Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_62881.317ON80680642290.0
AEL166C1.317ON80680824010.0
SAKL0D06974g1.317ON81379822220.0
KLTH0H10736g1.317ON81081122020.0
Kwal_14.25871.317ON80880321320.0
TDEL0D018601.317ON80981621270.0
ZYRO0G20724g1.317ON81281621090.0
KLLA0F01705g1.317ON78779719880.0
Kpol_1035.261.317ON83582919730.0
KAFR0A017301.317ON82181619500.0
NCAS0A092201.317ON83179719390.0
NDAI0G057401.317ON85783819300.0
TBLA0F013301.317ON82782519220.0
KNAG0C058301.317ON83082318430.0
TPHA0O014801.317ON82482317820.0
CAGL0J05236g1.317ON84284917540.0
Skud_10.1591.317ON83183517020.0
Suva_6.1381.317ON83083216950.0
YJL062W (LAS21)1.317ON83083316670.0
Smik_10.1781.317ON83183216550.0
ZYRO0B01034g4.28ON10093424795e-49
NDAI0H003204.28ON10343624796e-49
Ecym_55594.28ON10143384787e-49
KLLA0C17534g4.28ON10053404742e-48
TDEL0F016904.28ON10053454715e-48
YLL031C (GPI13)4.28ON10173394662e-47
CAGL0G04015g4.28ON10193574635e-47
KLTH0E06094g4.28ON10163504601e-46
Kpol_478.14.28ON10094454582e-46
Suva_10.414.28ON10173454564e-46
TPHA0F003104.28ON10263564564e-46
TPHA0K021804.28ON10283624564e-46
AGR126C4.28ON10134114547e-46
KAFR0I014104.28ON10164544484e-45
Kwal_YGOB_55.206644.28ON9563484474e-45
SAKL0H25542g4.28ON10133554485e-45
Kwal_55.20667singletonOFF6023474385e-45
NCAS0C058004.28ON10113454387e-44
Smik_12.254.28ON10173414371e-43
KNAG0J028204.28ON10173424361e-43
Skud_12.364.28ON10163454315e-43
TBLA0A085004.28ON10653514102e-40
TBLA0E014804.28ON10403191451e-08
KLLA0B07249g1.184ON9194701333e-07
TPHA0A028001.184ON9201821281e-06
YKL165C (MCD4)1.184ON9193931253e-06
Skud_11.601.184ON9193861228e-06
KAFR0G005001.184ON9223211192e-05
Suva_11.581.184ON9193301173e-05
Smik_11.641.184ON9453851163e-05
NDAI0A009801.184ON9251801164e-05
TBLA0C058401.184ON9473401121e-04
KNAG0C010801.184ON9313281093e-04
SAKL0C05434g1.184ON10353591065e-04
Kwal_33.138561.184ON9223221066e-04
Ecym_80941.184ON9263301030.001
Kpol_1044.184.28ON10223321030.001
Kpol_2001.281.184ON9191521020.002
NCAS0B082601.184ON9241461020.002
ZYRO0G18458g1.184ON9211791010.002
AEL113C1.184ON9253251010.002
TDEL0C036901.184ON920377950.010
KLTH0F04884g1.184ON922329950.010
CAGL0M08448g1.184ON921197940.017
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_6288
         (806 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar t...  1633   0.0  
AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON} S...   929   0.0  
SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {...   860   0.0  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...   852   0.0  
Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...   825   0.0  
TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.3...   823   0.0  
ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]...   816   0.0  
KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {...   770   0.0  
Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {O...   764   0.0  
KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {O...   755   0.0  
NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa] ...   751   0.0  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...   748   0.0  
TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {O...   744   0.0  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...   714   0.0  
TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {...   691   0.0  
CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa] ...   680   0.0  
Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {...   660   0.0  
Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON...   657   0.0  
YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}  LAS21Inte...   646   0.0  
Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062...   642   0.0  
ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar...   189   5e-49
NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON...   189   6e-49
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...   188   7e-49
KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON} sim...   187   2e-48
TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4....   186   5e-48
YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}  ...   184   2e-47
CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highl...   182   5e-47
KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa] ...   181   1e-46
Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON} co...   181   2e-46
Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON...   180   4e-46
TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON...   180   4e-46
TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4...   180   4e-46
AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON} ...   179   7e-46
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....   177   4e-45
Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)...   176   4e-45
SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON} sim...   177   5e-45
Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa] {...   173   5e-45
NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON} Anc_...   173   7e-44
Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON...   172   1e-43
KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4...   172   1e-43
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...   170   5e-43
TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]...   162   2e-40
TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {...    60   1e-08
KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {...    56   3e-07
TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {O...    54   1e-06
YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON} ...    53   3e-06
Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {O...    52   8e-06
KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {O...    50   2e-05
Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {O...    50   3e-05
Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {O...    49   3e-05
NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {O...    49   4e-05
TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa] ...    48   1e-04
KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {O...    47   3e-04
SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa] ...    45   5e-04
Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {...    45   6e-04
Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar t...    44   0.001
Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {...    44   0.001
Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]...    44   0.002
NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON} Anc_1...    44   0.002
ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} high...    44   0.002
AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON} S...    44   0.002
TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.1...    41   0.010
KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {...    41   0.010
CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa] ...    41   0.017

>Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar to
           Ashbya gossypii AEL166C
          Length = 806

 Score = 1633 bits (4229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/806 (98%), Positives = 793/806 (98%)

Query: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60
           MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA
Sbjct: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60

Query: 61  LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN 120
           LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN
Sbjct: 61  LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN 120

Query: 121 VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE 180
           VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE
Sbjct: 121 VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE 180

Query: 181 VDRNVTRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV 240
           VDRNVTRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV
Sbjct: 181 VDRNVTRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV 240

Query: 241 DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDG 300
           DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDG
Sbjct: 241 DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDG 300

Query: 301 DYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLA 360
           DYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLA
Sbjct: 301 DYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLA 360

Query: 361 NNTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFK 420
           NNTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFK
Sbjct: 361 NNTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFK 420

Query: 421 QTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVC 480
           QTKILSLTVAI             VEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVC
Sbjct: 421 QTKILSLTVAISLSLGLSMFSSSFVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVC 480

Query: 481 ARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVT 540
           ARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVT
Sbjct: 481 ARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVT 540

Query: 541 VTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPDNMLKEALVPLARLCFQSILASI 600
           VTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPDNMLKEALVPLARLCFQSILASI
Sbjct: 541 VTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPDNMLKEALVPLARLCFQSILASI 600

Query: 601 VFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLSSND 660
           VFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLSSND
Sbjct: 601 VFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLSSND 660

Query: 661 LSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFAPVI 720
           LSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFAPVI
Sbjct: 661 LSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFAPVI 720

Query: 721 YWSLNLIEVYQEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCY 780
           YWSLNLIEVYQEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCY
Sbjct: 721 YWSLNLIEVYQEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCY 780

Query: 781 YIAWSILINGLLEHLFNPLLLTVTNK 806
           YIAWSILINGLLEHLFNPLLLTVTNK
Sbjct: 781 YIAWSILINGLLEHLFNPLLLTVTNK 806

>AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL062W
           (LAS21)
          Length = 806

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/808 (55%), Positives = 573/808 (70%), Gaps = 5/808 (0%)

Query: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60
           M F+ + LL CQL+A+L FA GFFPQK VL GD++F YM E  + +EP F+K+V++VIDA
Sbjct: 1   MRFKEVGLLFCQLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDA 60

Query: 61  LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN 120
           LR+DFLFQ NVS F FVH+L+N+GEAWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILN
Sbjct: 61  LRADFLFQQNVSHFDFVHELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDAILN 120

Query: 121 VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE 180
           VAEDD+SSNLKDQDSW+SQ  KHGK+IHF+GDDTWLKLFP  FFQ+ DGTNSFFVSDFEE
Sbjct: 121 VAEDDSSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEE 180

Query: 181 VDRNVTRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV 240
           VD NVTRHLP++L +++WD+LILHYLGLDHIGHKGG+ASQFM PKH EMDAVI+ IYD V
Sbjct: 181 VDTNVTRHLPHELQHKDWDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQIYDQV 240

Query: 241 DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDG 300
           D RTL+CV+GDHGMND+GNHGGSSAGETSA MVFISK L++Y  P AQ GV  P+  ++ 
Sbjct: 241 DNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPVTAAE- 299

Query: 301 DYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKL- 359
           DYQ+ TRIQQVD VPT+ SLFN PIP+NS+G+ +++F  LLG  A  K+ +N+ QLM+L 
Sbjct: 300 DYQFFTRIQQVDFVPTIASLFNIPIPKNSLGVFVREFSSLLGQHATTKIIENYHQLMQLA 359

Query: 360 ANNTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTF 419
           A  T       ID +L +MK  Q  LA  ATNYNY  L +G+ +L  +T   +  +  + 
Sbjct: 360 AKKTAARGNDDIDSMLAEMKDVQATLARTATNYNYAMLFLGVGMLSIVTAATAYCYISSA 419

Query: 420 KQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSV 479
           +  +   L +A+             VEEEHQIWWWI+ A VG SW   PS T  H +  V
Sbjct: 420 RLNEASVLMIAVTALLGSSVFGSSFVEEEHQIWWWIIIAVVGYSWATRPSCTPSHLVFLV 479

Query: 480 CARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFV 539
           CARL+RGWNNSGQK++Y+ T+ ++L+ +P+ KWL+  AT+ +VA +      +  + + +
Sbjct: 480 CARLLRGWNNSGQKFMYDFTVAELLKSHPSIKWLLVCATLAVVALDGFTERPLLSIFNLL 539

Query: 540 TVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPDNML--KEALVPLARLCFQSIL 597
              L   YK CW  VN  + P + Q  V   CS L         K+ LVPLARL F+   
Sbjct: 540 AGLLWFVYKTCWANVNGEVSPTYAQTLVTKACSLLFAGGTPWDDKQLLVPLARLFFKVTA 599

Query: 598 ASIVFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLS 657
           A +  R+ YN   +  K L  + PL   +L++QT+  NIPLFL+FT+M+ ++  IL    
Sbjct: 600 AIVCMRIAYNVVFAKRKFLSELFPLFTIVLIMQTASQNIPLFLVFTIMRSSLRNILRVGY 659

Query: 658 SNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFA 717
                ++  +LSLI+QN +FFQFGGTNSIATI+LTNSYNG+S++YNIYVVG L  I N A
Sbjct: 660 PQQRCEMFFVLSLILQNLSFFQFGGTNSIATIDLTNSYNGISENYNIYVVGLLMCIGNMA 719

Query: 718 PVIYWSLNLIEVYQEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSVFSPK 777
           P IYWSL  +  +Q  +KK +Y  ++L  +F YSV  + LL++C+ +RYHLFIWSVFSPK
Sbjct: 720 PAIYWSLAAVVDHQLYSKK-SYAQQKLSSMFFYSVNSLLLLVACICMRYHLFIWSVFSPK 778

Query: 778 LCYYIAWSILINGLLEHLFNPLLLTVTN 805
           LCY + W+ILI+ L E +  P LL V  
Sbjct: 779 LCYLLGWNILIHFLTETVLEPFLLMVAG 806

>SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 813

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/798 (54%), Positives = 555/798 (69%), Gaps = 15/798 (1%)

Query: 4   RAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRS 63
           R++ LL+ Q+VAI TF+IGFFPQKSVL GD+ FLY+P++    +P F K+V++VIDALRS
Sbjct: 4   RSVILLLLQIVAIFTFSIGFFPQKSVLQGDASFLYLPQQQSRSDPVFRKLVLVVIDALRS 63

Query: 64  DFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAE 123
           DFLFQ + S F+FVH L+N G AWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAE
Sbjct: 64  DFLFQESNSKFNFVHQLLNDGAAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAE 123

Query: 124 DDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDR 183
           DD SS+L DQDSWL Q H + KRI F+GDDTWLKLFP  FFQ  +GTNSFFVSDFE+VD 
Sbjct: 124 DDLSSSLNDQDSWLRQFHNNNKRIKFFGDDTWLKLFPLEFFQEYEGTNSFFVSDFEQVDL 183

Query: 184 NVTRHLPYDLSYQ-EWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDE 242
           NVTRHLP+  S++ EWD+LILHYLGLDHIGHKGGS+S+FM  K  EMD VIK IY+++D 
Sbjct: 184 NVTRHLPHQFSHKDEWDVLILHYLGLDHIGHKGGSSSRFMPGKQEEMDNVIKQIYESMDR 243

Query: 243 RTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDY 302
            TL+CV+GDHGMND+GNHGGSS GETSAA+ FIS KL  ++ P  QR   +PL     +Y
Sbjct: 244 DTLLCVMGDHGMNDLGNHGGSSNGETSAALTFISPKLKQFQPPVTQRNAHLPLKEHSENY 303

Query: 303 QYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLL-GTFAEIKVKDNFRQLMKLAN 361
           +YL  +QQ+D+VPTL SLFN PIP+NS+GIII DFL L  G  AEIK+ DNF QLM +  
Sbjct: 304 KYLDEVQQIDLVPTLASLFNLPIPKNSLGIIITDFLQLFPGELAEIKITDNFHQLMNIIG 363

Query: 362 NTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFKQ 421
            TP      I   +E+MK  Q  LA A TNYNY  + IG  IL  +T+  +       K 
Sbjct: 364 ETPS-DTKDIQNSVEKMKRIQSTLAKATTNYNYQLISIGYIILLLVTVATTGFTLSLVKL 422

Query: 422 TKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVCA 481
               +L + +             VEEE Q+WWWI T  + +S ++ P    +H LV  C 
Sbjct: 423 NYDSALLLGVSFTLGISTFGSSFVEEEQQLWWWISTGILLLSAILVPQEIINHLLVFTCL 482

Query: 482 RLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETV--EFNLMTFVSSFV 539
           RLIRGWNNSGQK+IY+ T+Y++L+ + +  W +NA T+F+ +F     E   ++FVSSF+
Sbjct: 483 RLIRGWNNSGQKFIYDCTLYELLKVHTSWNWALNALTIFVTSFTCTLGERGPLSFVSSFL 542

Query: 540 TVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLI-GPDN--MLKEALVPLARLCFQSI 596
             TLCL YKG W++VN   +  WL+A +  +C  L+   DN  M  ++LVP+ARL FQ  
Sbjct: 543 LATLCLVYKGTWSVVNGEQISQWLKAVIRKSCILLLDDTDNRDMYTDSLVPMARLFFQIT 602

Query: 597 LASIVFRVCYNRF-KSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTN 655
           L  I+FR+  N+      K  + I  +++ IL+LQTS +NIP FL+F +++  +  +LT 
Sbjct: 603 LTLILFRIALNKLMDRKTKYFKDIHSIVSMILILQTSSANIPQFLVFWILQDRLKYLLTA 662

Query: 656 LSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISN 715
            + +D   +  ++SLI+QN TFFQFGGTNSIAT+NLTN+YNG+S  YNI+VVG L  I N
Sbjct: 663 YTPSDC--LVMVISLILQNLTFFQFGGTNSIATVNLTNAYNGISGDYNIHVVGLLMCIGN 720

