Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_62891.318ON1031035364e-72
SAKL0D06952g1.318ON1071073291e-40
AEL167C1.318ON101943282e-40
Kwal_14.25861.318ON106993057e-37
KLLA0F01683g1.318ON98853012e-36
KLTH0H10714g1.318ON1061013012e-36
ZYRO0G20702g1.318ON1401032833e-33
TDEL0D018701.318ON100972795e-33
CAGL0I09372g1.318ON1031022673e-31
Kpol_1035.251.318ON1061032658e-31
TPHA0O014701.318ON100972552e-29
YBR268W (MRPL37)1.318ON105972474e-28
NDAI0B047701.318ON1131072451e-27
Smik_2.4111.318ON105972441e-27
Skud_2.4001.318ON1051002388e-27
NCAS0B074401.318ON1101062389e-27
KNAG0C017701.318ON101982334e-26
Suva_4.5291.318ON1051002327e-26
TBLA0F013201.318ON111782076e-22
KAFR0C042101.318ON1011011996e-21
Ecym_63742.129ON47427614.6
AFR226C2.405ON70463605.3
TPHA0O009901.428ON41570589.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_6289
         (103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...   211   4e-72
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...   131   1e-40
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...   130   2e-40
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...   122   7e-37
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...   120   2e-36
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...   120   2e-36
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...   113   3e-33
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   112   5e-33
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...   107   3e-31
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   106   8e-31
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...   102   2e-29
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...   100   4e-28
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...    99   1e-27
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...    99   1e-27
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    96   8e-27
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    96   9e-27
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    94   4e-26
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...    94   7e-26
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    84   6e-22
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    81   6e-21
Ecym_6374 Chr6 (733665..735089) [1425 bp, 474 aa] {ON} similar t...    28   4.6  
AFR226C Chr6 complement(846565..848679) [2115 bp, 704 aa] {ON} S...    28   5.3  
TPHA0O00990 Chr15 complement(183157..184404) [1248 bp, 415 aa] {...    27   9.8  

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score =  211 bits (536), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MFSSPLIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEW 60
           MFSSPLIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEW
Sbjct: 1   MFSSPLIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEW 60

Query: 61  LWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           LWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI
Sbjct: 61  LWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score =  131 bits (329), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 81/107 (75%), Gaps = 4/107 (3%)

Query: 1   MFSSPLIINKRLISTTLRLAEQKGSKAIIS----SCPAGTPLNLQIKKTGKEPVALHESE 56
           M SS  + ++R +STT    +Q+ + A +S    SCPAGTPLNLQIKK+GKE VAL + E
Sbjct: 1   MLSSFHLASRRFLSTTRITLQQQAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHE 60

Query: 57  YPEWLWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           YPEWLW VLD + ++AKL +DP   +KKQLRKMNREKIKQNNFL++I
Sbjct: 61  YPEWLWTVLDEKAQSAKLAQDPAKLKKKQLRKMNREKIKQNNFLTKI 107

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score =  130 bits (328), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 61/94 (64%), Positives = 76/94 (80%), Gaps = 1/94 (1%)

Query: 10  KRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQV 69
           +RL S + R+ +Q+  KA+ SSCPAGTPLNL IKK GKEP+AL +S+YPEWLW VLDP+ 
Sbjct: 9   RRLFSVSCRVYDQQAQKAV-SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEA 67

Query: 70  EAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           +AAKL EDP  ARKK LR+MNRE IKQ NFL+++
Sbjct: 68  QAAKLAEDPIKARKKALRRMNREHIKQQNFLAKM 101

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score =  122 bits (305), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 62/99 (62%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 6   LIINKRLISTTLRLAEQKGS-KAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGV 64
           L++ K   + +  L  QKGS   I SSC AGTPLNLQIKK+GKEPVAL + EYPEWLW V
Sbjct: 8   LVVKKPFSTFSALLQSQKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEYPEWLWSV 67

Query: 65  LDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           LD + +  KL EDP   RKKQLR  NR+KIKQNNFLS I
Sbjct: 68  LDDKAQLKKLQEDPLKLRKKQLRSANRQKIKQNNFLSEI 106

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score =  120 bits (301), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 66/85 (77%), Gaps = 1/85 (1%)

Query: 20  AEQKGSKA-IISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVEAAKLNEDP 78
           +E  G  A I+SSCPAGTPLNLQIKK+GKEPVAL +SEYPEWLW VLD  V+A KL  DP
Sbjct: 14  SEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADP 73

Query: 79  FAARKKQLRKMNREKIKQNNFLSRI 103
              RKKQLR  NR  IKQNNFL++I
Sbjct: 74  IKLRKKQLRIANRANIKQNNFLAKI 98

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score =  120 bits (301), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 6/101 (5%)

Query: 7   IINKRLISTTLRLAEQKGSKA----IISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLW 62
           + +KR +S +   A  +G KA    ++SSCPAGTPLNLQIKK+GKEPVAL + EYPEWLW
Sbjct: 8   LTSKRALSVSR--ATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLW 65

