Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_62901.319ON67167134790.0
AEL168C1.319ON67367316680.0
SAKL0D06930g1.319ON6907008891e-109
Suva_6.1371.319ON7187218172e-98
ZYRO0G20680g1.319ON6926997822e-93
Kwal_14.25801.319ON6876937636e-91
Smik_10.1791.319ON7137097631e-90
YJL061W (NUP82)1.319ON7137097525e-89
Skud_10.1581.319ON7167097422e-87
KAFR0A017201.319ON7166807212e-84
KLTH0H10692g1.319ON6917087183e-84
TDEL0D018801.319ON6916967018e-82
NCAS0A092101.319ON7107126887e-80
TBLA0F013101.319ON7427236732e-77
NDAI0G057501.319ON7346146013e-67
KLLA0F01661g1.319ON6877085914e-66
KNAG0C058401.319ON7477155655e-62
Kpol_1035.241.319ON7177305382e-58
CAGL0J05214g1.319ON7166775302e-57
TPHA0O014601.319ON7216034614e-48
TDEL0C01030singletonON33740742.4
KAFR0B052102.616ON79779724.3
Skud_7.4013.446ON18392687.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_6290
         (671 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...  1344   0.0  
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   647   0.0  
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   347   e-109
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   319   2e-98
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   305   2e-93
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   298   6e-91
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   298   1e-90
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   294   5e-89
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   290   2e-87
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   282   2e-84
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   281   3e-84
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   274   8e-82
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   269   7e-80
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   263   2e-77
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   236   3e-67
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   232   4e-66
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   222   5e-62
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   211   2e-58
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   208   2e-57
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   182   4e-48
TDEL0C01030 Chr3 complement(173571..174584) [1014 bp, 337 aa] {O...    33   2.4  
KAFR0B05210 Chr2 (1069638..1072031) [2394 bp, 797 aa] {ON} Anc_2...    32   4.3  
Skud_7.401 Chr7 complement(678698..679249) [552 bp, 183 aa] {ON}...    31   7.0  

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score = 1344 bits (3479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/671 (97%), Positives = 654/671 (97%)

Query: 1   MTGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHSE 60
           MTGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHSE
Sbjct: 1   MTGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHSE 60

Query: 61  HSILNNSGTLIAFYGSNDVELFDMDGKKSCLRVELGIKQVLWHPLAYLDSCLVVLTKENT 120
           HSILNNSGTLIAFYGSNDVELFDMDGKKSCLRVELGIKQVLWHPLAYLDSCLVVLTKENT
Sbjct: 61  HSILNNSGTLIAFYGSNDVELFDMDGKKSCLRVELGIKQVLWHPLAYLDSCLVVLTKENT 120

Query: 121 IELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGDVYAL 180
           IELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGDVYAL
Sbjct: 121 IELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGDVYAL 180

Query: 181 HPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMIDKDSE 240
           HPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMIDKDSE
Sbjct: 181 HPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMIDKDSE 240

Query: 241 FFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILS 300
           FFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILS
Sbjct: 241 FFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILS 300

Query: 301 LFPDIELLMSWSRSLNNACSFVLIEKFRAGGEIFAIESGVAILEKNNAHIVRFPYLKALG 360
           LFPDIELLMSWSRSLNNACSFVLIEKFRAGGEIFAIESGVAILEKNNAHIVRFPYLKALG
Sbjct: 301 LFPDIELLMSWSRSLNNACSFVLIEKFRAGGEIFAIESGVAILEKNNAHIVRFPYLKALG 360

Query: 361 ECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWNEPSTKGILFIGNSVIRSIPDDVGLSS 420
           ECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWNEPSTKGILFIGNSVIRSIPDDVGLSS
Sbjct: 361 ECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWNEPSTKGILFIGNSVIRSIPDDVGLSS 420

Query: 421 FKPRVDPAISQNGKYTVCFPSTMEELLKTNKALQHTLRQPLPLVPLEQKNVPLNSEFNEH 480
           FKPRVDPAISQNGKYTVCFPSTMEELLKTNKALQHTLRQPLPLVPLEQKNVPLNSEFNEH
Sbjct: 421 FKPRVDPAISQNGKYTVCFPSTMEELLKTNKALQHTLRQPLPLVPLEQKNVPLNSEFNEH 480

Query: 481 QLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKS 540
           QLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKS
Sbjct: 481 QLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKS 540

Query: 541 LTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNE 600
           LTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNE
Sbjct: 541 LTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNE 600

Query: 601 YVLQNSXXXXXXXXXXXXXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLA 660
           YVLQNS                 SNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLA
Sbjct: 601 YVLQNSKLCEELNFLKKELELIESNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLA 660

Query: 661 AAKDLENKLYI 671
           AAKDLENKLYI
Sbjct: 661 AAKDLENKLYI 671

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/673 (47%), Positives = 453/673 (67%), Gaps = 2/673 (0%)

Query: 1   MTGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHSE 60
           MTG+ HPIF         +LH H   + T+IV  ++K+LR  R TE T+KS H ++    
Sbjct: 1   MTGELHPIFNADALGASHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAEVDAKA 60

Query: 61  HSILNNSGTLIAFYGSNDVELFDMDGKKSCLRVELGIKQVLWHPLAYLDSCLVVLTKENT 120
            SILN SG+L+AFYG + +E+ D +GKK  L V  GIKQVLWHPLAYLDSCLVVLT + T
Sbjct: 61  SSILNGSGSLLAFYGDHIIEVVDREGKKITLTVNGGIKQVLWHPLAYLDSCLVVLTGQET 120

Query: 121 IELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGDVYAL 180
           IE+YEL +  +  PT+VLNE   QLGISS V +I ++AF+PDGL+LYL S  EGGDV+ +
Sbjct: 121 IEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAPDGLSLYLFSTSEGGDVHVI 180

Query: 181 HPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMIDKDSE 240
            PLLPSR++  R+ W  QW KATALY ++ KDTP++ K+A IE+ +FV+++ + I+K+  
Sbjct: 181 CPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVATIEYLEFVTQLLQAIEKNGS 240

Query: 241 FFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILS 300
             ++ IPEH+R    +GP++I+GFPE+LY+   TKL  +P+ +  A++L+LSFDD T + 
Sbjct: 241 DGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVPLGESEAHLLLLSFDDSTNIL 300

Query: 301 LFPDIELLMSWSRSLNNACSFVLIEKFRAGGEIFAIESGVAILEKNNAHIVRFPYLKALG 360
           LFP  E+LMSW++ L NA + +L+E+F A G  FA   GVA+L  ++A  V  PYL+AL 
Sbjct: 301 LFPSTEVLMSWTKDLKNAYTLMLVEEFTATGTAFATCDGVAVLGIDSAQRVEIPYLQALE 360

Query: 361 ECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWNEPSTKGILFIGNSVIRSIPD-DVGLS 419
           +CI++ ++A + D+  TS I  + G +H+V  +N P  KGI+ +G+   + +P  +   S
Sbjct: 361 DCIRDCNLAALQDINFTSSICKIPGKFHSVARFNAPGNKGIILVGDHHAKIVPSTEAAKS 420

Query: 420 SFKPRVDPAISQNGKYTVCFPSTMEELLKTNKALQHTLRQPLPLVPLEQKNVPLNSEFNE 479
             +  +D    +   YTVCFP+++EE+L TNK LQ    QPLPLVP   KN+PLNS+ NE
Sbjct: 421 DTETELDSQPGKEPTYTVCFPNSLEEILNTNKELQRRKHQPLPLVPPALKNIPLNSDLNE 480

Query: 480 HQLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTK 539
             LATLT IS EVMDRIIL+QS G LM+NR + QQ+EL RQ+ETV+ +  R   L+ +++
Sbjct: 481 QHLATLTNISKEVMDRIILSQSAGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSE 540

Query: 540 SLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFN 599
           +++ RL SV K+D  L+ RL  LQ +L+++N S KF++LPLS KE  WFRELKN  ++FN
Sbjct: 541 AMSSRLTSVLKRDRRLKQRLCMLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFN 600

Query: 600 EYVLQNSXXXXXXXXXXXXXXXXXSN-HGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQL 658
           +YVLQ++                  +   +   EE F+F +LQ+LL LDSK+I +C D L
Sbjct: 601 DYVLQSAQLRDELAFLKNELESLPEHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNL 660