Query: 716 FAPVIYWSL----NLIEVYQEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIW 771
           FAP IYWS+     L E  +  +K   +   RLP L  YS+ G F++ SC+ LRYHLFIW
Sbjct: 721 FAPSIYWSMATLPTLFENKKNTDKWEIFFATRLPALMFYSIIGCFIMGSCVILRYHLFIW 780

Query: 772 SVFSPKLCYYIAWSILIN 789
           SVFSPKLCYY+ W++ +N
Sbjct: 781 SVFSPKLCYYVTWNVFMN 798

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/811 (53%), Positives = 566/811 (69%), Gaps = 16/811 (1%)

Query: 4   RAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRS 63
           R + LL+ ++VAILTF+ GFFPQKSVL GD++F Y PE H+ M P+FEKMV++++DALRS
Sbjct: 4   RLLVLLVLEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRS 63

Query: 64  DFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAE 123
           DF+FQ ++S F F+H L+NKG AWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAE
Sbjct: 64  DFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAE 123

Query: 124 DDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDR 183
           DD SSNLK+QDSWL Q   H K+I F+GDDTWLKLFPS FF  +DGTNSFFVSDFEEVD 
Sbjct: 124 DDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDL 183

Query: 184 NVTRHLPYDLSYQE-WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDE 242
           NVTRHLP  L  Q+ WD+LILHYLGLDHIGHKGG+ S FM PKH EMDAVI+ IY+AV E
Sbjct: 184 NVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGE 243

Query: 243 RTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDY 302
            TL+CV+GDHGMND+GNHGGSSAGETSAA+VFISK L  Y+ P AQ+G  +P+ +S  +Y
Sbjct: 244 DTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEY 303

Query: 303 QYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTF-AEIKVKDNFRQLMKLAN 361
            YLT++ Q+D VPT+ +LFN P+P+NS+G++I DFL LL    A+ KV DN++QL+ ++ 
Sbjct: 304 NYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISG 363

Query: 362 NTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFKQ 421
            + +  G   D ++E+M+  Q DLA  ATNYNY+ L IG   L  ++ +     + +F  
Sbjct: 364 GSTKKLGDP-DAIIEEMREVQSDLAKTATNYNYLLLGIGFLTLLVVSSVALFFSWTSFPS 422

Query: 422 TKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVCA 481
           T  L L +               +EEEHQIWWW   A VG+S++  P    DH  V    
Sbjct: 423 TFGLFLLLGTSLLLSLSTFGSSFIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLAVL 482

Query: 482 RLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVTV 541
           RLIRGWNNSGQK++YE T+Y++L+++   +WL+   T+F+V F+        F  SF+  
Sbjct: 483 RLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFLMS 542

Query: 542 TLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIG--PDNM-LKEALVPLARLCFQSILA 598
            LCL YK  W++VN   VP WLQ     + S + G   D +   +ALVP+ARL FQ   A
Sbjct: 543 VLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVTAA 602

Query: 599 SIVFRVCYNRFK-SSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLS 657
            I   V  ++FK + P+ L+ I   I+T+L+LQTS +NIP FL F ++    +R L +L 
Sbjct: 603 VIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHIL----SRKLNSLW 658

Query: 658 SNDLSQISCILS--LIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISN 715
           S        +++  L++Q+ +FFQFG TNSIAT++LTN+YNGVS++YNIYVVG L  +SN
Sbjct: 659 SRRQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSN 718

Query: 716 FAPVIYWSLNLIEVY---QEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWS 772
           FAP IYWSL+ +++       +K  T+   RLP   +Y + G FLL SC+ LRYHLFIWS
Sbjct: 719 FAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPSFLYYCLFGCFLLGSCVILRYHLFIWS 778

Query: 773 VFSPKLCYYIAWSILINGLLEHLFNPLLLTV 803
           VFSPKLCYY++W++ +N ++   F   L+ +
Sbjct: 779 VFSPKLCYYVSWNLFMNAIIAWFFEGTLVAL 809

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/803 (51%), Positives = 556/803 (69%), Gaps = 13/803 (1%)

Query: 8   LLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLF 67
           L++ QLVAILTF+ GFFPQKSVL GD+EF + P+E + + P+F K+V++VIDALRSDF+F
Sbjct: 8   LVVAQLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVF 67

Query: 68  QANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTS 127
           Q ++S F FVH L+N+G+AWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDD+S
Sbjct: 68  QKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSS 127

Query: 128 SNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTR 187
           SNLK+QDSWL Q H + KRI F+GDDTWLKLFP  FF  +DGTNSFFVSDFEEVD NVTR
Sbjct: 128 SNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTR 187

Query: 188 HLPYDLSYQE-WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDERTLV 246
           HLP  L+ Q+ WD+LILH+LGLDHIGHKGG+ S FM PK  EMD VI+ +Y++V E TL+
Sbjct: 188 HLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGEDTLI 247

Query: 247 CVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLT 306
           CV+GDHGMND+GNHGGSSAGETSA ++FIS+ L  Y+ P AQ     P+   + DY Y++
Sbjct: 248 CVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKNDDYSYVS 307

Query: 307 RIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQLMKLANNTPE 365
           ++ Q+D+VP++ SLFNFPIP+NS+G+++ D L LL    A++K+ DN+ QL  ++ +   
Sbjct: 308 KVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDLMA 367

Query: 366 FAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFKQTKIL 425
              +  D++ + M+  Q DLA  AT YNY  L  G S+L FIT I +    +       L
Sbjct: 368 -NSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLL-FITAIATFLLLKPTISKPAL 425

Query: 426 SLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVCARLIR 485
            L + +             VEEEHQ+WWW+  A  G S+   PS   +H ++ +C RLIR
Sbjct: 426 VLLIGVSLLLSLSTFGSSFVEEEHQLWWWLAIALTGASYTQAPSEIKEHLIILLCLRLIR 485

Query: 486 GWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVTVTLCL 545
           GWNNSGQKY YE+T+ +IL++    +WL+   T+F+  F      L++F  SF+  TLCL
Sbjct: 486 GWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFLVSTLCL 545

Query: 546 AYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPDNM---LKEALVPLARLCFQSILASIVF 602
            YK  W++VN   VP+WLQ  V  + S + G +N    LKE+LVP+ARL F++ILA  + 
Sbjct: 546 IYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTILAVTLL 605

Query: 603 RVCYNRFKSSPKT-LQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLSSNDL 661
            +  +++    K  L +I       L+LQTSP+NIP FL++ ++   +  +      +  
Sbjct: 606 EIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRRREWS-- 663

Query: 662 SQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFAPVIY 721
             I  +  +++QN  FFQFG TNSIAT+NLTN+YNG+S++YNIYVVGFL  +SNFAP IY
Sbjct: 664 PSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFAPSIY 723

Query: 722 WSLNLIEV-YQEP--NKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSVFSPKL 778
           WSLN +++ Y  P  +K   +L  R+P    Y + G FLL SC+ LRYHLFIWSVFSPKL
Sbjct: 724 WSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVFSPKL 783

Query: 779 CYYIAWSILINGLLEHLFNPLLL 801
           CYY++W+I +N ++  L    LL
Sbjct: 784 CYYVSWNIFMNAVIGWLVEATLL 806

>TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.317
           YJL062W
          Length = 809

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/816 (52%), Positives = 552/816 (67%), Gaps = 22/816 (2%)

Query: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60
           M  R ++LLI QLVA+  F  GFFPQK VL  +++F+  P      +P F K+V++VIDA
Sbjct: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60

Query: 61  LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN 120
           LRSDFLF+ + S F F+H L+N+G AWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILN
Sbjct: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE 180
           VAEDD+SSNL DQDSW+ Q   HGK++ F+GDDTWLKLFP  +F   DGTNSFFVSDFE+
Sbjct: 121 VAEDDSSSNLNDQDSWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180

Query: 181 VDRNVTRHLPYDL-SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDA 239
           VD NVTRHLP  L + QEWD LILHYLGLDHIGHKGG  SQFM  K  EMD ++K IY+ 
Sbjct: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240

Query: 240 VDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSD 299
           VD+ TL+CV+GDHGMND+GNHGGSSAGETSAA+  ISKKL  Y  P  Q GVQ+P+ N+D
Sbjct: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300

Query: 300 G--DYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQL 356
           G  DYQYLTRIQQVDIVPTL +LFNFPIP+NSVGI+I++ L LL    A+IK+ +N +QL
Sbjct: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360

Query: 357 MKLANNTPEFAG-ASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIII---- 411
             ++N        A+ID L + MK  Q DL  +ATNYNY  + +GL++L   TII     
Sbjct: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLALLVITTIITVLVG 420

Query: 412 --SCEFYRTFKQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPS 469
               EF   F  T I+SL + +             VEEEHQIWWWI T A   S V    
Sbjct: 421 SNRMEFGHPFFFTMIVSLLIGL------SSFGSSFVEEEHQIWWWISTGATLASSVYLVD 474

Query: 470 LTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEF 529
             + HF++ VC R+IR WNNSGQK+  ENT++ IL+R P  +W +N   + +   +    
Sbjct: 475 EKYTHFVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSG 534

Query: 530 NLMTFVSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGP-DNMLKEALVPL 588
           +++TF+ SFV   LCL YK  W LVN   VP+WL      +CS ++G   ++  ++L+PL
Sbjct: 535 DIVTFMCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFDKSLIPL 594

Query: 589 ARLCFQSILASIVFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIA 648
           A+L F+     +   V   +   + K   +I   I  +L+ Q+   NIPLF +F V+K +
Sbjct: 595 AQLFFRCFAGCVAVAVVACKMGGN-KNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSS 653

Query: 649 INRILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVG 708
           +N+I++   ++D   IS + SLI+Q FTFF FGGTNSIAT++L+N+YNGVS++YNIY VG
Sbjct: 654 LNKIVSKRYNSDAYMISAV-SLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVG 712

Query: 709 FLTFISNFAPVIYWSLNLIEVYQEPNKK-HTYLVERLPILFHYSVTGVFLLISCLALRYH 767
           F+  +SNFAP IYWS     +  + NKK H +   +L  L    ++G  L+ +C+ALR+H
Sbjct: 713 FMMCVSNFAPSIYWSTFTWNLLYKTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFH 772

Query: 768 LFIWSVFSPKLCYYIAWSILINGLLEHLFN-PLLLT 802
           LFIWSVFSPKLCYY  W+I +N ++  +   PL LT
Sbjct: 773 LFIWSVFSPKLCYYATWNIFMNLVIGWILEIPLALT 808

>ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 812

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/816 (50%), Positives = 557/816 (68%), Gaps = 15/816 (1%)

Query: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60
           ML + I+LL+ Q VAI  F  GFFPQK+VL G+++F+         +P F+K V++V+DA
Sbjct: 1   MLRQIITLLLAQFVAIFIFCCGFFPQKNVLKGNADFIIESSIQTQSKPVFDKFVLIVVDA 60

Query: 61  LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN 120
           LRSDF+F+ ++S F FVH LIN GEAWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILN
Sbjct: 61  LRSDFVFEESISNFKFVHSLINDGEAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE 180
           VAEDD+SSNLK+QDSWL Q  + GK++ F+GDDTWLKLFP  FFQ  +GTNSFFVSDFE+
Sbjct: 121 VAEDDSSSNLKEQDSWLKQFVRQGKKMRFFGDDTWLKLFPLDFFQEYEGTNSFFVSDFEQ 180

Query: 181 VDRNVTRHLPYDLSYQ-EWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDA 239
           VD NVTRHLP+ L  Q +WD+LILHYLGLDHIGHKGG+ S FM  KH EMD+++K+IY+ 
Sbjct: 181 VDLNVTRHLPHQLETQKDWDVLILHYLGLDHIGHKGGARSVFMPGKHAEMDSIVKNIYEN 240

Query: 240 VDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLIN-- 297
           VDE TLVCV+GDHGMN++GNHGGSS GETS+A+V ISKKL  ++ P  QR V +P+    
Sbjct: 241 VDENTLVCVMGDHGMNEVGNHGGSSPGETSSALVMISKKLKQFQPPLHQRDVHLPITTQF 300

Query: 298 SDGD--YQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGT-FAEIKVKDNFR 354
            DG+  Y YLT++QQVD VPTL +LFN PIP+N+VGIII DFL LL +  A IKVKDNF 
Sbjct: 301 QDGEVNYDYLTKVQQVDFVPTLAALFNIPIPKNNVGIIIPDFLQLLDSKMAAIKVKDNFN 360

Query: 355 QLMKLANNTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCE 414
           QL  L   T E    SI+   EQMK  Q+ L  +ATNY Y  L  G  +L  +T +    
Sbjct: 361 QLASLLGRTLEVKNESINEEFEQMKDLQEVLTKSATNYKYPILAAGFGLLTVLTAVALWY 420

Query: 415 FYRTFKQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDH 474
                + +K   LT+ +             VEEEHQIWWW++T A+ +S +        H
Sbjct: 421 GISIMQLSKSSLLTIVLSLLLGIATFSSSFVEEEHQIWWWVITGALLLSQLYLRKALGLH 480

Query: 475 FLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTF 534
           F+  VC RLIRGWNNSGQKY Y+NTI+++L+  P  +W +N  T+F V       + ++F
Sbjct: 481 FVCFVCVRLIRGWNNSGQKYTYDNTIFELLKANPGVQWYLNILTIFTVGLGGSLGDRLSF 540

Query: 535 VSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFL----IGPDNMLKEALVPLAR 590
           + SF    LC +YK  W +VN   VP W+Q     +C F       P+ +  +ALVP+A+
Sbjct: 541 ILSFSLCALCGSYKISWAIVNREDVPFWMQELAFKSCLFFTKEHTNPEEVFGKALVPMAQ 600

Query: 591 LCFQSILASIVFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAIN 650
             F+  +A +V ++  ++       L S++ +   +L+ Q+  +NIPLF +F V++ A++
Sbjct: 601 FFFKYFIACLVVKISASKIGVCKANLFSMLSI---LLMFQSPTANIPLFFIFEVLRAALS 657

Query: 651 RILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFL 710
           R+ T+   ++   +S + SL++Q FTF+QFGGTNSIA+I+L+N+YNGV ++YNIY+VGF+
Sbjct: 658 RLFTDYYGSNTYFVS-LSSLLLQYFTFYQFGGTNSIASIDLSNAYNGVPENYNIYLVGFM 716

Query: 711 TFISNFAPVIYWSLNLIEVYQEPNKKHT-YLVERLPILFHYSVTGVFLLISCLALRYHLF 769
            F+SNFAP IYWSL    + +  ++K   Y  +++P L    V GVFLLI+C   R+HLF
Sbjct: 717 MFVSNFAPTIYWSLYKSTIPRPESRKWILYAEQKIPFLIFNCVVGVFLLIACYVFRFHLF 776

Query: 770 IWSVFSPKLCYYIAWSILINGLLEHLFNPLLLTVTN 805
           IWSVFSPKLCY+++W+I +N ++E     ++  V N
Sbjct: 777 IWSVFSPKLCYFVSWNIFMNIIIECGLESIVWAVGN 812

>KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 787

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/797 (51%), Positives = 530/797 (66%), Gaps = 51/797 (6%)

Query: 8   LLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLF 67
           L   QLVA+  F  GFFPQK VL  DS+F+  PE     +P F+K+V++VIDALRSDFLF
Sbjct: 9   LATLQLVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLF 68

Query: 68  QANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTS 127
           Q + S F F+H L+N GEAWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDDTS
Sbjct: 69  QKDSSDFEFLHGLLNSGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDTS 128

Query: 128 SNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTR 187
           SNLK+QDS L Q H H  +++F+GDDTWLKLFP  FF   DGTNSFFVSDFEEVD NVTR
Sbjct: 129 SNLKEQDSLLKQFHTHHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTR 188

Query: 188 HLPYDLSYQE-WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDERTLV 246
           H+PY + +Q+ WD+LILHYLGLDHIGHKGGS S FM  KH EMD+VIK IY+ +D  TL+
Sbjct: 189 HVPYQMEHQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYEKIDGDTLM 248

Query: 247 CVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLT 306
            VLGDHGMND+GNHGGSS+GETSAA+ F+SK+L  Y++ + Q+   VP+ ++  DY+YL 
Sbjct: 249 VVLGDHGMNDLGNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVEDAHPDYKYLK 308

Query: 307 RIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLL-GTFAEIKVKDNFRQLMKLANN-TP 364
            ++Q+DIVPTL  LFN PIP+NS+G+II + L LL    A IKV+DN+ QL KL      
Sbjct: 309 EVEQIDIVPTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQDNYLQLTKLKPGYEA 368

Query: 365 EFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFKQTKI 424
           +    S   LLE+M+  Q  LA AATNYNY FL  G +++   T+I++      F+ ++ 
Sbjct: 369 QLEKKSAGTLLEEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTLIVTV---WNFQLSQE 425

Query: 425 LSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVCARLI 484
               V               +EEEHQIWWWI  + + +  + N        +V    RLI
Sbjct: 426 YIEHVGTSVLLGISMFASSFIEEEHQIWWWITISVLLLMQISNGK----KLVVLSGLRLI 481

Query: 485 RGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAF------ETVEFNLMTFVSSF 538
           RGWNNSGQKYIY+N ++ +L+ + +  W +N  T   V F      +  E  +     SF
Sbjct: 482 RGWNNSGQKYIYDNVLHTLLKSHTSVLWWLNVVTFLSVGFPFLRNKDESEKMVSLLSVSF 541

Query: 539 VTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPDNM----LKEALVPLARLCFQ 594
           + ++  + YK C+ +VN   VP+ L  F   +C+  +  +N     + + LVP+AR+ FQ
Sbjct: 542 LALS-SITYKICFAIVNGDKVPSGLYTFALRSCAMYLANENATESDISQCLVPIARIFFQ 600

Query: 595 ----SILASIVFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAIN 650
               SI+  +  +   N+   S   L  ++ +I  +L+LQTS +NIPLFL+F        
Sbjct: 601 ICGVSIIILLFMKYALNK---STNMLNKLLSVIKFVLLLQTSSANIPLFLIF-------- 649

Query: 651 RILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFL 710
            ILT+++ +    I+ I SL +QN TFFQFGGTNSIAT+NLTN+YNGVS +YNIYVVG L
Sbjct: 650 EILTSVTPD----ITPIFSLCLQNLTFFQFGGTNSIATVNLTNAYNGVSSNYNIYVVGVL 705

Query: 711 TFISNFAPVIYWSLNLI-EVYQEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLF 769
            F+SN+AP IYW+L+LI + Y++   +          L HY +TG  L+I+C+ALRYHLF
Sbjct: 706 MFLSNYAPSIYWALSLIPQSYKQKTLR----------LQHYYITGTCLMIACIALRYHLF 755

Query: 770 IWSVFSPKLCYYIAWSI 786
           IWSVFSPKLCYY AWS+
Sbjct: 756 IWSVFSPKLCYYAAWSL 772

>Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {ON}
           complement(61260..63767) [2508 nt, 836 aa]
          Length = 835

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/829 (47%), Positives = 555/829 (66%), Gaps = 30/829 (3%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           ++LI QL+++L F IGFFP K+VL GD+ F    +     +P F K+V++VIDALRSDFL
Sbjct: 8   AILIIQLISVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFL 67

Query: 67  FQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDT 126
           F  ++S F+++H+L N G AWG+TA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDD+
Sbjct: 68  FDQDISQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDS 127

Query: 127 SSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVT 186
           SSNLK+QDSW  Q  KHGK+I F+GDDTWLKLFP   F   +GTNSFFVSDFE+VD NVT
Sbjct: 128 SSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVT 187

Query: 187 RHLPYDLSYQ-EWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV--DER 243
           RHL   +  + +WD LILHYLGLDHIGHKGG  S+FM PKH EMD++IK++++ V  DE 
Sbjct: 188 RHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDEN 247

Query: 244 TLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLIN------ 297
           TL+CV+GDHGMN++GNHGGSS GETSA +V ISKKL N++ P  Q+GV++P+ +      
Sbjct: 248 TLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPE 307

Query: 298 SDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQL 356
            D  Y++LT+IQQVDIVPTL +LFN P P+N+VG+++   L LL      IK+++NFRQL
Sbjct: 308 EDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQL 367

Query: 357 MKLANNTP--------EFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFIT 408
           M ++NN          +F    I  ++ +MK  Q +L ++ATNYN   L +GL ++  +T
Sbjct: 368 MIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPLLYLGLGLIFILT 427

Query: 409 IIISCEFYRTFKQTKILS-LTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMN 467
           + IS  FY +  +    + L V I             VEEEHQIWWWI+T  + +S +  
Sbjct: 428 LTISFWFYFSVLEVDFKNVLIVIISLLIGLSSFASSFVEEEHQIWWWIITGLITVSAINL 487

Query: 468 PSLTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILE-RYPNTKWLINAATMFLVAFET 526
           P     H ++ VC R+IRGWNNSGQKY Y+ TI  +L   Y + +W +N AT+  +  + 
Sbjct: 488 PDQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKD 547

Query: 527 VEFNLMTFVSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFL-----IGPDNML 581
              NL++F+ S+   ++C+ YK CWT++N+  VP  +       C  L     +   +++
Sbjct: 548 STDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVV 607

Query: 582 KEALVPLARLCFQSILASIVFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLL 641
           +E L+P+AR  F S+LA ++      + K     ++ I   +  +L+ Q+  S I LF++
Sbjct: 608 EENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMV 667

Query: 642 FTVMKIAINRILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQS 701
           + +++ +++ +L N  S+++  I+  +SL++Q FTFFQFGGTNSIAT +LTN+YNGVS+ 
Sbjct: 668 YDILQSSLSSLLVNQYSSNV-MITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSED 726

Query: 702 YNIYVVGFLTFISNFAPVIYWSL---NLIEVYQEPNKKHTYLVE-RLPILFHYSVTGVFL 757
           YNIY VGFL  +SNFAP IYW++    +I    +PN K     E +LPI++   + G FL
Sbjct: 727 YNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFL 786

Query: 758 LISCLALRYHLFIWSVFSPKLCYYIAWSILINGLLEHLFNPLLLTVTNK 806
           L+SC  LRYHLFIWSVFSPKLCYY  W+I +N ++  +    +L++ +K
Sbjct: 787 LLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVDK 835

>KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {ON}
           Anc_1.317 YJL062W
          Length = 821

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/816 (46%), Positives = 541/816 (66%), Gaps = 20/816 (2%)

Query: 8   LLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLF 67
           +L+ QL+++L FAIGFFPQK+V+ G++ F    +  +  +  F+K+V++VIDALRSDFLF
Sbjct: 8   VLVAQLLSVLLFAIGFFPQKNVMNGNATFSINKKLQEETKQPFKKLVLIVIDALRSDFLF 67

Query: 68  QANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTS 127
             + S FHFVH  +N GEAWGYTAYSNPPTVTLPRLKGITTGS PNFLDA+LNVAEDD+S
Sbjct: 68  DESSSNFHFVHSKLNSGEAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDALLNVAEDDSS 127

Query: 128 SNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTR 187
           SN+KDQDSWL Q H  G R+ F+GDDTWLKLFP  FF   +GTNSFFVSDFE+VD NVTR
Sbjct: 128 SNVKDQDSWLKQFHSKGYRMRFFGDDTWLKLFPLEFFNDYEGTNSFFVSDFEQVDLNVTR 187

Query: 188 HLPYDLSYQE-WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDERTLV 246
           H+P  L   E WD+LILHYLGLDHIGHKGG+ S+FM  KH EMD ++  +YD +DE TL+
Sbjct: 188 HIPRQLEKTEDWDVLILHYLGLDHIGHKGGANSKFMPAKHREMDQIVGKLYDNLDEDTLL 247

Query: 247 CVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLT 306
            V+GDHGMND GNHGGSSAGETSA +VF SKKL+ +K P  Q   ++P+ ++  DYQYLT
Sbjct: 248 IVMGDHGMNDAGNHGGSSAGETSAGLVFFSKKLSKFKIPIRQLNARLPITSNSSDYQYLT 307

Query: 307 RIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQLMKLAN---- 361
           ++QQ+D+VPTL +L+N PIP+NSVG+II DFL LL     + K+ +N++QL++L+     
Sbjct: 308 QVQQMDLVPTLAALYNVPIPKNSVGVIIPDFLQLLDPNIIDTKLLENYKQLLELSKVEYD 367

Query: 362 ----NTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYR 417
               N   F           MK  Q+ L  A T Y+Y  L IG  +   +T++++   + 
Sbjct: 368 DELFNLNVFDLEKRSECQRIMKTLQEKLIAATTEYDYTMLAIGCFMSLVLTLVMAIFSFF 427

Query: 418 TFKQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLV 477
                K    +V +             VEEEHQIWWW++T  + IS        ++H ++
Sbjct: 428 QMASNKYFFASVLLASILGFSCFGSSFVEEEHQIWWWVITGCLFIS-AAKTMHYFEHSVI 486

Query: 478 SVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSS 537
            +C RLIRGWNN+GQK +Y   I +ILE     +W +NA T F+++    + ++  F+SS
Sbjct: 487 LLCLRLIRGWNNTGQKTVYPYVISKILEENSTLQWNLNALTFFVISLNGNQNSMWGFISS 546

Query: 538 FVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLI-GPDNMLKEALVPLARLCFQSI 596
                LCLAYK  W +VN+ +VP ++Q  ++   SF   G        L+P+A     S+
Sbjct: 547 STLGILCLAYKATWAVVNKEIVPWYIQNIMDNCASFFQDGNKKDYSSTLIPMASFFLHSV 606

Query: 597 LASIVFRVCYNRF-KSSPK-TLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILT 654
            A I F + + +F K  P  +L+ I   +  +++  +S  NIP FL+F +M+  I++IL 
Sbjct: 607 AAIIFFTLLWGKFNKHHPSFSLKCISKYVTILMMFLSSSVNIPQFLIFEIMRSFISKILK 666

Query: 655 NLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFIS 714
              ++++  ++ ++SL +QNF FFQFGGTNSIATI+++N+Y+G+S++YNIYV+G L  +S
Sbjct: 667 KHYNSNI-YLTSLISLCLQNFAFFQFGGTNSIATIDISNAYHGISENYNIYVIGVLMVLS 725

Query: 715 NFAPVIYWSL---NLIEVYQEP--NKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLF 769
           NFAP IYW++   ++I   +E   NK  ++   ++P      + G+ L+++C+  RYHLF
Sbjct: 726 NFAPSIYWAMFSWDIIYDIKETNFNKWASFTKSKIPTSLFNCIVGLCLMLACVMFRYHLF 785

Query: 770 IWSVFSPKLCYYIAWSILINGLLEHLFNPLLLTVTN 805
           +WSVFSPKLCY++ W++ +N +   +   LLL++TN
Sbjct: 786 VWSVFSPKLCYFVGWNLFMNAIFGWVLEVLLLSITN 821

>NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa]
           {ON} Anc_1.317 YJL062W
          Length = 831

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/797 (47%), Positives = 533/797 (66%), Gaps = 28/797 (3%)

Query: 20  AIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQANVSGFHFVHD 79
           AIGFFPQK+VL G ++F Y  E+ +  +P F+K+V++VIDALRSDFLF    S FHF+H 
Sbjct: 21  AIGFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHS 80

Query: 80  LINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQ 139
            +N+G AWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDD S+ L DQDS L+Q
Sbjct: 81  QLNEGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSTTLADQDSLLAQ 140

Query: 140 LHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTRHLPYDLSY-QEW 198
            H   K+I+F+GDDTWLKLFP  +F   +GTNSFFVSDFE VD NV+RHL   L +  +W
Sbjct: 141 FHLQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRHLTKQLKHNHDW 200

Query: 199 DILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMG 258
           D+LI+HYLGLDHIGHK G++S+FM  KHIEMD +++ +Y+ +D+ TL+ V+GDHGMN++G
Sbjct: 201 DVLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENIDDDTLLVVMGDHGMNEVG 260

Query: 259 NHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLI-NSDGDYQYLTRIQQVDIVPTL 317
           NHGGSSAGETSA +VF+S KL   + P  QR + +P+   +D ++Q+LT +QQ+D+VPTL
Sbjct: 261 NHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIKRQTDENFQFLTSVQQIDLVPTL 320

Query: 318 VSLFNFPIPQNSVGIIIKDFLPLL-GTFAEIKVKDNFRQLMKLAN-----NTPEFAGASI 371
            +LFN PIP+N+VGI+I +FL  L      IK+ +N+ QL++L+      N P F     
Sbjct: 321 ATLFNIPIPKNNVGIVIPEFLQFLRKDMINIKLMENYHQLLQLSKGQDLPNIP-FDHMDS 379

Query: 372 DMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFKQTKILS--LTV 429
             ++ +MK  QD+L   ATNYNY +L  G  +L F T+ +   F    K     +  +T+
Sbjct: 380 KNIMNKMKEIQDELTKNATNYNYSYLGRGYLLLIFTTVTVFIVFILNQKSLYCATTIITI 439

Query: 430 AIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGIS----WVMNPSLT--WDHFLVSVCARL 483
            I             VEEEHQIWWWI+T ++  S     + NPS +  ++HFL++VCAR+
Sbjct: 440 VISLLVGLSSFGSSFVEEEHQIWWWIITGSIMFSCIETLISNPSKSTVFNHFLIAVCARI 499

Query: 484 IRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFE-TVEFNLMTFVSSFVTVT 542
           IRGWNNSGQK++YE  +  IL+ + NT W +   T++ +  + T+  + ++F+  F   T
Sbjct: 500 IRGWNNSGQKHVYEFILTNILKNHYNTLWYLICTTIYYIGLKNTIRTDFLSFLGPFFMTT 559

Query: 543 LCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLI----GPDNMLKEALVPLARLCFQSILA 598
           LC  YK  W +VN   VP W           L+     P +  KEAL+PLA L +Q+ +A
Sbjct: 560 LCFVYKLDWAIVNNESVPEWFYVITKEASDILLKVGHSPKDAFKEALLPLATLFYQTFVA 619