Query: 63  GVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
            VLD + +  KL EDP   RKKQLR  NR KIKQNNFLS I
Sbjct: 66  TVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score =  113 bits (283), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (69%), Gaps = 5/103 (4%)

Query: 1   MFSSPLIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEW 60
           MF    +  +R +ST+  L +     A+ SSCPAGT +N+  KK+GK+PVAL ++EYP+W
Sbjct: 43  MFQLLRLFPRRFVSTSPVLGQ-----AVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDW 97

Query: 61  LWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           LW VLDP+ +  KL  DP   RKKQLRK NREKIKQNNFL +I
Sbjct: 98  LWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  112 bits (279), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 68/97 (70%)

Query: 7   IINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLD 66
            + KRL S      ++  S  + SSCPAGT L++ +KK+GK+PVAL +SEYP WLW VLD
Sbjct: 4   FVPKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWEVLD 63

Query: 67  PQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           P+  A KL EDP   RKKQ+RK NR +IKQNNFL ++
Sbjct: 64  PEARARKLAEDPMKLRKKQIRKANRMQIKQNNFLQQL 100

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score =  107 bits (267), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 56/102 (54%), Positives = 75/102 (73%), Gaps = 6/102 (5%)

Query: 6   LIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVL 65
           L+  KRL+S+++ L  +  +K I SSC AGTPL+L +KKTGK+PVAL +SEYPEWLW VL
Sbjct: 4   LLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVL 61

Query: 66  DPQVEAAK----LNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           D    AA     ++E+   ARKKQ+R+ NREKIKQ NFL+++
Sbjct: 62  DQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  106 bits (265), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 72/103 (69%), Gaps = 7/103 (6%)

Query: 7   IINKRLISTTLRLAEQKGSKA------IISSCPAGTPLNLQIKKTGKEPVALHESEYPEW 60
           I  KRL+S++ RL  Q+  K       I SSCPAG+ L L IKK GK+PVAL ++EYP W
Sbjct: 5   IFQKRLLSSS-RLLWQETVKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEYPTW 63

Query: 61  LWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           LW VLD + +A  L++DP A RKK+LR+ NR+ IKQNNFL +I
Sbjct: 64  LWTVLDKEAQAEALSKDPLALRKKKLRQANRKNIKQNNFLKQI 106

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score =  102 bits (255), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 64/97 (65%)

Query: 7   IINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLD 66
           +  KR  S    L ++  +  + SSC AGTPL + + KTGK+P+AL +SEYP WLW VLD
Sbjct: 4   VFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLD 63

Query: 67  PQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
              +AA+L  DP   R+K+LR+ NR  IKQNNFL +I
Sbjct: 64  KGAQAARLENDPLKLRRKELRRKNRANIKQNNFLKQI 100

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score = 99.8 bits (247), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 64/97 (65%), Gaps = 4/97 (4%)

Query: 11  RLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVE 70
           RLIST+  L  +   K+++SSCPAGT LNL I K+GK+ VAL + EYP WLW VLD    
Sbjct: 9   RLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWSVLDSDHV 68

Query: 71  AAKLNEDP----FAARKKQLRKMNREKIKQNNFLSRI 103
                EDP       R+K +RK NR++IKQNNFLS++
Sbjct: 69  VEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score = 99.0 bits (245), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 13/107 (12%)

Query: 10  KRLISTTLRL--AEQKGSKAIIS----SCPAGTPLNLQIKKTGKEPVALHESEYPEWLWG 63
           KR  ST++++  AE K +  I S    SC AGTPLNL IKKTGKEP+AL + EYPEWLW 
Sbjct: 7   KRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEYPEWLWT 66

Query: 64  VLDPQVEAAKLN-------EDPFAARKKQLRKMNREKIKQNNFLSRI 103
           VLD +    +         E+   ARK+QLR   R+KIKQNNFLS+I
Sbjct: 67  VLDTKTANGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 98.6 bits (244), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 11  RLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVE 70
           R IST+  L  +   K+++SSCPAGT LNL I K+GK+ VAL + EYP WLWG+L+ +  
Sbjct: 9   RFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQT 68

Query: 71  AAKLNEDP----FAARKKQLRKMNREKIKQNNFLSRI 103
                +DP       R+K +RK NR++IKQNNFLS++
Sbjct: 69  VEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 96.3 bits (238), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 66/100 (66%), Gaps = 4/100 (4%)

Query: 8   INKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDP 67
           ++ R IST+  L  ++  K ++SSCPAGT LNL I K+GK+ +AL E EYP WLW VLD 
Sbjct: 6   VSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDN 65

Query: 68  QVEAAKLNED----PFAARKKQLRKMNREKIKQNNFLSRI 103
           + +     +D        R+K +RK NR++IKQ+NFLS++
Sbjct: 66  KQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 96.3 bits (238), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 55/106 (51%), Positives = 72/106 (67%), Gaps = 9/106 (8%)