Query: 659 LAAAKDLENKLYI 671
            AAA++LE KL I
Sbjct: 661 SAAARELERKLCI 673

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  347 bits (889), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 231/700 (33%), Positives = 364/700 (52%), Gaps = 41/700 (5%)

Query: 1   MTGDPHPIFQ-VPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHS 59
           M+ + HPIFQ +   +      +   ++  ++V      +R        ++     I   
Sbjct: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTV 60

Query: 60  EHSILNNSGTLIAFYGSNDVELFDMDG------------KKSCLRVELGIKQVLWHPLAY 107
             + LNNSGTL+  Y   ++++  +                  + V+  IKQV WHP   
Sbjct: 61  AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGK 120

Query: 108 LDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLY 167
           LDS  VVL K++TI +YEL   +F  PT VLN    QLG++SH+++I SM FS DGL LY
Sbjct: 121 LDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALY 180

Query: 168 LLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDF 227
           LL+  EGGDVYAL+P LPS L I     E  +YK+   YE++  D     K  +I+   F
Sbjct: 181 LLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQF 240

Query: 228 VSKIYKMIDKDSEFFD--------VNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITL 279
           VS+++K     SE  D         NI E  R    +GPF+I  F E+LY+ TAT++ T+
Sbjct: 241 VSRLHKQY--KSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTM 298

Query: 280 PVNDEGAYVLILSFDDGTILSLFPDIELLMSWSR---SLNNACSFVLIEKFRA-GGEIFA 335
           P+ DE   ++++ FD+GTIL  F D++L M W     S NN  S V++E      G+I  
Sbjct: 299 PI-DEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNN--SLVVLESLDILSGQIIC 355

Query: 336 IE-SGVAILEKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWN 394
           +     A+L   +  +    + KAL ECI   ++  +  + + S ITP+ G++     W 
Sbjct: 356 LTPHKFAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWE 415

Query: 395 EPSTKGILFIGNSVIRSI----PDDVGLSSFKPRVDPAISQNGKYTVCFPSTMEELLKTN 450
               K ++F+ +  ++SI    P+     +    V P      KY   F   + E+L  N
Sbjct: 416 SNGEKQLIFMSDKSVKSITLPEPNKTK-DAVSKTVQPVTE--VKYEPVFSQPIGEILLLN 472

Query: 451 KALQHTL-RQPLPLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNR 509
           K  Q    R    ++P    ++PL ++ NE QLA LT IS EV  +II  Q+LG L++NR
Sbjct: 473 KKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNR 532

Query: 510 AATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKV 569
              Q++EL RQLE  S++  ++  L++       R + VSKK   + SR EKLQ  L+++
Sbjct: 533 LFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEI 592

Query: 570 NESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXXXXXXXXXXXSNHGNI 629
           + S K  +L +S +E  WF+E+K+ V  FN++V+Q                   +    +
Sbjct: 593 SSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQ--DVKEQLEFVQSELKTAGERRV 650

Query: 630 PNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLENKL 669
             E++F++ +LQ+LL++DS++I +CN+ L+ AAK+L+ K+
Sbjct: 651 SKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKELDEKI 690

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  319 bits (817), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 223/721 (30%), Positives = 363/721 (50%), Gaps = 74/721 (10%)

Query: 7   PIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARV----TEHTFK-SKHLDIKHSEH 61
           PIFQ       S  ++    N T++V   D  +R+  +    + H+   S+HL +  + H
Sbjct: 11  PIFQASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFSRHLVLDDTFH 70

Query: 62  SILNNSGTLIAFYGSNDVELFDMD-------------------GKKSCLRVELG----IK 98
           +I + SG L+ FY   D E+F M+                      S   +ELG    IK
Sbjct: 71  AISSASGDLLCFYS--DQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNSPIK 128

Query: 99  QVLWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMA 158
           +VL+HP +Y DSC+VVL  ++TI ++++   N     ++LN++    G+ + V++I   A
Sbjct: 129 KVLFHPKSYNDSCIVVLKNDDTITMFDIL--NQQEAPIILNKRNSSFGLDARVNDITDFA 186

Query: 159 FSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKK 218
           FS DGLTLY L+  EGGD++A +P LPS L +          K+  +YES++  T  + K
Sbjct: 187 FSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTDYKVK 246

Query: 219 IAMIEHFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLIT 278
             + +   FVSK++K  + DS+   V I +  R+V  +GPF+I  FP ELY+ TA+K+ T
Sbjct: 247 RNITKQLQFVSKLHK--NWDSKLAKVKIDDEYRLVKMQGPFTINPFPNELYDFTASKITT 304

Query: 279 LPVNDEGAYVLILSFDDGTILSLFPDIELLMSWSRS---LNNACSFVLIEKFRA------ 329
           +P++++   ++ +SFDDG+++ LF D+E+ MSW       NN  S +LIE+ +       
Sbjct: 305 IPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNN--SLILIERIKLQQKEMK 362

Query: 330 ---------GGEIFAIESGVAILEKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDI 380
                    G     +ES V  L+  +       +   L +CI E D+  + DVK  S  
Sbjct: 363 SLTALPDQLGKLYVTLESSVHQLDCTS-------WTSVLSKCIDESDLNALADVKFVSKF 415

Query: 381 TPLAG----SYHTVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKP------RVDPAIS 430
             +A     S    + WN+ S+  ++      I++I +     S          V+   S
Sbjct: 416 EDIATIHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKS 475

Query: 431 QNGK--YTVCFPSTMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTK 487
             GK  Y + F   + E+L  N++ Q     P   ++P   + +PL +E NE+QL   T 
Sbjct: 476 DTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTD 535

Query: 488 ISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDS 547
           IS E + +II AQSLG  +YNR   QQFEL RQL++ SK+  +   L++  ++ T + +S
Sbjct: 536 ISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNS 595

Query: 548 VSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSX 607
            S +   L +R  KL ++L KV ES KF E  +S  E  WF+E++N +L FN +V     
Sbjct: 596 QSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKS 655

Query: 608 XXXXXXXXXXXXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLEN 667
                           S   N   +    +++L+ +L +DSK+I +CN++L+  ++ L  
Sbjct: 656 IQQDLSYLKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQLTT 715

Query: 668 K 668
           K
Sbjct: 716 K 716

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  305 bits (782), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 210/699 (30%), Positives = 354/699 (50%), Gaps = 45/699 (6%)

Query: 1   MTGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLD--IKH 58
           M+   H IF+       SK  +   ++ +++V   D ++R+    +  ++   L+  I+ 
Sbjct: 1   MSIGSHSIFKRASGS--SKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIED 58

Query: 59  SEHSILNNSGTLIAFYGSNDVELFDMDGKKSCL--------------RVELGIKQVLWHP 104
            EH +L+ +GTL+  Y S +V + ++    S +              R +  IK+VL+HP
Sbjct: 59  VEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHP 118

Query: 105 LAYLDSCLVVLTKENTIELYELAKANFMYPTV-VLNEKLPQLGISSHVSEICSMAFSPDG 163
           LAY + C+V+L  +NTI L +        P + VLN+     G+   V++I S+ FS DG
Sbjct: 119 LAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDG 178

Query: 164 LTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIE 223
           LTLY LS+ EG D+YA +P LP  + I     +   +K+   YE++  +TP+  K   I+
Sbjct: 179 LTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIK 238

Query: 224 HFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVND 283
            F F+SK+ + ++ D     ++IP     V  +GPF+I  FP+  Y+ TA +L  LP+  
Sbjct: 239 QFQFISKLRQGLENDQT--KIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGA 296

Query: 284 EGAYVLILSFDDGTILSLFPDIELLMSW-SRSLNNACSFVLIEKFRAGGEIFAIESGV-- 340
               +L++SFDDGTI+ L+ D+EL M W S+  +   S VL+E  R       ++ G   
Sbjct: 297 NND-LLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGTLS 355

Query: 341 ---AILEKNNAHIV-RFPYLKALGECIKEGDIAPMVDVKLTSDITPLAG-----SYHTVV 391
               +   ++ ++V   P+ K L  CI   D+ P+ D++  S+I+ + G     SY    
Sbjct: 356 QFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWK 415

Query: 392 TWNEPS----TKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGKYTVCFPSTMEELL 447
              EP     +K  +F+ ++ +   P  V     K  VD       +Y V     M E+L
Sbjct: 416 KDTEPKDVFVSKDTVFVKSTAVNDQPSTVK-DEKKANVDIP-----RYEVALNQPMSEIL 469