Query: 599 SIVFRVCYNRFKSSPKT-LQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLS 657
            +  R+ +  F S  KT    I   I+ +L+ Q++ +NIP FL+F  +K +I ++L N  
Sbjct: 620 LVSIRIIFLVFFSRRKTFFDDISNYISLLLIFQSTATNIPQFLVFEFLKKSITKVLQNYH 679

Query: 658 SNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFA 717
             + +    ++SLI+Q+FTFFQFGGTNSIATI+++N+Y+G+S++YNIY+VG    ISNFA
Sbjct: 680 QENKNNYLPLISLILQSFTFFQFGGTNSIATIDISNAYHGISENYNIYLVGIFMTISNFA 739

Query: 718 PVIYWSLNL-----IEVYQEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWS 772
           P IYW +++      E+ +  +K + Y   +LP+L    + G  LL +C  LRYHLFIWS
Sbjct: 740 PSIYWIISMWPILYAEIPESSSKWNIYFKNKLPLLVFNCIVGCCLLAACYILRYHLFIWS 799

Query: 773 VFSPKLCYYIAWSILIN 789
           VFSPKLCY++ W++ +N
Sbjct: 800 VFSPKLCYFLGWNVFMN 816

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/838 (46%), Positives = 540/838 (64%), Gaps = 53/838 (6%)

Query: 19  FAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQANVSGFHFVH 78
           FA GFFPQK+V+ GDS+F           P F K+V++VIDALRSDFLF +  S FHFVH
Sbjct: 19  FATGFFPQKTVIKGDSQFQINATLQSQTRPTFNKLVLIVIDALRSDFLFDSQKSHFHFVH 78

Query: 79  DLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLS 138
             +NKG AWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDD SS L+DQDS + 
Sbjct: 79  SQLNKGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDISSTLEDQDSLIK 138

Query: 139 QLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTRHLPYDLSYQEW 198
           Q +  GK + F+GDDTWLKLFP H+F   +GTNSFFVSDFE VD+NVTRHLP  L+  + 
Sbjct: 139 QFYMQGKNLKFFGDDTWLKLFPHHWFSEFEGTNSFFVSDFEIVDKNVTRHLPEQLAANDA 198

Query: 199 DILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV------DERTLVCVLGDH 252
           D+LILHYLGLDHIGHK G++S+FM  KH+EMD +IK IY++       D+ TL+ V+GDH
Sbjct: 199 DVLILHYLGLDHIGHKDGASSKFMKHKHLEMDEIIKMIYESTQYSNEYDDNTLMVVMGDH 258

Query: 253 GMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPL---INSDG--DYQYLTR 307
           GMN++GNHGGSSAGETSA MVF+S+KLA Y  P+ Q   +VPL   +N +G  ++QYL  
Sbjct: 259 GMNEVGNHGGSSAGETSAGMVFLSEKLAKYSTPQEQMNFEVPLLPNLNEEGQNNFQYLNS 318

Query: 308 IQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQLMKLANNTPEF 366
           IQQVD+VPTL +LF  PIP+NSVG+II +FL +L       K+K+N+ QL++L+  +   
Sbjct: 319 IQQVDLVPTLATLFGLPIPKNSVGVIIPEFLQMLDPQIISTKIKENYNQLLQLSKKSANE 378

Query: 367 AGASID--------MLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRT 418
              + D        +L  +MK  Q++L   ATNYNY  LIIG SIL   T+  S   ++ 
Sbjct: 379 YEYNFDSDLDVNQEILQNEMKNIQNELTKTATNYNYNLLIIGYSILVISTLFTSLLIWKD 438

Query: 419 FKQTKILSL--TVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWD--- 473
           + +  I  L     I             VEEEHQIWWWI T  + +S V   +L      
Sbjct: 439 YSKKNIFQLIPITVISIMLGVSTFSSSFVEEEHQIWWWITTGFITVSLVSTLTLQNGFSP 498

Query: 474 ------HFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFET- 526
                 H ++  CAR++RGW+NSGQKYIY++ +  +L+ + N +W +N  T+ ++ F+  
Sbjct: 499 LKTILYHLIIFGCARILRGWSNSGQKYIYDHVLSNVLKSHTNIQWYLNLLTILIIGFQKD 558

Query: 527 VEFNLMTFVSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPD-NMLKEAL 585
              N   F  +F    LC  YK  W +VN   VP+W  A     CS LIGP     +++L
Sbjct: 559 STSNFFKFTITFFLSVLCFIYKVNWAIVNNENVPDWFYASTYEACSILIGPTATTFQDSL 618

Query: 586 VPLARLCFQSILASIVFRVCYNRF---KSSPKTL--QSIIPLINTILVLQTSPSNIPLFL 640
           +P+A L  ++I+ +I+ R+ Y++    K++  +L    I+  I  +L+ +TS + I  FL
Sbjct: 619 IPMANLFLKAIVTTIIGRIIYSKIFIGKNNKDSLLIPDIVKYIKLLLIFETSSTKISQFL 678

Query: 641 LFTVMKIAINRILT---NLSSNDLS---QISCI--LSLIMQNFTFFQFGGTNSIATINLT 692
           +F ++     ++L    + S ND++   ++S I  +SLI+QNFTFFQFGGTNSIATI+++
Sbjct: 679 IFEIINHIWPKLLNLVKDTSDNDIANSIELSLIPLISLILQNFTFFQFGGTNSIATIDIS 738

Query: 693 NSYNGVSQSYNIYVVGFLTFISNFAPVIYWSL-------NLIEVYQEPNKKHTYLVERLP 745
           N+Y+G+S++YNIY VG    ISNFAP IYW++       N   +  + +K   +   +LP
Sbjct: 739 NAYHGISENYNIYQVGLFMTISNFAPSIYWTIITWPTLYNSTSITNKNSKWIIFASNKLP 798

Query: 746 ILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSILINGLLEHLFNPLLLTV 803
           ILF   + G  LL SC  LRYHLFIWSVFSPKLCY++ W++ +N ++ ++   L++ +
Sbjct: 799 ILFFNCIVGCCLLASCYILRYHLFIWSVFSPKLCYFLGWNLFMNSIVGYIVEGLIVAL 856

>TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {ON}
           Anc_1.317 YJL062W
          Length = 827

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/825 (48%), Positives = 540/825 (65%), Gaps = 30/825 (3%)

Query: 4   RAISLLIC---QLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60
           R  SLLIC   QL A+  F IGFFPQKSVL G S F       +   P F K++++VIDA
Sbjct: 2   RFKSLLICLSLQLAAVFIFCIGFFPQKSVLNGSSTFQIEKSLQQEAPPVFSKLILVVIDA 61

Query: 61  LRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILN 120
           LRSDF+F +N+S F F H L+N G AWG+TAYSNPPTVTLPRLKG+TTGS PNFLDAILN
Sbjct: 62  LRSDFIFDSNISNFPFTHSLLNNGNAWGFTAYSNPPTVTLPRLKGLTTGSTPNFLDAILN 121

Query: 121 VAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEE 180
           VAEDD SSNLKDQDS L+Q + + K+I F+GDDTWLKLFP  +F+  +GTNSFFVSDF +
Sbjct: 122 VAEDDNSSNLKDQDSLLNQFYLNNKKIRFFGDDTWLKLFPLDYFEEHEGTNSFFVSDFTQ 181

Query: 181 VDRNVTRHLPYDLSYQ-EWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDA 239
           VD NVTRH+P  L  + +WD+LILHYLGLDHIGHKGG  S+FM  KH EMD +I+ +Y+ 
Sbjct: 182 VDNNVTRHIPKQLQEKNDWDVLILHYLGLDHIGHKGGPRSKFMPTKHEEMDGIIRQLYEN 241

Query: 240 VDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSD 299
           +D   L+C+LGDHGMN++GNHGGSS GETSAAMVF S KL+N++ P  Q+ +++P+    
Sbjct: 242 LDNDGLLCILGDHGMNELGNHGGSSNGETSAAMVFASPKLSNFELPSKQKEIKLPITKPS 301

Query: 300 GD---YQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLL--GTFAEIKVKDNFR 354
            D   ++YLT IQQVD VPT+ +LFN PIP+NSVGIII+  L LL       IK+K+N++
Sbjct: 302 EDENSFKYLTEIQQVDFVPTIATLFNLPIPRNSVGIIIEPLLKLLRNSKLESIKLKENYK 361

Query: 355 QLMKLAN---NTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIII 411
           QL+ LA+      + +      L  +M   Q+DL  +ATNY Y FL  G+      TI+ 
Sbjct: 362 QLLDLAHIHSTMDDISSLEDFELFTKMVSIQEDLTRSATNYFYEFLAAGIISSIIGTILY 421

Query: 412 SCEFYRTFKQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLT 471
           +    +  K   I  +++ I             VEEEHQIWWWI+T  + +S  + P+  
Sbjct: 422 AVLITKDLKFNGIEIISIIISLLIGLSMFGSSFVEEEHQIWWWIVTGLITLSLYLKPNTK 481

Query: 472 WDHFLVSVCARLIRGWNNSGQKYIYENTIYQILER--YPNTKWLINAATMFLVAFETVEF 529
             H  + +C RLIRGWNNSGQKY+YE+TI  IL R  Y + +W +  AT+  V+F     
Sbjct: 482 LLHLTLFICVRLIRGWNNSGQKYVYESTISNILSRIEYKDMQWYLILATITFVSFNDSMK 541

Query: 530 NLMTFVSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLI---GPDNMLKEALV 586
           NL TF  S     L  ++K  W++ N   VP  ++         L      D +   AL 
Sbjct: 542 NLPTFAMSLSLGVLVFSFKVSWSITNGEKVPFVIKDMARTVVKLLFPDESKDIIFSLALN 601

Query: 587 PLARLCFQSILASIVFRVCYNRFKSSPKTLQSII----PLINTILVLQTSPSNIPLFLLF 642
           PLA+L F   L  +V ++   + K   KT+ +I      ++N + ++QT PSNIP+F +F
Sbjct: 602 PLAQLFFHCTLGFLVIKLLIQKLKID-KTVDNIFDELTKVMNLVAIMQTRPSNIPMFCVF 660

Query: 643 TVMKIAINRILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSY 702
            +MK+ + +I+ +   N    ++ I SL++Q+FTFFQFGGTNSIAT++L+N+YNGVS++Y
Sbjct: 661 EIMKMILVKIIKH-DYNSNPYVTSIASLVLQHFTFFQFGGTNSIATVDLSNAYNGVSENY 719

Query: 703 NIYVVGFLTFISNFAPVIYWSL---NLIEVYQEPN--KKHTYLVER-LPILFHYSVTGVF 756
           NIY VG L  I+NFAP IYW++   +++  Y   +  ++  ++  + LP+LF++ + G F
Sbjct: 720 NIYYVGLLMTIANFAPSIYWAVFSWDILYSYDTNSILRRQNFMKSKVLPLLFYF-IIGCF 778

Query: 757 LLISCLALRYHLFIWSVFSPKLCYYIAWSILINGLLEHLFNPLLL 801
           L +SC  LRYHLFIWSVFSPKLCYY+AWSI +N ++  +F  +L+
Sbjct: 779 LFLSCFILRYHLFIWSVFSPKLCYYVAWSIFMNCIVGWVFEGILV 823

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/823 (47%), Positives = 534/823 (64%), Gaps = 36/823 (4%)

Query: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPM-----EPQFEKMVV 55
           ML R  + LI QL+AI  F +GFFPQK VL G +EF   PE    +     EP F K ++
Sbjct: 1   MLGRLGAALILQLIAIFIFCLGFFPQKKVLKGQAEF--NPENLDRLGSNREEPVFNKFIL 58

Query: 56  MVIDALRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFL 115
           +V+DALRSDF+F ++ S F FVH  +N GEAWG+TA+S+PPTVTLPRLKGITTGS PNFL
Sbjct: 59  VVVDALRSDFIFDSHNSHFDFVHSKLNSGEAWGFTAFSSPPTVTLPRLKGITTGSTPNFL 118

Query: 116 DAILNVAEDDTSSNLKDQDSWLSQLHKHGKR-IHFYGDDTWLKLF--PSHFFQRSDGTNS 172
           DA+LNVAEDD +S +K+QDSW++Q   +G + I F+GDDTWLKLF   +  FQ  +GTNS
Sbjct: 119 DALLNVAEDDQTSTIKEQDSWINQFLTNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNS 178

Query: 173 FFVSDFEEVDRNVTRHLPYDLSYQ-EWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDA 231
           FFVSDF +VD NVTRH+P  L  + +WD LILHYLGLDHIGHKGG+ S FM  KH EMD 
Sbjct: 179 FFVSDFTQVDLNVTRHIPTQLQEKDQWDTLILHYLGLDHIGHKGGAYSHFMPEKHKEMDN 238

Query: 232 VIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGV 291
           V+KD+Y+ VD  TL+ V+GDHGMND+GNHGGSS GET A +VF+S+KL+ +  P +Q   
Sbjct: 239 VLKDLYENVDPDTLIVVMGDHGMNDVGNHGGSSPGETHAGLVFLSEKLSRFPKPHSQYET 298

Query: 292 QVPL---INSDGD--YQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGT-FA 345
            +PL   + +DGD  ++YLT++QQVDIVPTL +LFN PIP+NSVGI+IKDF+PLL     
Sbjct: 299 -IPLNTPVTADGDKTFEYLTQVQQVDIVPTLATLFNVPIPKNSVGILIKDFIPLLDKHLR 357

Query: 346 EIKVKDNFRQLMKLANNTPEF-AGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSIL 404
           E KV +N++QL  L+N+      G ++D + E+M+  Q++L   AT+YNY  L+ G  IL
Sbjct: 358 EAKVGENYQQLFTLSNSMETVNVGLTVDEMYEKMRAVQENLTRNATDYNYRALVPGYVIL 417

Query: 405 CFITIIISCEFYRTFKQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISW 464
             +T        +  + +      + I             VEEEHQ+WWW++T ++  + 
Sbjct: 418 VCVTAYCLILAVQRMRLSGAFVALLGISFLTGISMFGSSFVEEEHQLWWWVITGSILFTL 477

Query: 465 VMNPS---LTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFL 521
               S    T     +S+  RLIRGWNN+GQK  Y   I  IL  +P  KW +N      
Sbjct: 478 AFRQSSWHTTSSCITLSLAVRLIRGWNNTGQKTTYTYVIGNILAAHPTIKWNLNVLAFLA 537

Query: 522 VAFETVEFNLMTFVSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFL---IGPD 578
           V     E +LM+F    V + + LAYK  W LVN+  VP +   F+ +    +   +G D
Sbjct: 538 VCQSNTE-SLMSFCGHIVLIVVALAYKINWALVNKENVPVYAFQFLQIIGRLIKVNVGED 596

Query: 579 -NMLKEALVPLARLCFQSILASIVFRVCYNRFKSSP--KTLQSIIPLINTILVLQTSPSN 635
              L+EAL+PLAR+ ++ +L+  V ++   + +  P    ++ I      +L+  +S SN
Sbjct: 597 IENLEEALIPLARVFYRLVLSFTVVKIVLAKIRLQPPHSLIKDISKNFVVLLMFLSSTSN 656