Query: 7   IINKRLISTTLRL------AEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEW 60
           ++ KR +ST+ R+           S  I SSC AGT LNL IKK GK+P+AL ++EYP W
Sbjct: 4   LVFKRSLSTSFRVLTAEAATTANASTNIKSSCLAGTSLNLNIKKNGKDPIALEDNEYPAW 63

Query: 61  LWGVLDPQV--EAAKLNE-DPFAARKKQLRKMNREKIKQNNFLSRI 103
           LW VL+ +   EA+ L+E +  A RKKQLRK NR+KIKQNNFLS++
Sbjct: 64  LWKVLESKAPKEASDLSEQEVLAMRKKQLRKENRKKIKQNNFLSQL 109

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 94.4 bits (233), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 7   IINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLD 66
            + +R+      L +     A+ SSC AGTPL L I+K G++PVA+ + EYPEWLW VL+
Sbjct: 4   FVQRRMWHGGRVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVLE 63

Query: 67  PQVEA-AKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103
           P     A    DP AAR+K+LR+ +R +IKQ+N+LS++
Sbjct: 64  PATGGDASARADPLAARRKELRRKHRNEIKQSNYLSQL 101

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 94.0 bits (232), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 4/100 (4%)

Query: 8   INKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDP 67
           ++ R +ST+     ++  K + SSCPAGT LNL I K+GK+  AL + EYP WLW VLD 
Sbjct: 6   VSCRWLSTSRVFYNKQAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLWSVLDA 65

Query: 68  QVEAAKLNEDP----FAARKKQLRKMNREKIKQNNFLSRI 103
           +       +DP     + RKK +RK NR++IKQNNFLS++
Sbjct: 66  KQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 84.3 bits (207), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 41/78 (52%), Positives = 52/78 (66%)

Query: 26  KAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVEAAKLNEDPFAARKKQ 85
           +AI SSCPAGT L L + K GK+PVAL + +YP WLW +L P         +  A RKK 
Sbjct: 33  QAIKSSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNNKNPSPMEAIAQRKKV 92

Query: 86  LRKMNREKIKQNNFLSRI 103
           LRK NR++IKQNNFL ++
Sbjct: 93  LRKNNRDRIKQNNFLKQL 110

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 81.3 bits (199), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 61/101 (60%), Gaps = 4/101 (3%)

Query: 6   LIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVL 65
           L +++R  S + R   Q     ++SSCP GTPL L ++K  K P+AL + EYP WLW VL
Sbjct: 2   LRLSRRFFSHS-RSVLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVL 60

Query: 66  DPQVEAAKLNEDP---FAARKKQLRKMNREKIKQNNFLSRI 103
           + +    +    P      R+KQLRK+NR+KIKQ NFLS +
Sbjct: 61  NEESANTQKELSPIQELELRRKQLRKLNRDKIKQKNFLSEL 101

>Ecym_6374 Chr6 (733665..735089) [1425 bp, 474 aa] {ON} similar to
           Ashbya gossypii AFR062C
          Length = 474

 Score = 28.1 bits (61), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%)

Query: 58  PEWLWGV-LDPQVEAAKLNEDPFAARK 83
           PEW+  + L PQ+   KL EDP AA+K
Sbjct: 363 PEWVNKLPLHPQINVLKLREDPAAAQK 389

>AFR226C Chr6 complement(846565..848679) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR035C
           (MLH2)
          Length = 704

 Score = 27.7 bits (60), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 27/63 (42%)

Query: 41  QIKKTGKEPVALHESEYPEWLWGVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFL 100
           ++K T + P    E E  +  +    P  E   + +D     K + R +N      NNF+
Sbjct: 577 KMKTTNRRPTQREERELLKLQYSSTGPSEENVPIQKDKIKPTKDRRRNLNMFSEYTNNFI 636

Query: 101 SRI 103
           SR+
Sbjct: 637 SRV 639

>TPHA0O00990 Chr15 complement(183157..184404) [1248 bp, 415 aa] {ON}
           Anc_1.428 YCR012W
          Length = 415

 Score = 26.9 bits (58), Expect = 9.8,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 9   NKRLIST--TLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEY----PEWLW 62
           N+R+++   T++ A +KG++ ++ +   G P   ++ K   +PV    S       E+L 
Sbjct: 37  NQRIVAALPTIKYALEKGAQYVVLASHLGRPNGERVAKYSLKPVQAELSTLLGKPVEFLN 96

Query: 63  GVLDPQVEAA 72
             + P+VEAA
Sbjct: 97  DCVGPEVEAA 106

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,746,054
Number of extensions: 400546
Number of successful extensions: 1103
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1093
Number of HSP's successfully gapped: 25
Length of query: 103
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 29
Effective length of database: 44,996,115
Effective search space: 1304887335
Effective search space used: 1304887335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)