Query: 448 KTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLM 506
             N + Q   ++PL  LV   ++   LN+E NE QL  LT +S E + +I+ AQ+LG+ +
Sbjct: 470 SLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNL 529

Query: 507 YNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSL 566
           +NR   QQ+EL RQL+  S++  +   L+   +S +   +S  ++   L  R   L + L
Sbjct: 530 HNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKL 589

Query: 567 DKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXXXXXXXXXXXSNH 626
            ++NESPKF E+ ++ KE AWF+E++N VL FN+YV                        
Sbjct: 590 GRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLED 649

Query: 627 GNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665
            ++  +    + +L  +L  D+K+I +CN+QL  A+ ++
Sbjct: 650 KDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEV 688

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  298 bits (763), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 217/693 (31%), Positives = 349/693 (50%), Gaps = 32/693 (4%)

Query: 1   MTGDPHPIFQVPPFRT-LSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHS 59
           M  + HPIF      +  S+  V     A++        LR+     H ++    + +  
Sbjct: 1   MIPESHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLEFEPRID 60

Query: 60  EHSI-LNNSGTLIAFYGSNDVELFDM--DGKKS---CLRVELGIKQVLWHPLAYLDSCLV 113
             S+ +N SG+L+  Y S  V++  +  D  KS    +    GIKQ LWHP   L SCL 
Sbjct: 61  YTSVVINESGSLLCLYNSKQVQILAVSWDESKSDTILISPPAGIKQALWHPRGRLGSCLA 120

Query: 114 VLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEE 173
           VLT ++ I LYEL   ++  PT +LN    +LG+ S V +I SM+FS DGLTLYLLS  E
Sbjct: 121 VLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSMSFSSDGLTLYLLSTSE 180

Query: 174 GGDVYALHPLLPSRLRIKRSFWESQWYKATALYESI-DKDTPNEKKIAMIEHFDFVSKIY 232
           G D+Y+++P LPS + I  +  +S + KA   Y+ + D D+P+ ++  + +   FVSK+ 
Sbjct: 181 GADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRR-KVTKQLQFVSKLQ 239

Query: 233 KMID-KDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLIL 291
           K  D KD+E   V I +  R    +GPF+I  FP+ LY  T  ++  + +    A +L++
Sbjct: 240 KKNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEVIKLQGCAAELLLI 299

Query: 292 SFDDGTILSLFPDIELLMSWS-RSLNNACSFVLIEKFRAGGEIFAIESGVAILEKNNAHI 350
           SFDDGTIL  FPD E +MSW         S +++     GGEI A+ +G   +  ++A +
Sbjct: 300 SFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNIGGEI-ALVNGYTFVVLSSAKV 358

Query: 351 VRFPYLKALGECIK----EGDIAPMVDVKLTSDITPLAGSYHTVVTWNEPSTKGILFIGN 406
             F  L+ L + I+    + DI+   +  L+ ++    G + + +         +  +  
Sbjct: 359 T-FVSLRKLAQVIESSLNDCDISYFDEADLSEEVVEKNGRFCSAIICASSEKSCVALLSE 417

Query: 407 SVIRSIPDDVGLSSFKPRVDPAISQNGKYTV----CFPSTMEELLKTNKALQHTLRQPLP 462
           +    I  D+  S   P++  A+    K  V     +   + E+L  N+ +Q  L++PL 
Sbjct: 418 TTTSHI--DIPFSLDAPKMRTALG-TAKTDVEQYRPYGQPLNEVLALNEKVQALLKKPLQ 474

Query: 463 L-VPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQL 521
             V    +   LN+E NE QL+ LT IS EVM RI  AQ+L   +Y R + QQ EL + L
Sbjct: 475 TGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTLALSLYLRLSCQQGELTQHL 534

Query: 522 ETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLS 581
           ETVSK+ +    + +  K  + R ++   K+ ++ SRLE++   L +V+ S KF   P+S
Sbjct: 535 ETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQISSKLKQVSSSGKFQSQPIS 594

Query: 582 MKERAWFRELKNDVLAFNEYVLQN-------SXXXXXXXXXXXXXXXXXSNHGNIPNEEL 634
             E  WF+E+++ V+ FN  V +        S                 S   +  N++ 
Sbjct: 595 NHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELEYVHVESKEGKSGSSSADNKDE 654

Query: 635 FNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLEN 667
             +++L+ LL  D ++IG+C D L   AK L++
Sbjct: 655 VPWDELRALLAKDLRIIGECQDSLQGVAKQLDS 687

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  298 bits (763), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 208/709 (29%), Positives = 354/709 (49%), Gaps = 55/709 (7%)

Query: 7   PIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTE----HTFK-SKHLDIKHSEH 61
           PIFQ     + S  ++   +N T+IV   D  +R+  V      H+   S+HL +  + H
Sbjct: 11  PIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTFH 70

Query: 62  SILNNSGTLIAFYGSNDVELFDMDG-------------------KKSCLRVELG----IK 98
            I + SG L+ F+  ND E+F M+                      S    ELG    IK
Sbjct: 71  VISSTSGDLLCFF--NDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIK 128

Query: 99  QVLWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMA 158
           +VL+HP +Y DSC+VVL + +TI ++++   N     ++LN+     G+ + +++I  + 
Sbjct: 129 KVLFHPKSYHDSCIVVLKENDTIIMFDIL--NQQEKPIILNKPNNSFGLDARLNDITDLV 186

Query: 159 FSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKK 218
           FS DGLTLY L+  EGGD++A +P LPS L +  +       K+  +YES+D  T    K
Sbjct: 187 FSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVK 246

Query: 219 IAMIEHFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLIT 278
             +I+   FVSK+++  + DS+   V+I    R+V  +GPF+I  FP ELY+ TA  + T
Sbjct: 247 RNIIKQLQFVSKLHE--NWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAKNIAT 304

Query: 279 LPVNDEGAYVLILSFDDGTILSLFPDIELLMSWSRSLNNAC---SFVLIEKFRAGGEIFA 335
           + ++++   +  +SFDDG+++ L  D+E+ MSW   + N     S VLIE+ +   EI +
Sbjct: 305 ISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWD--VGNYVYNDSLVLIERVKMQKEIES 362

Query: 336 IES------GVAILEKNNAHIVR-FPYLKALGECIKEGDIAPMVDVKLTSDITPLAGSYH 388
           + +       + +  KN  + V    +   + +CI E D+ P+ D+K  S I  +A    
Sbjct: 363 LITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVEG 422

Query: 389 ----TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNG----KYTVCFP 440
                 + WN  S   +        +++  D  + S +   D    ++G    +Y + F 
Sbjct: 423 MPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELRFT 482

Query: 441 STMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILA 499
             + E+L  N+  Q     P   ++P   + +PL +E +E+QL   T +S E + +I  A
Sbjct: 483 QPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKA 542

Query: 500 QSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRL 559
           QSLG  +YNR   QQ EL RQL++  K+  + V L++  ++   + D+   +   L  R 
Sbjct: 543 QSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERF 602

Query: 560 EKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXXXXXXX 619
            KL ++L ++++S KF E  +S  E  WF+E++N +L FN YV                 
Sbjct: 603 SKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKREL 662

Query: 620 XXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLENK 668
               +    +  +    + +L+ +L +DSK+I +CN++L  A++ L  K
Sbjct: 663 TRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTK 711

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  294 bits (752), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 206/709 (29%), Positives = 354/709 (49%), Gaps = 55/709 (7%)

Query: 7   PIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFK-----SKHLDIKHSEH 61
           PIFQ     + S  ++   +N T+IV   D  +R+  V   +       S+HL +  + H
Sbjct: 11  PIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFH 70

Query: 62  SILNNSGTLIAFYGSNDVELFDMD---GKKSCLRV----------------ELG----IK 98
            I + SG L+  +  ND E+F M+   G  +   V                E+G    IK
Sbjct: 71  VISSTSGDLLCLF--NDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIK 128

Query: 99  QVLWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMA 158
           +VL+HP +Y DSC+VVL +++TI ++++   N     +VLN+     G+ + V++I  + 
Sbjct: 129 KVLFHPKSYRDSCIVVLKEDDTITMFDIL--NSQEKPIVLNKPNNSFGLDARVNDITDLE 186