Query: 636 IPLFLLFTVMKIAINRILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSY 695
           IP FL+F +MK+ I +I+ +   +D+S I+ I+SLI+QNFTFFQFG TNSIATI+L+N+Y
Sbjct: 657 IPQFLIFEIMKVCITQIIKDEYGSDIS-ITAIVSLILQNFTFFQFGRTNSIATIDLSNAY 715

Query: 696 NGVSQSYNIYVVGFLTFISNFAPVIYWSL---NLIEVYQEPNKKHTYL---VERLPILFH 749
           +G+S++YNIY VG+L  ISNFAP +YW++   N+  V      K  +L     +LPI   
Sbjct: 716 HGISENYNIYAVGWLMVISNFAPALYWAIYPWNITYVTPTGICKARWLRFAKGKLPITLF 775

Query: 750 YSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSILINGLL 792
             + G  LL +C+ALRYHLFIWSVFSPKLCYY+ W++ +  ++
Sbjct: 776 NGLVGCCLLAACVALRYHLFIWSVFSPKLCYYVFWNLFMASII 818

>TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {ON}
           Anc_1.317 YJL062W
          Length = 824

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/823 (47%), Positives = 534/823 (64%), Gaps = 44/823 (5%)

Query: 14  VAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQANVSG 73
           +AI  F +GFFP K+VL G  EF +  E     +P F K+V +VIDALRSDFL++   S 
Sbjct: 12  IAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSH 71

Query: 74  FHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQ 133
           FHFVH ++N GEAWG+TA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDD SS+LKDQ
Sbjct: 72  FHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQ 131

Query: 134 DSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTRHLPYDL 193
           DSWL Q +KH K I F+GDDTWLKLFP + F   +GTNSFFVSDFE+VD NVTRHL    
Sbjct: 132 DSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQF 191

Query: 194 SYQE-WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVD--ERTLVCVLG 250
             +E WD+LILHYLGLDHIGHKGGS S+FM  KH EMD++++DIY+++   E TL+CV+G
Sbjct: 192 KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVMG 251

Query: 251 DHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVP------LINSDGDYQY 304
           DHGMN+ GNHGGSS+GETSA +  ISKK      P+ Q    +P      L   + DY++
Sbjct: 252 DHGMNNGGNHGGSSSGETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKF 311

Query: 305 LTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQLMKLAN-- 361
           L+ +QQVD VPTL +LFN P+P NSVG++I + L LL       K+K+NF QL +L+   
Sbjct: 312 LSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSL 371

Query: 362 ------NTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEF 415
                 N  +F   +I+ ++ QM+  Q +L  +ATNYN   + I + +L  +T+II    
Sbjct: 372 TTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATNYNMNAIYIAIILLSIVTLII---I 428

Query: 416 YRTFKQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGISWVMNPSLTWDHF 475
           ++ F   K   L VA+             +EEEHQIWWW++T     S V N    + +F
Sbjct: 429 HKAFSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNF 488

Query: 476 LVSVCARLIRGWNNSGQKYIYENTIYQILE-RYPNTKWLINAATMFLVAFETVEFNLMTF 534
           +V +C RLIRGWNNSGQKY Y   +  +L+ +Y N +W +N +T+    F+    N  +F
Sbjct: 489 IVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNNFPSF 548

Query: 535 VSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFL-----IGPDNMLKEALVPLA 589
           +SSF+   LCL YK  W +VN+  VP+ ++ +V + C+ L     + P  + +  L+PLA
Sbjct: 549 MSSFLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTLIPLA 608

Query: 590 RL--CFQSILASIVFRVCYNRFKSSPKTLQSIIPLIN------TILVLQTSPSNIPLFLL 641
           RL  C   IL S+   +     K SP  L +  P+ N       +L+ QTSP NI L+LL
Sbjct: 609 RLFFCCVVILLSLTLVIG----KLSPTRLGN--PVSNIKKIIIFLLIFQTSPENIGLYLL 662

Query: 642 FTVMKIAINRILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQS 701
           F +++  +  I+    S + +Q+   +SL+MQ FTF+QFG TNSIATI+LTN+YNGVS+ 
Sbjct: 663 FGILETNLTDIIDKHYSGN-TQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSED 721

Query: 702 YNIYVVGFLTFISNFAPVIYWSLNLIEVYQEPNKKHTYLVERLPILFHYS-VTGVFLLIS 760
           YNIY VG++  ISN+AP IYWS+    +  +  +K    +ER  I+  ++ ++G+FLLI+
Sbjct: 722 YNIYFVGWMMSISNYAPAIYWSM-FPWIIDDNKQKWKKFIERKNIILLFNCISGLFLLIT 780

Query: 761 CLALRYHLFIWSVFSPKLCYYIAWSILINGLLEHLFNPLLLTV 803
           C  LRYHLFIWSVFSPKLCYY+ W+I +N ++  +   L+  V
Sbjct: 781 CTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLVTYV 823

>CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062w LAS21
          Length = 842

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/849 (45%), Positives = 529/849 (62%), Gaps = 63/849 (7%)

Query: 8   LLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLF 67
           L++   +A+L F  GFFPQK VL G +      +     +P F+K+VV+V+DA+RSDFLF
Sbjct: 5   LVVAHAIAVLIFGCGFFPQKKVLDGHAAL----DGTHARDPVFDKLVVVVVDAMRSDFLF 60

Query: 68  QANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTS 127
            A++S FHF+H+ +  G AWG+TA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDDTS
Sbjct: 61  DASISKFHFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDTS 120

Query: 128 SNLKDQDSWLSQLHKH-GKRIHFYGDDTWLKLFP--------SHFFQRSDGTNSFFVSDF 178
           S+L  QDSWL Q   + GKRI F+GDDTWLKLFP           F   +GTNSFFVSDF
Sbjct: 121 SSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFVSDF 180

Query: 179 EEVDRNVTRHLPYDL-SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIY 237
            +VD NVTRH+   L    EWD+LILHYLGLDHIGHK G  S+FM PKH EMD++I+ +Y
Sbjct: 181 TQVDLNVTRHIDRQLRETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSIIRKLY 240

Query: 238 DAVD-ERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRG-----V 291
           D +D + TL+ ++GDHGMND+GNHGGSSAGETSA MVF+S KLA YK  + Q       +
Sbjct: 241 DELDMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAYKPSKEQSSAKEFPM 300

Query: 292 QVPLINS--DGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIK- 348
           ++P +N+  +  + YL +IQQ+D+VPT+ SLFN  IP+N+VG+II +FL L    +  K 
Sbjct: 301 KIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLFKDVSLQKA 360

Query: 349 -VKDNFRQLMKLANNTPEFAGAS----IDMLLEQMKITQDDLATAATNYNYIFLIIGLSI 403
            VK+N+ QL  L     +    +    I+ +++ MK  Q++LA  AT+YNY  L IG   
Sbjct: 361 IVKENWNQLSGLTKGKTQIMEETKNFVIEDVIKNMKDVQENLAKTATDYNYPLLFIG--- 417

Query: 404 LCFITIIISCE-FYRTFKQTKI---LSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAA 459
            CF++I+I+   +YR  +   I    S+ +AI             +EEEHQ WWWI+T  
Sbjct: 418 -CFLSIVITGTIYYRYARHVAININTSILIAIAALMGISVFGSSFIEEEHQFWWWIITGL 476

Query: 460 VGISWV-MNPSLTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAAT 518
           V +S V +N S    H +V  C RLIRGWNNSGQKY Y+N I  +L+   +  W +N  T
Sbjct: 477 VLLSMVNLNFSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNVIANLLKGNIDALWWLNLIT 536

Query: 519 MFLVA-------FETVEFNLMTF---VSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVN 568
           + +V        F     +L+ F   +S  +   +   YK  W++VN   VP+    +V 
Sbjct: 537 VTVVGLNLKSLRFGNHTVSLLGFSDLLSMGLLSMITFLYKVNWSIVNGERVPDLFYKWVL 596

Query: 569 MTCSFLIGPDNMLKE------ALVPLARLCFQSILASIVFRVCYNRF---KSSPKTLQSI 619
            T S ++    + +E      AL+PLAR+ F+   A +V R+   +F       K+L  +
Sbjct: 597 ETASLIVEDATLYREEDLIHTALIPLARIFFKLFFAVLVSRLMIQKFFQVSDISKSLAVV 656

Query: 620 IPLINTILVLQTSPSNIPLFLLFTVM-KIAINRILTNLSSNDLSQISCILSLIMQNFTFF 678
              +   LV QT   NI LFL F ++ +I ++ I     S+ L  ++ I  +I+Q FTFF
Sbjct: 657 SRYVTIFLVFQTPSHNIGLFLFFEIINEITVHIIRERYQSDYL--LAVIFGIILQFFTFF 714

Query: 679 QFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISNFAPVIYWSL-NLIEVYQEPN--K 735
           Q GGTNSIAT++L+N+YNGVS++YNIYVVG +  ISNFAP IYWS  N    Y   N  +
Sbjct: 715 QSGGTNSIATVDLSNAYNGVSENYNIYVVGLMMCISNFAPTIYWSFYNWRITYANANSSR 774

Query: 736 KHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSILINGLLEHL 795
             T +  + P +   S  G  LL++C+ LRYHLFIWSVFSPKLCYY+ W+I + G++ H 
Sbjct: 775 WQTLVAAKYPFIIIQSTIGCCLLLACIILRYHLFIWSVFSPKLCYYMVWTIFV-GIIVHW 833

Query: 796 FNPLLLTVT 804
              +LL +T
Sbjct: 834 IPEILLLLT 842

>Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {ON}
           YJL062W (REAL)
          Length = 831

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/835 (44%), Positives = 521/835 (62%), Gaps = 51/835 (6%)

Query: 1   MLFRAISLLIC-QLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQ--FEKMVVMV 57
           M  +  + L C QL AIL F   FFP+K VLTG S+    P+E + ++    F+K+V ++
Sbjct: 1   MNLKQFTCLSCAQLFAILLFIFAFFPRKIVLTGISQ--QDPDEDRDLQHNRPFQKLVFVI 58

Query: 58  IDALRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDA 117
           IDALRSDFLF A +S F+ VH  +N GEAWGYT+++NPPTVTLPRLK ITTGS P+F+D 
Sbjct: 59  IDALRSDFLFDAQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 118

Query: 118 ILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSD 177
           +LNVA+D  S++L + DSWL Q  +H   I F GDDTWLKLFP  +F  +D T+SFFVSD
Sbjct: 119 LLNVAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFADPTHSFFVSD 178

Query: 178 FEEVDRNVTRHLPYDL--SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKD 235
           F +VD NVTR+L   L   + +WD+ ILHYLGLDHIGH+ G  S+FM  KH EMD+++K 
Sbjct: 179 FTQVDNNVTRNLQKKLFQEWAQWDVAILHYLGLDHIGHRDGPHSKFMGTKHQEMDSILKS 238

Query: 236 IYDAV-----DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRG 290
           IYD V     D+ TL+CVLGDHGMN++GNHGGSSAGETSA ++F+S KL+ +  PE Q  
Sbjct: 239 IYDQVLEHENDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSRFAKPEPQET 298

Query: 291 VQVPLINS-DGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKV 349
             +P+  + D D+QYL  +QQ+DIVPT+ +LF  PIP NSVGIII DFL LL       +
Sbjct: 299 HILPINGTPDHDFQYLESVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPN-KLASM 357

Query: 350 KDNFRQLMKLANNTPEFA--GASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFI 407
           K+NF  L +L+++  + A    +I+ +  +M   Q+ L  +ATNYNY  L +      F 
Sbjct: 358 KENFMHLWRLSDHHDDVALDDFTINDIYTKMHDIQETLTRSATNYNYPLLAVAFVSFLFT 417

Query: 408 TIIISCEFYR----TFKQTKILSLTVA-IXXXXXXXXXXXXXVEEEHQIWWWILTAAVGI 462
           TI+   +  R    +F    I SL+V  +             +EEEHQ+WWWI+TA+  +
Sbjct: 418 TIVAVYQLQRYSGPSFCHLHISSLSVILVSVILGVSTFASSFIEEEHQLWWWIVTASSVV 477

Query: 463 SWVMNPS-----LTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAA 517
              + PS       W  F++  C RLI+ WNNSGQK+IY N +  +L + P  KW +N++
Sbjct: 478 PLFLYPSNAFVFARW--FIMIACVRLIKFWNNSGQKFIYSNVMSNLLNQNPFWKWYLNSS 535

Query: 518 TMFLVAFETVEFNLMTFVSSFVTVTLCLAYKGCWTLV--NEGLVPNWLQAFVNMTCSFLI 575
           T   +   +    L+ F+ + + V LC  YK  W +V  N+  +P ++Q  +     FL 
Sbjct: 536 TFLALIIPSARSQLLHFIVTTILVGLCFTYKISWEIVNGNQAEIPPFMQGLLT-KMDFLP 594

Query: 576 GPDNMLKEALVPLARLCFQSILASIVFRVCYNRFKSSPKT--LQSIIPLINTILVLQTSP 633
             +N+L      LAR+ FQ+    ++ R+   + K   K   ++ +   I  +L+ QTS 
Sbjct: 595 TENNLLL-----LARVFFQAWSIVVISRLALTKLKVLDKRYLIEDMKLYITVLLIFQTSS 649

Query: 634 SNIPLFLLFTVMKIAI----NRILTNLSSNDLSQI--SCILSLIMQNFTFFQFGGTNSIA 687
            NI  F++F +++  I      + T+LS    S++  S ++SLI+QNFTFFQFGGTNSI+
Sbjct: 650 QNIGQFIIFQILQSQIYYFFQHLPTSLSLTSPSEVYLSSLVSLILQNFTFFQFGGTNSIS 709

Query: 688 TINLTNSYNGVSQSYNIYVVGFLTFISNFAPVIYWSLNLIEV----YQEPNKKHTYLVER 743
           TI+L N+Y+GVS  YNIYVVG L  ++NFAP IYWS+    +        NK  T+++ +
Sbjct: 710 TIDLGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYGSASSQNKLQTFIMSK 769

Query: 744 LPILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSI---LINGLLEHL 795
           +P   ++ + G  L+ +C+ LR+HLFIWSVFSPKLCY++ W++   L+NG L  L
Sbjct: 770 MPAFTYHCIFGACLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGLLNGWLPEL 824

>Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON}
           YJL062W (REAL)
          Length = 830

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/832 (43%), Positives = 516/832 (62%), Gaps = 46/832 (5%)

Query: 1   MLFRAISLLIC-QLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQ----FEKMVV 55
           M  + +  L C QL AIL F   FFP+K VL G S+    P++ +  + Q    F+K+V 
Sbjct: 1   MNLKQLMCLSCAQLFAILLFIFAFFPRKIVLPGISQ--QAPDQDQDRDLQHERPFQKLVF 58