Query: 159 FSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKK 218
           FS DGLTLY L+  EGGD++A +P LPS L +          K+  +YES+D  T    K
Sbjct: 187 FSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVK 246

Query: 219 IAMIEHFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLIT 278
             +I+   FVSK+++  + +S F  V+I +  R+   +GPF+I  FP ELY+ TAT + T
Sbjct: 247 RNVIKQLQFVSKLHE--NWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIAT 304

Query: 279 LPVNDEGAYVLILSFDDGTILSLFPDIELLMSW---SRSLNNACSFVLIEKFRAGGEIFA 335
           + +++    ++ +SFDDG+++ LF D+E+ MSW   +   NN  S VLIE+ +   EI +
Sbjct: 305 ILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNN--SLVLIERVKLQREIKS 362

Query: 336 IES------GVAILEKNNAHIVRF-PYLKALGECIKEGDIAPMVDVKLTSDITPLAGSYH 388
           + +       + ++  N    V F  +   L +CI E D+ P+  +K  S +  +A    
Sbjct: 363 LITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIER 422

Query: 389 ----TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGK----YTVCFP 440
                 + WN+ S   ++       ++I  D+   S       +  ++      + + F 
Sbjct: 423 IPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMSFT 482

Query: 441 STMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILA 499
             + E+L  N   Q     P   ++P   + +PL +E +E+QL   T IS E + RI+ A
Sbjct: 483 QPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIVKA 542

Query: 500 QSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRL 559
           Q+LG  ++NR   QQFEL RQL++  K+  +   L++  ++   + D+   +   L  R 
Sbjct: 543 QTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELMERF 602

Query: 560 EKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXXXXXXX 619
            KL + L ++ ES KF E  +S  E  WF+E++N +L FN +V                 
Sbjct: 603 SKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKSEL 662

Query: 620 XXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLENK 668
               +    +  +    +++L+ +L +DSK+I +CN++LL  +++   K
Sbjct: 663 TRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTK 711

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  290 bits (742), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 209/709 (29%), Positives = 360/709 (50%), Gaps = 61/709 (8%)

Query: 7   PIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYAR-VTEHTFKS----KHLDIKHSEH 61
           PIFQ     + S  ++    N T++V   D  +R+   +TE +++S    +HL +  +  
Sbjct: 11  PIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTFR 70

Query: 62  SILNNSGTLIAFY------------GSNDVELFDMDGKKSCLRVELG---------IKQV 100
            I + SG L+ F+            G N++E   +          +G         IK+V
Sbjct: 71  VISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKV 130

Query: 101 LWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFS 160
           L+HP +Y DSC+VVL +++TI ++++   N  +  +VLN++    G+ + V++I  +AFS
Sbjct: 131 LFHPKSYHDSCIVVLKEDDTITMFDIL--NQQHKPIVLNKRSNSFGLDARVNDITDLAFS 188

Query: 161 PDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIA 220
            DGLTLY L+  EGGDV+A +PLLP  L +          K+  +YES+D  T    K  
Sbjct: 189 RDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRN 248

Query: 221 MIEHFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLP 280
           +I+    VSK+++ +D  S+   V I E  R+V  +GPF+I  FP+ELY  TA  + T+P
Sbjct: 249 IIKQLQLVSKLHENLD--SQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIP 306

Query: 281 VNDEGAYVLILSFDDGTILSLFPDIELLMSWSRSLNNAC---SFVLIEKFR-AGGEIFAI 336
           +++    ++ + FDDG++  LF D+E+ MSW   ++N     S VLIE+ +    +I ++
Sbjct: 307 IDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWD--VDNYVHNNSLVLIERIKIQETDIKSL 364

Query: 337 ES------GVAILEKNNAHIVRFPYLKA-LGECIKEGDIAPMVDVKLTSDITPLAGSYH- 388
           ++       + +  +N+ H +      A L  CI+E D+  + DVK  S +  +    H 
Sbjct: 365 KTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHP 424

Query: 389 ---TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFK-------PRVDPAISQNGK-YTV 437
                ++WN+ S   +   G    ++I +D  L + K        R+D      GK Y +
Sbjct: 425 SNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDA-----GKHYEM 479

Query: 438 CFPSTMEELLKTNKALQHTLRQPL-PLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRI 496
            F   + E+L  N++ Q     P   ++P   + +PL +E +E+QL   T IS E + +I
Sbjct: 480 SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKI 539

Query: 497 ILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALR 556
           I AQSLG+ +YNR   QQFEL RQL+  SK+  +   L++   +   + D+   + + L 
Sbjct: 540 IKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLM 599

Query: 557 SRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXXXX 616
            R +KL ++L ++ ES K  E  ++  E  WF+E++N +L FN +V              
Sbjct: 600 ERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMK 659

Query: 617 XXXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665
                  +       +    +++L+ +L  DSK+I +CN++L+  ++ L
Sbjct: 660 KELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQL 708

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  282 bits (721), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 202/680 (29%), Positives = 347/680 (51%), Gaps = 51/680 (7%)

Query: 29  TQIVTCFDKN-LRYARVTEHTFKSKHL---DIKHSEHSILNNSGTLIAFYGSNDVELFDM 84
            Q  + + KN LR+  V    + S  L   D    E+ I++NSG  +  Y    + L ++
Sbjct: 43  AQDSSIYKKNQLRWGSVASSQYHSLPLLFFDDSAYENVIISNSGQFLCLYDKKSLSLIEI 102

Query: 85  ----DG-----KKSCLRV------ELGIKQVLWHPLAYLDSCLVVLTKENTIELYELAKA 129
               DG     K S  RV         IK++L+HP A  D C+V+L + + I L++L K+
Sbjct: 103 PWGYDGAVTSIKSSFQRVFRDVNKSSDIKKILFHPKAADDGCVVILFENDVICLFDLRKS 162

Query: 130 NFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGDVYALHPLLPSRLR 189
             ++    LN+   +LGI + V++I  M FS DGLTLY+LS+ +GGD+YA +P LP +L 
Sbjct: 163 EKLF----LNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLS 218

Query: 190 IKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMIDKDSEFFDVNIPEH 249
           +K+S  E  + K+  LY+S+D     E +  +++   F++ +      +++   + I   
Sbjct: 219 LKKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDSSSDETKNSCLEISND 278

Query: 250 KRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLM 309
            R V  +GPF++  +PE+LY  TA ++ TL + +    +  ++FD+GT+  L  D+EL M
Sbjct: 279 FRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNNE-LFAITFDNGTVTLLLKDLELSM 337

Query: 310 SWSRS---LNNACSFVLIEKFRAGGEIFAI-----ESGVAILEKNNAHIVRF---PYLKA 358
           SW+      NN  SFVLIE    G E   +      +G   + +N++ + +     +   
Sbjct: 338 SWNADNYVYNN--SFVLIESVEMGPESIKLLKSSSLTGQMFISQNHSSVRKIDTTAWSFK 395

Query: 359 LGECIKEGDIAPMVDVKLTSDITPL--AGSYHTVVTWNEPSTKGILFIGNSVI--RSIPD 414
           + +CI   D+  ++DV   S I+ L    +      W+    +GILF+ NS +  R++P+
Sbjct: 396 VSKCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGILFVSNSSVISRTLPE 455

Query: 415 DVGLSSFKPRVDP-AISQN------GKYTVCFPSTMEELLKTNKALQHTLRQPL-PLVPL 466
               SSF  ++D  + S+N       KY V F   + E++  N + Q   R P   ++  
Sbjct: 456 --SDSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQPISEIMNLNDSFQRICRHPFKKIISP 513

Query: 467 EQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSK 526
           E++   L+++ NE QLATLT+IS +++  I+  QSLG ++ NR   QQ+EL +QL+   +
Sbjct: 514 EERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTKQLKESIQ 573

Query: 527 LNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERA 586
           L ++   LK +      R +   KK   L  R   L  +L K++ES + ++ P+S KE  
Sbjct: 574 LIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTPISEKEVE 633

Query: 587 WFRELKNDVLAFNEYVLQNSXXXXXXXXXXXXXXXXXSNHGNIPNEELFNFEKLQDLLTL 646
           WF+E++N +L FN++V  +                  S  G   +     + + + +L  
Sbjct: 634 WFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQRSSHLTSEWAEFKKILET 693

Query: 647 DSKMIGDCNDQLLAAAKDLE 666
           D+ +I +CN++L  A   L+
Sbjct: 694 DTNIIKECNEELTKAHTQLD 713

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  281 bits (718), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 202/708 (28%), Positives = 351/708 (49%), Gaps = 58/708 (8%)

Query: 1   MTGDPHPIFQVPPFRTLS-----KLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLD 55
           M  + HPIFQ    R+L      +L +H  K+ ++ +     +L++  +    ++   L+
Sbjct: 1   MLPEAHPIFQA---RSLGESRSERLCLHT-KDLSRTILLEGNSLKWCLMDAPNYEYMELN 56

Query: 56  -IKHSEHSILNNSGTLIAFYGSNDVELFDMDGKKSC-----LRVELGIKQVLWHPLAYLD 109
            I +   ++LN+SGTL+     +++++  +   ++      ++V  G+KQVLWHP   LD
Sbjct: 57  AISNYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLD 116

Query: 110 SCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLL 169
           SCL VL K + I LYEL   +F  PT VLN    +LG+ S V +I S+ FS DGLTLYL+
Sbjct: 117 SCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLM 176

Query: 170 SLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVS 229
           S+ EG DV++++P +PS L I R   +  + KA   Y+ + +    E K+       F+S
Sbjct: 177 SVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMS 236

Query: 230 KIYKMI-DKDSEFFDV----NIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDE 284
            +Y    D D    ++    +I +  R    +GPF+I  FPE+LY  TA ++  + + DE
Sbjct: 237 SLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIALEDE 296

Query: 285 GAYVLILSFDDGTILSLFPDIELLMSWSRSLNN-ACSFVLIEKFRAGGEIFAI-ESGVAI 342
              +L+++FDD TIL  FPD+  +MSW  S ++   S + +   +  G I  I  S   +
Sbjct: 297 TTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSISLIYGSCFVL 356

Query: 343 LEKNNAHIVRFPYL-KALGECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWNEPSTKGI 401
           +    A +V    L +++   + + D   + +  LT +IT   G++ +   W E   + I
Sbjct: 357 ISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPESGMQKI 416

Query: 402 LFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGKYTVC-------FPSTMEELLKTNKALQ 454
           + +    I SI     +SS +    PA S   K           +   + E+   N+ +Q
Sbjct: 417 VLLSEKEITSI----DISSMQT---PASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQ 469

Query: 455 HTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQ 513
             L+ PL  ++P   +   LN+  NE QL+ LT IS EV+ R+ LAQ+LG  ++ R   Q
Sbjct: 470 SLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTLGLSLHLRLLGQ 529

Query: 514 QFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESP 573
           Q EL + L  VS+L  +   +  +  S   R +++ +K+ ++  R E L +++ ++++S 
Sbjct: 530 QDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSS 589

Query: 574 KFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXX--------------XXXXXXXX 619
           +    P++  E  WF+EL+N V+ FN  V +                             
Sbjct: 590 QLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSLEYVRVDSAEAASRS 649

Query: 620 XXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLEN 667
                + G +P      +++LQ +L  DS++I +C  +L    ++L++
Sbjct: 650 KKSAESAGGVP------WDELQAMLAKDSRIIKECQAELQCTTQELDS 691

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  274 bits (701), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 193/696 (27%), Positives = 344/696 (49%), Gaps = 40/696 (5%)

Query: 1   MTGDPHPIFQVPPF--RTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLD--I 56
           MT + HPIF+ P    ++ S        +  + V   D  +R+  V+E  + S  L+   
Sbjct: 1   MTVETHPIFR-PSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAF 59

Query: 57  KHSEHSILNNSGTLIAFYGSNDV----------ELFDMDGKKSCLRV---ELGIKQVLWH 103
           K  +H +++NSG  +  Y  +++          E+  M       R    E  IKQVL+H
Sbjct: 60  KDVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFH 119

Query: 104 PLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDG 163
           PLAY    +V+L  +++I +          P V LN       + S ++++  + FS DG
Sbjct: 120 PLAYQQETVVILKDDDSITIMNWQDFGDSKPDV-LNLSNGTYSLDSSITDVECITFSQDG 178

Query: 164 LTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIE 223
           LTLY+LS+ EG D+YA +P L  R++  +   +   YK+   Y+ ++  T +E K   I+
Sbjct: 179 LTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIK 238

Query: 224 HFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVND 283
              FVS ++K   ++S+   + IPE +R V  +GPF+I  FP+++Y++T T + +LP+ND
Sbjct: 239 QLKFVSGLHKQ--QNSQRI-LEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPIND 295

Query: 284 EGAYVLILSFDDGTILSLFPDIELLMSW-SRSLNNACSFVLIEKFRAGGEIFAIESGVAI 342
           +   +LI+S DDG I  L  D+++ M+W S   N   SF L+E    G +   I+  V  
Sbjct: 296 QNE-LLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQ--EIQQIVVG 352

Query: 343 LEKNNAHIVRFP----------YLKALGECIKEGDIAPMVDVKLTSDIT--PLAGSYHTV 390
             K     V  P          +   +  C+ E D+ P+ + KL S++T   L  S  +V
Sbjct: 353 DHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPKSV 412

Query: 391 VTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGKYTVCFPSTMEELLKTN 450
             WN  + + ++ + N  ++S     G+S     +  +  +  KY   +   + E+++ N
Sbjct: 413 AWWN-TTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYSQPIAEIMQLN 471

Query: 451 KALQ-HTLRQPLPLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNR 509
           +  Q  + + P  ++P  ++  PL +E +E QL  LT+ S + + +I + Q+LG  ++NR
Sbjct: 472 QKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNR 531

Query: 510 AATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKV 569
              QQ +L  QL+   +L ++  T+  +  S + R D+V  +   L SR  K + +L ++
Sbjct: 532 IYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQI 591

Query: 570 NESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXXXXXXXXXXXSNHGNI 629
             S +F +L +S +E  WF+E++  VL FN  V                        G+ 
Sbjct: 592 QNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIAQVTGDQ 651

Query: 630 PNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665
            ++    + +L+ +L  D+ ++ DCN+QL +AA+ +
Sbjct: 652 NSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  269 bits (688), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 204/712 (28%), Positives = 350/712 (49%), Gaps = 63/712 (8%)

Query: 6   HPIFQ-VPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKHSE---- 60
           HPIFQ +   +  +   +    + T++V      LR+  VT  +F S  +D    E    
Sbjct: 10  HPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPESTAP 69

Query: 61  -HSILNNSGTLIAFYGSNDVELFDMD------GKKSCLRVEL------------GIKQVL 101
             +IL+NSG  I  Y ++ +E+ ++             + +L             IKQVL
Sbjct: 70  QKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQVL 129

Query: 102 WHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSP 161
           +HP AY DSCLVVL    TI L ++ +   +  T+ LN+++   GI + +++I S+ FS 
Sbjct: 130 FHPEAYKDSCLVVLYDNGTISLMDVTQ---ITKTITLNKRVATFGIDTQITDIESICFSK 186

Query: 162 DGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAM 221
           DG TLY LS+ +GGD+YA +P LP +L +KR    S  +++  LYES+  DT  + K  +
Sbjct: 187 DGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRNV 246

Query: 222 IEHFDFVSKIYKMI---DKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLIT 278
           I    FV+K+  ++   +K+S    + I +  R++  +GPF+I  +PE LY+ TA ++ T
Sbjct: 247 IRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALEIST 306

Query: 279 LPVNDEGAYVLILSFDDGTILSLFPDIELLMSW---SRSLNNACSFVLIEKFR------- 328
           LP+N     + ++ FDDG+I  LF D+ L MSW   +   NN+ S V + + +       
Sbjct: 307 LPINSNNELMCMI-FDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVKRI 365

Query: 329 -----AGGEIFAIESGVAILEKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPL 383
                  G+ F    G + L   + HI    +   L + I   ++  ++++  TS +   
Sbjct: 366 VSYPDTYGQFFIF--GDSSLFLVHTHI----WSDLLAKAIDNSNLNELLEMNFTSKLDFF 419

Query: 384 AGSYHTVVTWNEPSTKG---ILFIGNSVIRSIPDDVGLSSFKPRVDPAISQN-----GKY 435
             + + +   +    +G   ILFI    +   P ++  S       P +  N      +Y
Sbjct: 420 ETT-NGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQEY 478