Query: 56  MVIDALRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFL 115
           +VIDALRSDFLF + +S F+ VH  +N GEAWGYT+++NPPTVTLPRLK ITTGS P+F+
Sbjct: 59  VVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFI 118

Query: 116 DAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFV 175
           D +LNVA+D  S++L + DSWL Q  +H   I F GDDTWLKLFP  +F  +D T+SFFV
Sbjct: 119 DLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFV 178

Query: 176 SDFEEVDRNVTRHLPYDL--SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVI 233
           SDF +VD NVTR+L   L   + +WD+ ILHYLGLDHIGHK G  S+FM  KH EMD+++
Sbjct: 179 SDFTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSIL 238

Query: 234 KDIYDAV-----DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQ 288
           K IYD V     D+ TL+CVLGDHGMN++GNHGGSSAGETSA ++F+S KL+ +  P +Q
Sbjct: 239 KTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQ 298

Query: 289 RGVQVPLINS-DGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEI 347
               +P+  + D D+QYL  +QQ+DIVPT+ +LF  PIP NSVGIII DFL LL      
Sbjct: 299 AENALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPN-KVA 357

Query: 348 KVKDNFRQLMKLANNTPEFAGASIDM--LLEQMKITQDDLATAATNYNYIFLIIGLSILC 405
            +K+NF  L +L+++  E     +D+  +  +M   Q+ L  +ATNYNY  L +  +   
Sbjct: 358 SMKENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFL 417

Query: 406 FITIIISCEFYR----TF-KQTKILSLTVAIXXXXXXXXXXXXXVEEEHQIWWWILTAAV 460
            ITII + +  R    TF K        + +             +EEEHQ+WWWI+TA  
Sbjct: 418 IITIIATYQLQRHSGPTFCKLRTSSLSVLLVSVILGVSTFASSFIEEEHQLWWWIVTAFA 477

Query: 461 GI---SWVMNPSLTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAA 517
            +   ++ +N S+    F++  C RLI+ WNNSGQK+IY N +  IL R P  KW +N+ 
Sbjct: 478 AVPLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSL 537

Query: 518 TMFLVAFETVEFNLMTFVSSFVTVTLCLAYKGCWTLVN--EGLVPNWLQAFVNMTCSFLI 575
           T  ++   +V   L+  + S + V LC  YK  W +VN  +  +P +LQ  +     F+ 
Sbjct: 538 TFLILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLT-KIDFIP 596

Query: 576 GPDNMLKEALVPLARLCFQSILASIVFRVCYNRFK--SSPKTLQSIIPLINTILVLQTSP 633
              N     L+ LAR+ FQ+    ++ R+   + K       ++ +   I  +L+LQTS 
Sbjct: 597 NESN-----LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSS 651

Query: 634 SNIPLFLLFTVMKIAINRILTNLSSNDLSQ---ISCILSLIMQNFTFFQFGGTNSIATIN 690
            NI LF++F +++  I     N  S+  +    +S ++SL++QNF+FFQFGGTNSI+TI+
Sbjct: 652 QNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTID 711

Query: 691 LTNSYNGVSQSYNIYVVGFLTFISNFAPVIYWSLNLIEVYQEP----NKKHTYLVERLPI 746
           L N+Y+G+S  YNI VVG L  I+NFAP IYWS+    +  EP    NK  T++  +LP 
Sbjct: 712 LGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPA 771

Query: 747 LFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSIL---INGLLEHL 795
             ++ + G  L+ +C+ LR+HLFIWSVFSPKLCY++ W+++   +NG L  L
Sbjct: 772 FTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPEL 823

>YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}
           LAS21Integral plasma membrane protein involved in the
           synthesis of the glycosylphosphatidylinositol (GPI) core
           structure; mutations affect cell wall integrity
          Length = 830

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/833 (43%), Positives = 516/833 (61%), Gaps = 48/833 (5%)

Query: 1   MLFRAISLLIC-QLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQ--FEKMVVMV 57
           M  +  + L C QL+AIL F   FFP+K VLTG S+    P++ + ++    F+K+V ++
Sbjct: 1   MNLKQFTCLSCAQLLAILLFIFAFFPRKIVLTGISK--QDPDQDRDLQRDRPFQKLVFVI 58

Query: 58  IDALRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDA 117
           IDALRSDFLF + +S F+ VH  +N GEAWGYT+++NPPTVTLPRLK ITTGS P+F+D 
Sbjct: 59  IDALRSDFLFDSQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 118

Query: 118 ILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSD 177
           +LNVA+D  S++L + DSWL Q  +H   I F GDDTWLKLFP  +F  +D T+SFFVSD
Sbjct: 119 LLNVAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSD 178

Query: 178 FEEVDRNVTRHLPYDL--SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKD 235
           F +VD NVTR+LP  L   + +WD+ ILHYLGLDHIGHK G  S+FM  KH EMD+++K 
Sbjct: 179 FTQVDNNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKS 238

Query: 236 IYDAV-----DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRG 290
           IYD V     D+ TL+CVLGDHGMN++GNHGGSSAGETSA ++F+S KLA +  PE+Q  
Sbjct: 239 IYDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVN 298

Query: 291 VQVPLINS-DGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKV 349
             +P+  S D ++QYL  +QQ+DIVPT+ +LF  PIP NSVGIII DFL LL       +
Sbjct: 299 YTLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPN-KLASM 357

Query: 350 KDNFRQLMKLANNTPEFA--GASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFI 407
           K+NF  L KL+++  E A    + + +  +M   Q+ L  +ATNYNY  L +       I
Sbjct: 358 KENFMHLWKLSDHHGEVALDDFTAEDIYTKMYTIQETLTKSATNYNYPLLTLAFVGFLII 417

Query: 408 TIIISCEFYR----TFKQTKILSLTVAIXXXXX-XXXXXXXXVEEEHQIWWWILTAAVGI 462
           TII      R     F Q ++ SL+V +              +EEEHQ+WWWI+TA   +
Sbjct: 418 TIIAIYVLLRYSGPDFWQLRVSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAFSAV 477

Query: 463 S---WVMNPSLTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATM 519
               + +N  +    F++  C R I+ WNNSGQK+IY N +  +L + P+ KW +N  T 
Sbjct: 478 PLFVYRLNVLIIVRWFIMMACVRSIKFWNNSGQKFIYSNVMSNLLNQNPSWKWCLNMLTF 537

Query: 520 FLVAFETVEFNLMTFVSSFVTVTLCLAYKGCWTLV--NEGLVPNWLQAFVNMTCSFLIGP 577
            ++   +  F ++ F+ + + V LC  YK  W +V  N+  +P ++    ++       P
Sbjct: 538 LVLIMASAGFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPLFMH---DLLAKIDFAP 594

Query: 578 DNMLKEALVPLARLCFQSILASIVFRVCYNRFKSSPKT--LQSIIPLINTILVLQTSPSN 635
               +  L+ LAR+ FQ+    ++ R+   + K   K   ++ +   I  +L+ QTS  N
Sbjct: 595 T---ESNLIVLARVFFQAWAIVVISRLVLTKLKVLNKNYLIKDMKVYITILLMFQTSSQN 651

Query: 636 IPLFLLFTVMKIAINRILTNLSSNDLSQISCI-----LSLIMQNFTFFQFGGTNSIATIN 690
           I  FL+F +++  I     N+ +  L+  S I     +SLI+QNFTFFQFGGTNSI+TI+
Sbjct: 652 IGQFLVFQILESQIFYFFQNIPTASLTSTSKIYFSNLVSLILQNFTFFQFGGTNSISTID 711

Query: 691 LTNSYNGVSQSYNIYVVGFLTFISNFAPVIYWSL-----NLIEVYQEPNKKHTYLVERLP 745
           L N+Y+GVS  YNIYVVG L  ++NFAP IYWS+     N   +  +  K  T++  +LP
Sbjct: 712 LGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYASIPAQV-KLQTFIRSKLP 770

Query: 746 ILFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSI---LINGLLEHL 795
              ++ + G  L+ +C+ LR+HLFIWSVFSPKLCY++ W+    L+NG L  L
Sbjct: 771 AFTYHCIFGTCLMTACVVLRFHLFIWSVFSPKLCYFLGWNFVMGLLNGWLPEL 823

>Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062W
           (REAL)
          Length = 831

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/832 (43%), Positives = 514/832 (61%), Gaps = 45/832 (5%)

Query: 1   MLFRAISLLIC-QLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVID 59
           M  + ++ + C QL+AI+ F   FFP+K VLTG S+     +        F+K+V ++ID
Sbjct: 1   MNLKQLTCITCAQLLAIVLFIFAFFPRKIVLTGISQQDADQDRDLQHNRPFQKLVFVIID 60

Query: 60  ALRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAIL 119
           ALRSDFLF +++S F+ VH+ +N GEAWGYT+++NPPTVTLPRLK ITTGS P+F+D +L
Sbjct: 61  ALRSDFLFDSHISHFNNVHEWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLL 120

Query: 120 NVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFE 179
           NVA+D  S++L + DSWL Q  +H   I F GDDTWLKLFP  +F  +D T+SFFVSDF 
Sbjct: 121 NVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQEWFDFTDPTHSFFVSDFT 180

Query: 180 EVDRNVTRHLPYDL--SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIY 237
           +VD NVTR+LP  +   + +WD+ ILHYLGLDHIGHK G  S+FM  KH EMD+++K IY
Sbjct: 181 QVDNNVTRNLPGKIFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMGTKHQEMDSILKSIY 240

Query: 238 DAV-----DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQ 292
           D V     +E TL+CVLGDHGMN++GNHGGSSAGETSA ++F+S KL+ +  PE+Q    
Sbjct: 241 DQVLVHEHEEDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSKFVKPESQINRT 300

Query: 293 VPLINS--DGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVK 350
           +P IN+  D D+QYL  +QQ+DIVPT+ +LF  PIP NSVGIII DFL LL       +K
Sbjct: 301 LP-INAAPDRDFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPN-KLASIK 358

Query: 351 DNFRQLMKLANNTPEFA--GASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFIT 408
           +NF  L KL+++  +F     +ID +  +M   Q+ L  +ATNYNY  L +       IT
Sbjct: 359 ENFMHLWKLSDHNGDFTLDDLTIDGIYTKMYSIQETLTKSATNYNYPLLALAFISFLIIT 418

Query: 409 IIISCEFYR----TFKQTKILSLTV-AIXXXXXXXXXXXXXVEEEHQIWWWILTAAVGIS 463
           II   +  R    +  Q +   L+V  I             +EEEHQ+WWWI+TA   + 
Sbjct: 419 IIAIYQLQRNSGSSLWQPRTSPLSVLLISVILGISTFASSFIEEEHQLWWWIVTAFSVVP 478

Query: 464 ---WVMNPSLTWDHFLVSVCARLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMF 520
              + +N  +    F++ VC RLI+ WNNSGQK+IY N +  +L + P  KW +N  T+ 
Sbjct: 479 LFVYNLNVFVVARWFIMMVCVRLIKFWNNSGQKFIYSNVMSNLLNQNPIWKWWLNLFTLL 538

Query: 521 LVAFETVEFNLMTFVSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIGPDNM 580
            +   +  F ++ F+ + + V LC  YK  W +VN        QA + +    L+   + 
Sbjct: 539 ALIIASSRFQVLHFIVTTILVGLCFTYKISWEIVNGN------QAEIPIFMHDLLAKIDF 592

Query: 581 L--KEALVPLARLCFQSILASIVFRVCYNRFKSSPKT--LQSIIPLINTILVLQTSPSNI 636
           +  +  L+ LAR+ FQ+    +V R+   + K   K   ++ I   I  +L+LQTS  NI
Sbjct: 593 VPTESNLILLARVFFQAWAIVVVSRLVLTKLKVLNKNYLIEDIKVYITILLILQTSSQNI 652

Query: 637 PLFLLFTVMKIAINRILTN------LSSNDLSQISCILSLIMQNFTFFQFGGTNSIATIN 690
             F++F +++  I     +      L+ +    +S ++SLI+QNFTFFQFGGTNSI+TI+
Sbjct: 653 GQFIIFQILQSQIYYFFKSLPAPFLLTPSSKVYLSNLVSLILQNFTFFQFGGTNSISTID 712

Query: 691 LTNSYNGVSQSYNIYVVGFLTFISNFAPVIYWSLNLIEVYQEPN----KKHTYLVERLPI 746
           L N+Y+GVS  YN+  VG L  I+NFAP IYWS+    +  +      K  T++  +LP 
Sbjct: 713 LGNAYHGVSSDYNMCTVGMLMSIANFAPSIYWSMLPWSMNYDSTSSQVKIQTFIRSKLPA 772

Query: 747 LFHYSVTGVFLLISCLALRYHLFIWSVFSPKLCYYIAWSIL---INGLLEHL 795
             ++ + G  L+ +C+ LR+HLFIWSVFSPKLCY++ W+ +   +NG +  L
Sbjct: 773 FTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNFVMGFLNGWITEL 824

>ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar to
           uniprot|Q07830 Saccharomyces cerevisiae YLL031C
          Length = 1009

 Score =  189 bits (479), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 123/342 (35%), Positives = 180/342 (52%), Gaps = 33/342 (9%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           SL   Q +AI  F  GF   + VL   S     P ++     +F+K VV+VIDALR DF+
Sbjct: 41  SLAALQFIAIAFFTRGFLLTRQVLDNVSS--PFPNQYG----KFDKAVVLVIDALRFDFV 94

Query: 67  F-------QANVSGFHFVHDLIN----KGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFL 115
                   Q N +  + +  L N    KG +  +   ++PPT TL RLKG+TTGS+P F+
Sbjct: 95  IPVDESHPQHNPNYHNNIKALWNDESLKGSSLLFKFIADPPTTTLQRLKGLTTGSLPTFI 154

Query: 116 DAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFV 175
           DA  N        ++ ++D+ + QL+   K ++F GDDTW  LF      +S+   S  V
Sbjct: 155 DAGSNF-----DGSVIEEDNLIKQLYLAQKNVYFAGDDTWSALFHPFLSAQSEPYPSLNV 209

Query: 176 SDFEEVDRNVTRHLPYDL------SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEM 229
            D + VD  V  +    L       +++WD+L+ H LG+DH+GHK G     M  K +++
Sbjct: 210 WDLDTVDNGVMSYFERHLLEGGQTRHRDWDVLVGHMLGVDHVGHKYGPNHFTMREKQLQV 269

Query: 230 DAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQR 289
           D  I+ I  A+D+ TL+ V+GDHGM+  GNHGG S  E  + +   SK+   ++  E   
Sbjct: 270 DEFIRKIIAAIDKDTLLIVMGDHGMDHTGNHGGDSIDELESTLFLYSKRPDMWQPNEDPN 329

Query: 290 GVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
              V    SD    Y  ++ Q+D+VPTL  L N PIP NS+G
Sbjct: 330 VYDV----SDLGKNY-KQVNQIDLVPTLSLLLNLPIPFNSLG 366

>NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON}
           Anc_4.28
          Length = 1034

 Score =  189 bits (479), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 122/362 (33%), Positives = 191/362 (52%), Gaps = 40/362 (11%)

Query: 6   ISLLICQLVAILTFAIGFFPQKSVLTGDS---EFLYMPEEH----KPME-PQFEKMVVMV 57
           ISL I Q +AI  F  GF   ++VL   S   ++  + E +     P +  +F+K V++V
Sbjct: 40  ISLAILQFIAIAFFIKGFLLTRNVLENVSTLNDYTSILESNPIFNNPSDIAKFDKTVIVV 99

Query: 58  IDALRSDFLFQANVSG----------FHFVHDLINKGEAWGYTAY----SNPPTVTLPRL 103
           IDALR DF+   + S           F  ++D  N+  +   +      ++PPT TL RL
Sbjct: 100 IDALRFDFVIPVDESNPNYNPNYHNNFKVMYDHFNETSSADSSLLLKFIADPPTTTLQRL 159

Query: 104 KGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHF 163
           KG+TTGS+P F+DA  N        ++ ++D+ + Q++ + K ++F GDDTW  LF    
Sbjct: 160 KGLTTGSLPTFIDAGSNF-----DGSVIEEDNLIKQMYLNNKTVYFVGDDTWDSLFHPFL 214

Query: 164 FQRSDGTNSFFVSDFEEVDRNVTRHLPYDL--------SYQEWDILILHYLGLDHIGHKG 215
             +S    S  V D + VD  V  +   +L          +EWD+LI H LG+DH+GHK 
Sbjct: 215 SSKSQPFESLNVWDLDTVDNGVISYFEKELISKKNNQKEEKEWDVLIGHMLGMDHVGHKY 274

Query: 216 GSASQFMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFI 275
           G +   M  K ++++  +  + D++DE TL+ V+GDHGM+  GNHGG S  E  + +   
Sbjct: 275 GPSHFSMKDKQLQLNEFVTKVIDSLDEDTLLVVMGDHGMDHTGNHGGDSQDELESTLFLF 334

Query: 276 SKKLANYK-APEAQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIII 334
           SKK   +   P+ Q      L N +   ++  ++ Q+D+VPTL  L   PIP N++G  I
Sbjct: 335 SKKQQMWNLDPDNQE----TLYNVNKLGKHYRQVNQIDLVPTLSLLTGLPIPFNNLGWPI 390

Query: 335 KD 336
           K+
Sbjct: 391 KE 392

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score =  188 bits (478), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 118/338 (34%), Positives = 176/338 (52%), Gaps = 28/338 (8%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           SL + Q +AI  F  GF   ++VL   + F    +E K    +F+K V++++DALR DF+
Sbjct: 49  SLAVLQAIAIAFFTRGFLLSRTVLDNVASF----DETKDSYGKFDKAVILIVDALRFDFV 104

Query: 67  FQANVSGFHFVHDLINK----GEAWGYTAY----SNPPTVTLPRLKGITTGSMPNFLDAI 118
              + +   +  +  N      E W  +      ++PPT TL RLKG+TTGS+P F+DA 
Sbjct: 105 IPVDTAAEGYNDNYHNNLKVLYEYWDNSVLLKFIADPPTTTLQRLKGLTTGSLPTFIDAG 164

Query: 119 LNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDF 178
            N   D     +  +D+ + QL+ H K I+F GDDTW  LF  +    S    S  V D 
Sbjct: 165 SNFNGD-----VIVEDNLIKQLYLHNKSIYFVGDDTWDALFHPYLSNMSVPYESLNVWDL 219

Query: 179 EEVDRNVTRH-----LPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVI 233
           + VD  V  +     L  D   +EWD+LI H LG+DH+GHK G     M  K  ++D  I
Sbjct: 220 DTVDNGVISYFEEHLLDKDPLDREWDVLIGHMLGIDHVGHKYGPNHFTMSEKQQQVDKFI 279

Query: 234 KDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQV 293
           + +  ++DE TL+ V+GDHGM+  GNHGG S  E  + +   SK+   +K     +    
Sbjct: 280 RKVIASIDEDTLLVVMGDHGMDHTGNHGGDSNDELESTLWLHSKRKNAWKLKSPDQ---- 335

Query: 294 PLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
              N+    +   ++ Q+D+VPTL  L   PIP N++G
Sbjct: 336 --YNTSRLGENYRQVNQIDLVPTLSLLLGTPIPFNNLG 371

>KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C,
          Length = 1005

 Score =  187 bits (474), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/340 (34%), Positives = 177/340 (52%), Gaps = 32/340 (9%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           SL + Q ++I  FA GF   ++VL   +E     +   P E +++KMV++++DALR DF+
Sbjct: 49  SLAVLQFISIAFFAKGFLLTRTVLDNVAEL----DPQLPFEAKYDKMVLLIVDALRFDFV 104

Query: 67  FQANVSGFHFVHDLINKGEAWGYTAY-----------SNPPTVTLPRLKGITTGSMPNFL 115
              + +   +  +  N  +    TA+           ++PPT TL RLKG+TTGS+P F+
Sbjct: 105 IPVDENHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFI 164

Query: 116 DAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFV 175
           DA  N   D     + D+D+ + QL+ H K+I F GDDTW  LF  +    S    S  V
Sbjct: 165 DAGSNFNGD-----VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNV 219

Query: 176 SDFEEVDRNVTRHLPY----DLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDA 231
            D + VD  V  +L      +    E+DILI H LG+DH+GHK G     M  K +++D 
Sbjct: 220 WDLDTVDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDE 279

Query: 232 VIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGV 291
           +++ I    D+ TL  V+GDHGM+  GNHGG S  E  + +   +K  AN+         
Sbjct: 280 LLRKIISTADDNTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKN-ANWSKDYDSYN- 337

Query: 292 QVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
                 +D    Y  ++ Q+D+VPTL  L   PIP N++G
Sbjct: 338 -----TTDLGTSY-KQMNQIDLVPTLSLLLGIPIPFNNLG 371

>TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4.28
           YLL031C
          Length = 1005

 Score =  186 bits (471), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 117/345 (33%), Positives = 181/345 (52%), Gaps = 33/345 (9%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           SL + Q +AI  F  GF   + VL  D   +   E  K     F+K VV+++DALR DF+
Sbjct: 41  SLALLQFIAIAFFTRGFLLTRQVL--DDVAIKTAEYGK-----FDKAVVLIVDALRFDFV 93

Query: 67  F------QANVSGFHFVHDLI------NKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNF 114
                  Q     FH   D++      ++G +      ++ PTVTL RLKG+TTGS+P F
Sbjct: 94  IPVDQDHQGYSGNFHNNIDVLYESMFADQGSSLLLKFIADAPTVTLQRLKGLTTGSLPTF 153

Query: 115 LDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFF 174
           +DA  N        ++ ++D+ + Q+++ GK+I+F GDDTW  LF      RS    SF 
Sbjct: 154 IDAGSNF-----DGSVIEEDNLIKQMYEQGKQIYFAGDDTWESLFSPFLSPRSKYYESFN 208

Query: 175 VSDFEEVDRNVTRHLPYDL---SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDA 231
           V D + VD  V  +    L   + ++WD+LI H LG+DH+GHK G     M  K ++++ 
Sbjct: 209 VWDLDTVDNGVISYFNEHLLETANRDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVND 268

Query: 232 VIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGV 291
            +  I + +D+ TL+ ++GDHGM+  GNHGG S  E  + +   SK+   +   +  +  
Sbjct: 269 FLIKIKETIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKRPNMWGLNDPSQ-- 326

Query: 292 QVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKD 336
                N+     Y   + Q+D+VPTL  L   PIP N++G  I++
Sbjct: 327 ----YNTTDLGAYYREVNQIDLVPTLSILMGLPIPFNNLGWPIEE 367

>YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}
           GPI13ER membrane localized phosphoryltransferase that
           adds phosphoethanolamine onto the third mannose residue
           of the glycosylphosphatidylinositol (GPI) anchor
           precursor; similar to human PIG-O protein
          Length = 1017

 Score =  184 bits (466), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 172/339 (50%), Gaps = 35/339 (10%)

Query: 10  ICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQA 69
           I Q ++I  F  GF   + VL   S       E   + P+F K V++VIDALR DF    
Sbjct: 44  ILQFISIAFFTRGFLLSRHVLDNISS----QNETSKLPPRFNKAVILVIDALRFDFAIPV 99

Query: 70  NVS----GFHFVHDLINKGEAWGYTA---------YSNPPTVTLPRLKGITTGSMPNFLD 116
           N S      ++ +++++  +++              ++PPT TL RLKG+TTGS+P F+D
Sbjct: 100 NESHSNYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFID 159

Query: 117 AILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVS 176
           A  N         + ++D++L QLH   K + F GDDTW+ LF       S    S  V 
Sbjct: 160 AGSNF-----DGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVW 214

Query: 177 DFEEVDRNVTR----HLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAV 232
           D + VD  V      HL  D   +EWD++I H LG+DH+GHK G     M  K I++D  
Sbjct: 215 DLDTVDNGVMDYFHDHLQQD---KEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQF 271

Query: 233 IKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQ 292
           I  I  ++D+ TL+ +LGDHGM+  GNHGG S  E  + +   SKK      P+  R  +
Sbjct: 272 IDWILKSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKK------PDMWRLKE 325

Query: 293 VPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
               N D        ++Q+D+V +L  L   PIP N++G
Sbjct: 326 TSNYNIDNLGHDYRSVRQIDLVSSLALLMGQPIPFNNLG 364

>CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highly
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031c GPI13
          Length = 1019

 Score =  182 bits (463), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 120/357 (33%), Positives = 179/357 (50%), Gaps = 53/357 (14%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           +L   Q VAI  FA GF   ++VL   S      +    ++ +F+KMV++V+DALR DF+
Sbjct: 41  ALAFLQFVAIAFFAKGFLLSRTVLDNVST---TSDNPLAVDKKFDKMVLLVVDALRFDFV 97

Query: 67  FQANVSGFHFVHDLINKGE----AW------GYTAYSN------------PPTVTLPRLK 104
              + S  ++  +  N  +     W      G   YSN            PPT TL RLK
Sbjct: 98  VPVSTSHPNYNENFHNNLDVLYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLK 157

Query: 105 GITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFF 164
           G+TTGS+P F+DA  N        ++ ++D+ + QL    K + F GDDTW  LF     
Sbjct: 158 GLTTGSLPTFIDAGSNF-----DGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLA 212

Query: 165 QRSDGTNSFFVSDFEEVDRNV----TRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQ 220
             S+   S  V D + VD  V      HL    + + WDIL+ H LG+DH+GHK G    
Sbjct: 213 NNSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHF 272

Query: 221 FMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLA 280
            M  K  +++  I++I +++D  TL+ V+GDHGM+  GNHGG S  E  + + F +K+  
Sbjct: 273 TMREKQNQVNRFIQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQN 332

Query: 281 NYKAPEAQRGVQVPLINSDGDY------QYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
            +K             N +G+Y      Q    + Q+D+VPTL  L + P+P N++G
Sbjct: 333 TWK-------------NQNGNYDIENLAQNYHSVNQIDLVPTLSLLLDIPVPFNNLG 376

>KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa]
           {ON} similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1016

 Score =  181 bits (460), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 180/350 (51%), Gaps = 38/350 (10%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           SL + Q++AI  FA GF   ++VL    E +    +H   E +F K V++VIDALR DF 
Sbjct: 47  SLAVLQIIAIAFFARGFLLTRTVL----ENVATGADH---EARFSKCVILVIDALRFDFS 99

Query: 67  FQANV------SGFH----FVHDLINKGEAWGYTAY-----SNPPTVTLPRLKGITTGSM 111
              +       S FH     +H   N   +  +++      ++PPT TL RLKG+TTGS+
Sbjct: 100 IPVDPADNAFNSYFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSL 159

Query: 112 PNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTN 171
           P F+DA  N      +  + ++D+ + Q+  + + + F GDDTW  LF       S    
Sbjct: 160 PTFIDAGSNF-----NGAVIEEDNLIKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFE 214

Query: 172 SFFVSDFEEVDRNVTRHLPYDL-----SYQEWDILILHYLGLDHIGHKGGSASQFMFPKH 226
           S  V D + VD  V R    +L       +EWD+LI H LG+DH+GHK G     M  K 
Sbjct: 215 SLNVWDLDTVDNGVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQ 274

Query: 227 IEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPE 286
           ++ +  IK I +++D+ TL+ V+GDHGM+  GNHGG S  E  AA+   SK+      P 
Sbjct: 275 LQANEFIKRICESIDDDTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSKR------PN 328

Query: 287 AQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKD 336
               +     +     +   ++ Q+D+VPTL  L   PIP N++G  I++
Sbjct: 329 MWSHLPEQFYDISALGENYRQVNQIDLVPTLSLLLGLPIPFNNLGWPIQE 378

>Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON}
           complement(442..3471) [3030 nt, 1010 aa]
          Length = 1009

 Score =  181 bits (458), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 140/445 (31%), Positives = 224/445 (50%), Gaps = 52/445 (11%)

Query: 8   LLICQLVAILTF-AIGFFPQKSVLTGDSEFLYM---PEE-HKPMEPQFEKMVVMVIDALR 62
           +L   L+AIL F +I FF +  +LT +         P + ++    +F+K V+++IDALR
Sbjct: 26  VLFLSLIAILQFISIAFFCKGFLLTRNVLDNVNNLNPSDLNQDYTKKFDKAVILIIDALR 85

Query: 63  SDFLFQANVS------GFH---------FVHDLINKGEAWGYTAY-SNPPTVTLPRLKGI 106
            DF+   N +       +H         F+    NK  +     + ++PPT TL RLKG+
Sbjct: 86  FDFVIPVNSTDPLHNQNYHNNIITLYDQFISQNNNKDHSSILLKFIADPPTTTLQRLKGL 145

Query: 107 TTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQR 166
           TTGS+P F+DA  N        ++ ++D+ + QL+   + I+F GDDTW  LF       
Sbjct: 146 TTGSLPTFIDAGTNF-----DGSVIEEDNLIKQLYLKNEEIYFVGDDTWDSLFNPFLSNH 200

Query: 167 SDGTNSFFVSDFEEVDRNVTRHLPYDLSYQE-----WDILILHYLGLDHIGHKGGSASQF 221
           S    S  V D + VD  V  +    L  Q+     WDILI H LG+DH+GHK G     
Sbjct: 201 SKPFESLNVWDLDTVDNGVISYFNDHLINQKTNDKKWDILIGHMLGVDHVGHKYGPNHFT 260

Query: 222 MFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLAN 281
           M  K ++++  I DI +++D+ TL+ ++GDHGM+  GNHGG S  E  + +   SKK   
Sbjct: 261 MREKQLQVNNFINDIIESIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFMYSKKTDV 320

Query: 282 YKAPEAQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLP-- 339
           ++  +        + NS  +Y+    + Q+D+VPTL  L + PIP N++G  I +     
Sbjct: 321 WELGDPN---NYNIENSGDNYR---SVNQIDLVPTLSLLLDVPIPFNNLGWPINEISKNQ 374