Query: 436 TVCFPSTMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMD 494
              F   +EEL+  NK  Q      +  L+  E++ V LN+E NE QL  L+ +S EV+ 
Sbjct: 479 KTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEVIS 538

Query: 495 RIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIA 554
           +I   Q+L   +++R   QQ+EL RQL+ V  +  +   L++ ++  + R D  + +   
Sbjct: 539 KIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQ 598

Query: 555 LRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXX 614
           L  RL+ L   + ++N SPK  E P++ KE  WF+E++N VL FN +V            
Sbjct: 599 LIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNH 658

Query: 615 XXXXXXXXXSNHGNIPNEEL-FNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665
                         + +E+    +++L+D+L  D+++I +CN +LL+  + L
Sbjct: 659 LKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  263 bits (673), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 197/723 (27%), Positives = 346/723 (47%), Gaps = 64/723 (8%)

Query: 6   HPIFQ----VPPFRTLSKLHVHVCKNATQIVTCFDKNLRYA-----RVTEHTFKSKHLDI 56
           HPIF+       F+  S           ++V   D ++R+          +T  S++ DI
Sbjct: 18  HPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDI 77

Query: 57  KHSEHSILNNSGTLIAFYGSNDVELFDMDGKKS---------CL--------RVELGIKQ 99
           K S   +++NSG+ + +Y   D+ + ++    S         C+        +  L +KQ
Sbjct: 78  KDS---LISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLTVKQ 134

Query: 100 VLWHPLAYLDSCLVVLTKENTIELYELAKA-NFMYPTVVLNEKLPQLGISSHVSEICSMA 158
           VL+HPLA L+SCLVVL  ++TI   + +K+ + +    +LN+K   +G+SS +S+I S+ 
Sbjct: 135 VLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDYILNKKSKSIGLSSQISDIQSLT 194

Query: 159 FSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKK 218
           FS DGLTLY LS     DVYA +P LP   +      E+   K+   YE + +D P   K
Sbjct: 195 FSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALK 254

Query: 219 IAMIEHFDFVSKIYKM------IDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTT 272
           I +I+   F S +YK        D DS+ +  ++P   R++ P+GPF+I  FP+ LY ++
Sbjct: 255 INIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSLYYSS 314

Query: 273 ATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWSR-SLNNACSFVLIEKFRAGG 331
            T ++++P+ D    +L+LSF DG+++SLF D+EL MSW + + N   S VL+E  +   
Sbjct: 315 PTHIVSVPI-DTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKE 373

Query: 332 E------IFAIESGVAIL--EKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPL 383
           +       +A + G   +     N  ++   +   L  CIK  DI  + ++ + S I P 
Sbjct: 374 QNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPF 433

Query: 384 AGSYHTVVT---WNEPSTKGILFIGNSVIRSI--------PDDVG---LSSFKPRVDPAI 429
             + + + +   W  P+   +LFI  S +  +         DD      S    +  P +
Sbjct: 434 DNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTHLLTSELAQKYIPPL 493

Query: 430 SQNGKYTVCFPSTM--EELLKTNKALQHTLRQPLPL-VPLEQKNVPLNSEFNEHQLATLT 486
            ++  + +  P  +   +L   N   +    + L + +P +++NV L ++ NE+QL TLT
Sbjct: 494 -EDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLT 552

Query: 487 KISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLD 546
           KIS  +  +I + QSLG+ +YN+   QQ  +  QL    +L ++   L         +L 
Sbjct: 553 KISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYNEQADKLR 612

Query: 547 SVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNS 606
           + +++   L SRL  + + L K +       + +S KE  +F+E++  VL FNE+V +  
Sbjct: 613 AFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQK 672

Query: 607 XXXXXXXXXXXXXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLE 666
                              +  +   +   +++L+D+L  D+  I  C + +     DL+
Sbjct: 673 DQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIKNINFDLD 732

Query: 667 NKL 669
             L
Sbjct: 733 RAL 735

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  236 bits (601), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 171/614 (27%), Positives = 305/614 (49%), Gaps = 60/614 (9%)

Query: 97  IKQVLWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICS 156
           IKQVL+HP +Y ++CLV+L +++ I+L +   +     T+ +N+    LG+ + V +I S
Sbjct: 130 IKQVLFHPKSYHETCLVILYEDSIIQLIDTTAST---ETITINQPTGTLGVETRVIDIES 186

Query: 157 MAFSPD-GLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPN 215
           + F    GL LY LS+ +GGD+YAL+P LP+RL + +   +    K+  LY+S+ ++  N
Sbjct: 187 ICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSN 246

Query: 216 EKKIAMIEHFDFVSKIYKMI------DKDSE-----------FFDVNIPEHKRMVTPRGP 258
           + K  +I+   F +K+          +KD E             DV++    R+V  +GP
Sbjct: 247 DVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDL--EYRLVNFQGP 304

Query: 259 FSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWS-RSLNN 317
           F+I  FP ELY+ TA +   + +N E   +LI++FDDG++  LF D+EL MSW   +  +
Sbjct: 305 FTISPFPNELYSATAKESQCMKIN-ENNELLIMTFDDGSVALLFRDLELTMSWDIANYIH 363

Query: 318 ACSFVLIEKFRAG--------------GEIFAIESGVAILEKNNAHIVRFPYLKALGECI 363
             SF L+E  +                G+ F +   V +L   N+      +   L + I
Sbjct: 364 DNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNS------WSDKLAKAI 417

Query: 364 KEGDIAPMVDVKLTSDIT--PLAGSYHTVVTWNEPSTKGILFIGNSVI--------RSIP 413
            + ++  + ++   S+IT   + G ++          + I+F+ +  +         S+ 
Sbjct: 418 DDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMN 477

Query: 414 DDVGLSSFKPRVDPAISQNGKYTVCFPSTMEELLKTNKALQHTLRQPLP-LVPLEQKNVP 472
           +  G S+     + A S+   Y V F   ++EL+  N+  Q   R P   L+  E + + 
Sbjct: 478 NIKGSSTSNSNEETAESE---YKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIE 534

Query: 473 LNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSV 532
           L++E NE QL  LT +S E++ +II  Q+LG+ ++NR   QQ EL RQL+    + ++  
Sbjct: 535 LSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQD 594

Query: 533 TLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELK 592
            +K   K +  R +    + + L  RL+ L + L  +N+SP  +  P++  E  WF+E++
Sbjct: 595 CIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIR 654

Query: 593 NDVLAFNEYVLQNSXXXXXXXXXXXXXXXXXSNHGNIPNEELFN-FEKLQDLLTLDSKMI 651
           N V  FN +V                     ++  ++ +E+    +E+L+ +L  DSK+I
Sbjct: 655 NQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKII 714

Query: 652 GDCNDQLLAAAKDL 665
            +CN +L    + +
Sbjct: 715 KECNIELTKTTESM 728

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  232 bits (591), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 210/708 (29%), Positives = 333/708 (47%), Gaps = 72/708 (10%)

Query: 2   TGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKH-SE 60
           T D   IFQ        +L   VC N+  I    D  LR     E  ++S ++++    E
Sbjct: 6   TEDLKAIFQEVSLNPSDRL---VCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVPE 62

Query: 61  HSILNNSGTLIAFYGSNDVELFDMDGKKSCLR----VELGIKQVLWHPLAYLDSCLVVLT 116
             +++ SG L+AF+ ++++ + +++ ++S LR      LGIK++LWHPLA      V+L 
Sbjct: 63  QMVISPSGGLVAFHANSELYVMEVN-EQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILH 121

Query: 117 KENTIELYELAKANFMYP--TVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEG 174
            ++TI +Y+L     + P    V N K    G+S HV  +C +AF P GLTLYLLS    
Sbjct: 122 DDSTIRIYDLED---LEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNY 178

Query: 175 GDVYALHPLLPSRLRIKR-------------SFWESQWYKATALYESIDK--------DT 213
            D+YA+HP LP    ++              S  +   +K+ +LY S+DK        D 
Sbjct: 179 CDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDP 238

Query: 214 PNEKKIAMIEHFDFVSKIYKMID--KDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNT 271
             E     ++H D + +I +  D  K ++  D    +  R   P+GPF I  FP  L   
Sbjct: 239 DVESDYLTLKH-DLLKQI-QFFDNYKKNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAK 296

Query: 272 TATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWS-RSLNNACSFVLIEKFRAG 330
             T L  +PV  E   +L L F DGT + LF D E++MSWS RS     +  +I  F A 
Sbjct: 297 EVTGLTIIPVG-ERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAK 355

Query: 331 GE---IFAIESGVAILEKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPLAGSY 387
           G+   + + E  +     ++  I+  P+L+ L +CI+  D + + DVK  + I  ++G++
Sbjct: 356 GQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTF 415

Query: 388 HTVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKP--RVDPAISQNGKYTV--CFPSTM 443
             V++     +  IL+ GNS  + I  +   ++ KP  R D       KYT     P++ 
Sbjct: 416 LGVLS---TLSGDILYNGNS-FKVIESNDKSTTQKPINRTDEV-----KYTYKPSLPTSG 466

Query: 444 EEL---LKTNKALQHTLRQPLP--LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIIL 498
           +EL   L   K   +     +P  L PL     PL +  NE QL  ++++  E M R+ L
Sbjct: 467 KELDMLLTKYKTEANGFISGIPDSLAPL-----PLKNNSNERQLEVVSELYKETMKRVKL 521

Query: 499 AQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSR 558
            Q + + M+N++  +  EL RQL   +++      L  N   L  R     +K   L  R
Sbjct: 522 GQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKR 581

Query: 559 LEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYV-LQNSXXXXXXXXXXX 617
           L+KL+++   +  + K     +S  E  WF+ +KN VL FN YV L N            
Sbjct: 582 LDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNK---LREELEFL 638

Query: 618 XXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665
                 +  G+    EL  F  LQ +L  D K+I  C ++L A+ +DL
Sbjct: 639 DTQLRSTTKGDDFFSEL-EFSSLQQMLLNDKKVINSCMNELSASIEDL 685

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  222 bits (565), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 195/715 (27%), Positives = 333/715 (46%), Gaps = 82/715 (11%)

Query: 17  LSKLHVHVCKNATQIVTCFDKN--LRYARVTEHTFKSKHLDIKH----SEHSILNNSGTL 70
           LS  +V      T+ V     N  LR+  V+E  + S  L I +    S + IL++SG  
Sbjct: 36  LSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKISNFADKSVNVILSDSGEF 95

Query: 71  IAFYGSNDVELFDMDGKKSC--------------LRVELGIKQVLWHPLAYLDSCLVVLT 116
           +  Y  + V + ++  +                 +R +  IK+VL+HP A   +C+V+L 
Sbjct: 96  LCVYSKDCVTVIEVPWRYRNPEEMSYVFQTSFKEIRKDSFIKKVLFHPRAIKKTCMVILF 155

Query: 117 KENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGD 176
           +++TI L+++   N     + LN     +GI   ++ I  + FS DGLTLY+LS E+ GD
Sbjct: 156 EDDTIYLFDVEDNN----KIALNVPSGNIGIEDRITSIADIEFSQDGLTLYVLSAEDCGD 211

Query: 177 VYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMID 236
           VYA++P LP  L + +   +S   ++  LY+S+ + TP+  K  +I+  +F+S++  +  
Sbjct: 212 VYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVKKGVIKQVEFISQLQNISH 271

Query: 237 KDSEFFDV-NIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDD 295
              E  +V  I    R+  P+GPF+I  FPE+LY+ TAT++  L +   G  +L +++D+
Sbjct: 272 GKEEISNVLEIDTIYRLAKPQGPFTIAPFPEKLYSATATEICPLNIGG-GNEILCIAYDN 330

Query: 296 GTILSLFPDIELLMSWSRS---LNNACSFVLIEKFRAGGE---------------IFAIE 337
           GT L LF D+EL M+W       NN  S VL+E+F    E               +F + 
Sbjct: 331 GTALFLFKDLELSMAWDVGGIYYNN--SLVLMEEFDLQTESAVSILKSFKMDGLILFKVS 388

Query: 338 SGVAILEKNNAHI------------VRFPYLKA----LGECIKEGDIAPMVDVKLTSD-- 379
             V  ++ + + I            +R    KA    + +CI   DI  ++ V   S   
Sbjct: 389 DSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDCIDRHDINALITVSFKSKGH 448

Query: 380 ITPLAGSYHTVV-TWNEPSTKGILFIGNSVI--RSIPDDVGLSSFKPRVDPAISQNGKYT 436
              +AGS  T    WN   T+G+ +I N  +  + +   V   S+KP      + + K  
Sbjct: 449 TWAIAGSDITSCGAWNHGGTEGVTWITNKSVTCKELKKQV---SWKPEQS---TSSEKKK 502

Query: 437 VCFPST-----MEELLKTNKALQHTLRQPLP--LVPLEQKNVPLNSEFNEHQLATLTKIS 489
             FP       + EL   N   Q T R      + PL+++  PL +  NE QL  +T +S
Sbjct: 503 QAFPKPEFSVPISELNALNINYQDTCRIGFHDIISPLDRQK-PLLNPSNEKQLQVMTSLS 561

Query: 490 TEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVS 549
             ++  +   Q LG  +YNR   QQ EL +QL+  +K+  +   + +  +      +   
Sbjct: 562 NYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQPAIAKKLEEQKSVWNEKL 621

Query: 550 KKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSXXX 609
            K   L+ R   LQQ L  ++++ K  +L ++ +E  WF+E+K + L FN+ V +     
Sbjct: 622 AKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVKKEALTFNDLVYKQESVQ 681

Query: 610 XXXXXXXXXXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMI-GDCNDQLLAAAK 663
                         S+   +P      +  LQ++L  DS ++  D  D+  A+++
Sbjct: 682 DDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEMLKHDSLLLRADKKDKKDASSQ 736

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  211 bits (538), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 201/730 (27%), Positives = 336/730 (46%), Gaps = 81/730 (11%)

Query: 1   MTGDPHPIFQVPPF-RTLSKLHVHVCKNATQIVTCFDKNLRYARVTEH------TFKSKH 53
           M+ + +PIF+ P   R L+K       N T+I+   D  +R++  +++        +   
Sbjct: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60

Query: 54  LDIKHSEHSILNNSGTLIAFYGSNDVELFDM-----------DGKKSCL--RV------E 94
           +D+  +   I+++ G  +  Y S+ + + ++           +   S L  RV      +
Sbjct: 61  MDVTGA---IISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDK 117

Query: 95  LGIKQVLWHPLAYLDSCLVVLTKENTIELYELA---KANFMYPTVVLNEKLPQ-LGISSH 150
           L +KQVL+HPL+     LVVL   + I   +L    K++ +     LN      +GI + 
Sbjct: 118 LSVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNR 177

Query: 151 VSEICSMAFSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESID 210
           V  I  + F+ D L+LY L+     DVY  +P LP    + ++  +    K+  LYE++ 
Sbjct: 178 VENIQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLG 234

Query: 211 KDTPNEKKIAMIEHFDFVSKIYKMIDKDSEF--------FDVNIPEHKRMVTPRGPFSIY 262
            D  +  +  +I+     S + K I+   EF         +V I    R    +G FSI 
Sbjct: 235 IDADDIVRKNVIKQLQLASSLRKKIE---EFENANGEVEVNVEIDLEFRQTKAQGYFSIS 291

Query: 263 GFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWS---RSLNNAC 319
            +PE LY  T  ++  LP+  EG  + ++SFD+GT+L +F D E  MSW     S NN+ 
Sbjct: 292 PYPESLYTCTGKQISVLPIG-EGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSF 350

Query: 320 SFVLIEKFR----AGGEIFAIESGVAIL--EKNNAHIVRFPYLKALGECIKEGDIAPMVD 373
           + V I KF+    +   +   E G  ++  EK+   +    +   + +CI++ D+ P+V 
Sbjct: 351 TLVEIIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVG 410

Query: 374 VKLTSDITPLAGSYH--TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQ 431
           +++ S IT +       +   WN    K +L +  +V+           FKP     IS 
Sbjct: 411 LEMKSTITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEIST 470

Query: 432 N------GKYTVCFPSTMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLAT 484
                   K+TV  P    EL   N   Q  +  P   ++P   K VP  S   E QL  
Sbjct: 471 ELENFTLDKFTV--PEN--ELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKI 526

Query: 485 LTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCR 544
           L  IS +V  +I+  QSLG ++Y+R   QQ +L  QL   +K+  R+  ++ +  +   +
Sbjct: 527 LNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSK 586

Query: 545 LDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYV-- 602
           LD   KK   L   L K++ +L+ + ES K   LPLS KE   F+EL++ +L FN +V  
Sbjct: 587 LDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHK 646

Query: 603 ----LQNSXXXXXXXXXXXXXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQL 658
                QN                  S+ G + NE    +E+L+ +L  D+K+I +CN+QL
Sbjct: 647 QKDQKQNIQFLKKELQKIIDISRSESSKGML-NE----WEELRQILADDAKIIKECNEQL 701

Query: 659 LAAAKDLENK 668
              +K+L+ K
Sbjct: 702 TQISKELDTK 711

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  208 bits (530), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 177/677 (26%), Positives = 316/677 (46%), Gaps = 54/677 (7%)

Query: 27  NATQIVTCFDK-NLRYARVTEHTFKSKHLDIKHS---EHSILNNSGTLIAFYGSNDVELF 82
           + T+IV+  D+ +LR+   T  T+KS   D++     E ++ + +   +  Y  +++ + 
Sbjct: 27  DGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVL 86

Query: 83  DM----DGKKSCLR-----------VELGIKQVLWHPLAYLDSCLVVLTKENTIELYELA 127
           ++     G+++ L+               IKQVL+HP +YLDS ++VLT +++I +    
Sbjct: 87  EVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTD 146

Query: 128 KANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGDVYALHPLLPSR 187
                   + LN K   LG+   +++I  + FS DGL+L +LS EEG D++ ++P LP R
Sbjct: 147 DNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRR 206

Query: 188 LRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMIDKDSEFFDVNIP 247
             I     ++ + K+  LY +++ +T  ++K  +++  +F+ KI     + + F +   P
Sbjct: 207 WDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIR---GQKTAFRNDKKP 263

Query: 248 ----EHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFP 303
               +      P+GPFS+  +P ELY+  AT +  + +    + +L ++F +GT+L    
Sbjct: 264 LILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQNIS-LLAIAFSNGTVLLFLS 322

Query: 304 DIELLMSWSRS-LNNACSFVLIEKFR----AGGEIFAIES--GVAILEKN---NAHIVRF 353
           D+E +MSW  S    + S  L+E+ +       +  +I    G  ++  N   N  +   
Sbjct: 323 DLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSNFFVNTC 382

Query: 354 PYLKALGECIKEGDIAPMVDVKLTSDI---TPLAGSYHTVVTWNEPSTKGILFIGNSVIR 410
            +   L + I + DI  + ++K+ S+I     LA ++ +++ W   +      I +  I 
Sbjct: 383 DWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKKIE 442

Query: 411 SIPDDVGLSSFKPR--VDPAISQ-----------NGKYTVCFPSTMEELLKTNKALQHTL 457
            +    G+SS      +D + SQ           NG Y V F   + E+    +     L
Sbjct: 443 ELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNL 502

Query: 458 R-QPLPLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFE 516
           + Q    +PLE ++ PL +  NE+QL +LTKIS   M  I +AQ+LGY+   R      E
Sbjct: 503 QNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEE 562

Query: 517 LCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFN 576
             RQ+ET  ++N      +Q  +    ++D V +K   L  RL  L   ++   E    N
Sbjct: 563 FSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQKEMGSMN 622

Query: 577 ELPLSMKERAWFRELKNDVLAFNEYVLQNSXXXXXXXXXXXXXXXXXSNHGNIPNEELFN 636
              +S  E  WF E+K  V+ FN YV + S                 +   +I +E    
Sbjct: 623 NSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKE 682

Query: 637 FEKLQDLLTLDSKMIGD 653
           +  LQ LL  D K+I +
Sbjct: 683 WNDLQQLLRTDLKIISE 699

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  182 bits (461), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 156/603 (25%), Positives = 297/603 (49%), Gaps = 44/603 (7%)

Query: 97  IKQVLWHPLAYLDSCLVVLTKEN---TIELYELAKANFMYPTVVLN-EKLPQLGISSHVS 152
           I+++L+HPL     CLVVL K +   +I++  + K   +  T +        +G+SS + 
Sbjct: 123 IQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCID 182

Query: 153 EICSMAFSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKD 212
           +I  ++FS D L+LY L+     D+Y  +P L   + + ++  +  + K+  L+E+++ D
Sbjct: 183 DIIDISFSSDKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEND 239

Query: 213 TPNEKKIAMIEHFDFVSKIYKMID---------KDSEFFDVNIPEHKRMVTPRGPFSIYG 263
           +    +  +I+    +S +   I           +++ ++++I    R V  +G FSI  
Sbjct: 240 SSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAP 299

Query: 264 FPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWSR---SLNNACS 320
           FPEELY  +A  L  + +   G  + ++++DDGT+L L+ D+E  MSW     + NN  S
Sbjct: 300 FPEELYKQSAVNLSVIQIG-HGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNN--S 356

Query: 321 FVLIEKFRAGGE----IFAI--ESGV-AILEKNNAHIVRFP-YLKALGECIKEGDIAPMV 372
           F+L+EK +   +    I  I  ++G+ AI      +++    +   L +CIK+ DI  + 
Sbjct: 357 FILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLA 416

Query: 373 DVKLTSDITPLAG--SYHTVVTWNEPSTKGILFIGNSVIRS--IPDDVGLSSFKPRVDPA 428
            + + S    +      ++ + WNE + K +LFI  + + S  I +    S+ K  V PA
Sbjct: 417 GLSIESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPV-PA 475

Query: 429 ISQNGKY-TVCFPSTMEELLKTNKALQH---TLRQPLP-LVPLEQKNVPLNSEFNEHQLA 483
           I+   K   +   +  + + + N A+Q    + + P   ++P   +  P  ++ NE QLA
Sbjct: 476 INDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLA 535

Query: 484 TLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTC 543
            +T+IS E+  +I+  Q++  +M+ R   QQ     QL   +K    + T+KQ     + 
Sbjct: 536 YITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQST 595

Query: 544 RLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYV- 602
           ++  +++++  L  R  KL + ++K+ +S ++  +P++  E   F+E+K  VL FN+ V 
Sbjct: 596 KIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVN 655

Query: 603 ---LQNSXXXXXXXXXXXXXXXXXSNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLL 659
               Q                    +H  I + +   + +L DLL  D+K+I DCN +L 
Sbjct: 656 RQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELS 715

Query: 660 AAA 662
           +A+
Sbjct: 716 SAS 718

>TDEL0C01030 Chr3 complement(173571..174584) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 250 KRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVL 289
           KRM++  G  S+YG   EL+   + KL T   ND+GAY++
Sbjct: 265 KRMISWMGYDSVYGAYSELFAALSPKLTT---NDQGAYII 301

>KAFR0B05210 Chr2 (1069638..1072031) [2394 bp, 797 aa] {ON}
           Anc_2.616 YKL072W
          Length = 797

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 526 KLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKER 585
           KL +   T +     ++  LD+VS  D     + EK   SL   N S  +    L M  R
Sbjct: 712 KLKNLKKTFRIQDVEVSNALDAVSDND-----QFEKCLTSLTNSN-SGCYASFYLRMASR 765

Query: 586 AWFRELKNDVLAFNEYVLQ 604
            +F +LKND+LA+  Y+ +
Sbjct: 766 NFFTDLKNDILAWANYIFK 784

>Skud_7.401 Chr7 complement(678698..679249) [552 bp, 183 aa] {ON}
           YGR102C (REAL)
          Length = 183

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 4/92 (4%)

Query: 514 QFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESP 573
           Q  L +QL  +S+L++  V  ++  K    RL     K    R   EKL + +D   +  
Sbjct: 94  QMRLAKQLSFISRLHNIPVNGEEEMKEYDARL----MKRKTTRLSYEKLLEGIDHQTQDV 149

Query: 574 KFNELPLSMKERAWFRELKNDVLAFNEYVLQN 605
           +  E+  S K      E KN+     E +L+N
Sbjct: 150 ELGEVSGSWKATGLAAESKNEYFLVKEGLLKN 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,916,288
Number of extensions: 3289659
Number of successful extensions: 10026
Number of sequences better than 10.0: 63
Number of HSP's gapped: 10293
Number of HSP's successfully gapped: 64
Length of query: 671
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 555
Effective length of database: 40,180,143
Effective search space: 22299979365
Effective search space used: 22299979365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)