Query: 340 -LLGTFAEIKVKD--NFRQLMKL-ANNTPEF---AGASIDMLLEQMKIT--QDDLATAAT 390
                F ++ +K   N++++  L  NNT ++        D L++  K T  Q+DL     
Sbjct: 375 NERNIFEQLTLKQLKNYQEVSGLVVNNTEKYFHLEQLYQDSLIDSSKATIFQNDLLELCK 434

Query: 391 N----YNYIFLIIGLSILCFITIII 411
           +    ++YI +  G+  L F  II+
Sbjct: 435 DLWARFDYISITTGIIFLTFSLIIL 459

>Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  180 bits (456), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 174/345 (50%), Gaps = 47/345 (13%)

Query: 10  ICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQA 69
           I Q ++I  F  GF   + VL   S       E   + P+F K VV+VIDALR DF+   
Sbjct: 44  ILQFISIAFFTRGFLLSRHVLDNIST----QNETTTLHPRFNKTVVLVIDALRFDFVIPV 99

Query: 70  NVSGFHFVHDLINKGEAWG-YTAYSN--------------PPTVTLPRLKGITTGSMPNF 114
           + SG +  H+L         Y +++N              PPT TL RLKG+TTGS+P F
Sbjct: 100 DESGSN--HNLNYHNNILSLYDSFANDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTF 157

Query: 115 LDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFF 174
           +DA  N         + ++D+ L QLH   K + F GDDTW+ LF       S    S  
Sbjct: 158 IDAGSNF-----DGTVIEEDNLLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLN 212

Query: 175 VSDFEEVDRNVTR----HLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMD 230
           V D + VD+ V      HL  D   QEWD++I H LG+DH+GHK G     M  K +++D
Sbjct: 213 VWDLDSVDKGVMDYFHDHLQQD---QEWDVMIGHMLGIDHVGHKYGPDHFTMREKQVQVD 269

Query: 231 AVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRG 290
             I  I  ++DE TL+ +LGDHGM+  GNHGG S  E  + +   SKK   +K  ++   
Sbjct: 270 EFINWILKSIDENTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNLWKLKDS--- 326

Query: 291 VQVPLINSDGDYQYLTR----IQQVDIVPTLVSLFNFPIPQNSVG 331
                  S+ D   L R    ++Q+D+V +L  L   PIP N++G
Sbjct: 327 -------SNYDISALGRDYRSVRQIDLVSSLSLLLGQPIPFNNLG 364

>TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1026

 Score =  180 bits (456), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 116/356 (32%), Positives = 176/356 (49%), Gaps = 41/356 (11%)

Query: 12  QLVAILTFAIGFFPQKSVLTGDSEF---LYMPEEHKP---MEPQFEKMVVMVIDALRSDF 65
           Q +AI  F  GF   ++VL   +E    +Y           + +FEK V++VIDALR DF
Sbjct: 37  QFIAIAFFTKGFLLSRNVLDDINELKPSMYAANSSNNGFVHQQKFEKTVILVIDALRFDF 96

Query: 66  LFQANVSGFHFVHDLINK---------GEAWGYTA--------YSNPPTVTLPRLKGITT 108
           +   N +   +  +  NK          E+ G            ++PPT TL RLKG+TT
Sbjct: 97  VIPVNTNNSAYNSNHHNKITTLYDQFCKESVGKKQNNSLLLKFLADPPTTTLQRLKGLTT 156

Query: 109 GSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSD 168
           GS+P F+DA  N         + ++D+ + Q++ + K + F GDDTW  LF       S 
Sbjct: 157 GSLPTFIDAGSNF-----DGTVIEEDNLIKQMYLNNKEVFFVGDDTWDALFSPFLSNHSI 211

Query: 169 GTNSFFVSDFEEVDR--------NVTRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQ 220
              S  V D + VD         N+ R   Y     +W++LI H LG+DH+GHK G    
Sbjct: 212 PYESLNVWDLDTVDNGVISYFNDNLIRSEEYKKKNSQWNVLIGHMLGVDHVGHKYGPNHF 271

Query: 221 FMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLA 280
            M  K ++++  I DI + +D+ TL+ ++GDHGM+  GNHGG S  E  + +   SK+  
Sbjct: 272 TMKEKQLQVNNFINDIINVIDDDTLLVIMGDHGMDHTGNHGGDSIDELESTLFLYSKRQN 331

Query: 281 NYKAPEAQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKD 336
            +K  +      +  + S+        I Q+D+VPTL  L + PIP N++G  IK+
Sbjct: 332 VWKLEDDHSVYNIDDLGSN-----YKSINQIDLVPTLALLLDIPIPFNNLGWPIKE 382

>TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4.28
           YLL031C
          Length = 1028

 Score =  180 bits (456), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 119/362 (32%), Positives = 188/362 (51%), Gaps = 51/362 (14%)

Query: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60
           +L  +I+LL  Q+++I  F  GF   +S +   ++  Y PE  +    +F+K VV+++DA
Sbjct: 44  ILLSSIALL--QVISIAFFTKGFSFCRSPIRHTAQ--YSPEYSEV--KKFDKAVVLLVDA 97

Query: 61  LRSDFLFQANV------SGFH----FVHDLIN----------------KGEAWGYTAYSN 94
           LR DF+   N         +H     + +L+N                K  +  +   + 
Sbjct: 98  LRFDFVVPINELDPIYNENYHNNIDIISELLNQNDNSTKNESKKDRVQKSSSLLFKFLAE 157

Query: 95  PPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDT 154
           PPT T  RLKGITTG +P+FLD I+ + +      + + DS + QL    K I+F GDDT
Sbjct: 158 PPTTTFHRLKGITTGLLPSFLDGIMKLND-----RVVEDDSIIKQLFLRNKTIYFSGDDT 212

Query: 155 WLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTR----HL-PYDLSYQEWDILILHYLGLD 209
           W ++F  +   +S    S+ + D   VD  V +    HL   + S +EWDILI H +G+D
Sbjct: 213 WSRMFEPYLSPKSVPLESYNIWDLNTVDDGVFKFFNEHLTSKNTSNREWDILIGHIVGID 272

Query: 210 HIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETS 269
           H   K G     +  K I+++  IK I  ++D++TL+ V+GDHGM+  GNHGG S+GE  
Sbjct: 273 HAATKYGPNHITVKQKQIQINEFIKQIVKSLDDQTLLIVMGDHGMDITGNHGGKSSGELE 332

Query: 270 AAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNS 329
           +++   SKK + +K   +           + +  +  +I Q+DIVPT   LF  PIP N+
Sbjct: 333 SSLFLYSKKSSVWKQEHSLH---------ENNNDFYKKINQIDIVPTFSLLFGIPIPYNN 383

Query: 330 VG 331
           +G
Sbjct: 384 LG 385

>AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL031C
           (GPI13)
          Length = 1013

 Score =  179 bits (454), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 133/411 (32%), Positives = 206/411 (50%), Gaps = 36/411 (8%)

Query: 2   LFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDAL 61
           L+ A++ L  Q +AI  F  GF   + VL   +       +      +F+++V++V+DAL
Sbjct: 46  LYSALAAL--QFIAIAFFTRGFLLSRKVLDDVAN-----RDESTAPAKFDRLVLLVVDAL 98

Query: 62  RSDFLFQANVS--GF--HFVHDLINKGEAWGYTAY----SNPPTVTLPRLKGITTGSMPN 113
           R DF+   +V+  G+  H+ + L    E W  +      ++PPT TL RLKG+TTGS+P 
Sbjct: 99  RFDFVIPVDVAAEGYNSHYHNHLRALYERWDESILLKFLADPPTTTLQRLKGLTTGSLPT 158

Query: 114 FLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSF 173
           F+DA  N      +  + D+   + Q+    K I+F GDDTW  LF  +    S    S 
Sbjct: 159 FIDAGSNF-----NGIVIDEGYIIKQMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESL 213

Query: 174 FVSDFEEVDRNVTRHLPYDL-----SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIE 228
            V D + VD  V       L       +EWD+L+ H LG+DH+GHK G +   M  K  +
Sbjct: 214 NVWDLDTVDNGVISFFEDHLLNNPTEKKEWDVLVGHMLGIDHVGHKYGPSHFSMAEKQSQ 273

Query: 229 MDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYK--APE 286
           +D  I+ I DAVDE TL+ V+GDHGM+  GNHGG S  E  + +   +K+   ++  AP 
Sbjct: 274 VDGFIRQIIDAVDEDTLLVVMGDHGMDHTGNHGGDSPAELESTLWLYTKRPGTWRRQAPA 333

Query: 287 AQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAE 346
           A    ++         +Y   + Q+D+VP+L  L   PIP N++G  I++ L        
Sbjct: 334 AYNTTELG--------RYYRAVNQIDLVPSLSLLLGLPIPFNNLGWPIEE-LAHDDDEWR 384

Query: 347 IKVKDNFRQLMKLANNTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFL 397
           +  +    QL    N +     +S   +LE++KI  +  ++ A NY  I L
Sbjct: 385 LFTRQTLMQLETYRNTSNSITDSSKLKILEELKINANSNSSDAGNYQAILL 435

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score =  177 bits (448), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 140/454 (30%), Positives = 216/454 (47%), Gaps = 60/454 (13%)

Query: 1   MLFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDA 60
           +LF +I+LL  Q +AI  F  GF   + VL   +     P +   ++ +F+K V++++DA
Sbjct: 37  ILFGSIALL--QFIAIAFFTKGFLLSRQVLDNIT-----PLDSNVIDAKFDKAVILIVDA 89

Query: 61  LRSDFLFQANVS-----GFH----FVHDLINKGEAWGYTAY----SNPPTVTLPRLKGIT 107
           LR DF+   + +      +H     ++D    G + G +      ++PPT TL RLKG+T
Sbjct: 90  LRFDFVIPVDSTEHLNNNYHNNIDILYDTFKNGNSHGSSILLKFLADPPTTTLQRLKGLT 149

Query: 108 TGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKH-GKRIHFYGDDTWLKLFPSHFFQR 166
           TGS+P F+DA  N      + N+  +D+ + QL ++  + I F GDDTW  LF       
Sbjct: 150 TGSLPTFIDAGSNF-----NGNVIFEDNLIRQLSENLNREILFVGDDTWDALFHPFLSNN 204

Query: 167 SDGTNSFFVSDFEEVDRNVTRHLPYDLSY-QEWDILILHYLGLDHIGHKGGSASQFMFPK 225
           S    S  V D + VD  V      +L    +WD+LI H LG+DH+GHK G     M  K
Sbjct: 205 SLPYESLNVWDLDTVDNGVIDFFDENLKKNDDWDVLIGHMLGVDHVGHKYGPNHFTMREK 264

Query: 226 HIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAP 285
            ++++  IK I D++D  TL+ V+GDHGM+  GNHGG S  E  + +   +KK   ++  
Sbjct: 265 QLQVNTFIKKIIDSIDNNTLLVVMGDHGMDHTGNHGGDSIDELESTLFLYTKKKNIFRKH 324

Query: 286 EAQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIII----------- 334
           +       P   +D    Y   + Q+D+V TL  L   PIP N++G  I           
Sbjct: 325 DD----FTPYNITDLGKNY-RAVNQIDLVSTLSYLLGIPIPFNNLGWPIEEIFHSKNDKI 379

Query: 335 ---KDFLPLLGTFAEI--------KVKDNFRQLMK------LANNTPEFAGASIDMLLEQ 377
              K  L  L T+ EI        +  +N R + +      +A  + E       +LLE+
Sbjct: 380 KMTKRVLDQLRTYQEIMGISFQDPESNENGRSMNESFFNDIIATGSYELGQKYQSILLEK 439

Query: 378 MKITQDDLATAATNYNYIFLIIGLSILCFITIII 411
            K         +     I L I ++IL  IT +I
Sbjct: 440 CKDLWARFDYYSIATGLILLTISVTILILITKLI 473

>Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)
           [2871 bp, 956 aa] {ON} ANNOTATED BY YGOB -
          Length = 956

 Score =  176 bits (447), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 118/348 (33%), Positives = 171/348 (49%), Gaps = 37/348 (10%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDF- 65
           S+ + Q++AI  FA GF   ++VL   +        H   EP+F+K V++VIDALR DF 
Sbjct: 51  SIAVLQIIAIAFFARGFLLTRTVLENVAT-------HADYEPKFDKCVILVIDALRFDFS 103

Query: 66  ------------LFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPN 113
                        +  N+  FH      N          S+PPT TL RLKG+TTGS+P 
Sbjct: 104 IPIDPQENGYNPYYHNNLDVFHSGFRDQNHSSLL-LKFISDPPTTTLQRLKGLTTGSLPT 162

Query: 114 FLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSF 173
           F+DA  N      +  + ++D+ + Q++ + K I F GDDTW  LF +     S    S 
Sbjct: 163 FIDAGSNF-----NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESL 217

Query: 174 FVSDFEEVDRNVTRHLPYDL-----SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIE 228
            V D + VD  V  +    L         WD+LI H LG+DH+GHK G     M  K ++
Sbjct: 218 NVWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQ 277

Query: 229 MDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQ 288
            +  IK I + +D+ TL+ V+GDHGM+  GNHGG S  E  A +   S K      P+  
Sbjct: 278 ANEFIKRICEKLDDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTK------PDMW 331

Query: 289 RGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKD 336
             +     N+    +    + Q+D+V TL  L   PIP N++G  I++
Sbjct: 332 NHLPQDAYNTSVLGENHREVNQIDLVSTLSLLLGLPIPFNNLGWPIQE 379

>SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1013

 Score =  177 bits (448), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 182/355 (51%), Gaps = 50/355 (14%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVL----TGDSEFLYMPEEHKPMEPQFEKMVVMVIDALR 62
           SL + Q +AI  F  GF   + VL    T  SE+             F+K VV+V+DALR
Sbjct: 46  SLALLQFIAIAFFTRGFLLTRHVLDNVATKKSEY-----------GTFDKAVVLVVDALR 94

Query: 63  SDFLFQANVSGFHFVHDLINKGEAWGYTAY--------------SNPPTVTLPRLKGITT 108
            DF+   + +  ++  +  N  E   Y  +              ++PPT TL RLKG+TT
Sbjct: 95  FDFVIPVSETQDYYNENYHNNLEVL-YEKFKDVSESSSLLLKFIADPPTTTLQRLKGLTT 153

Query: 109 GSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSD 168
           GS+P F+DA  N      +  + ++D+ + Q+  + K + F GDDTW  LF     ++S 
Sbjct: 154 GSLPTFIDAGSNF-----NGEVIEEDNLIKQMFLNDKTVFFAGDDTWNALFSPFLAEQSR 208

Query: 169 GTNSFFVSDFEEVDRNVTRHLPYDL-----SYQEWDILILHYLGLDHIGHKGGSASQFMF 223
              S  V D + VD  V       L     + +EWD+LI H LG+DH+GHK G     M 
Sbjct: 209 PYESLNVWDLDTVDNGVISFFKEHLFEKTPAQREWDVLIGHMLGIDHVGHKYGPNHFTMR 268

Query: 224 PKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKK--LAN 281
            K +++D  I+ I +++DE TL+ +LGDHGM+  GNHGG S  E  + +   SKK  + +
Sbjct: 269 EKQLQVDNFIRQIMESIDEDTLLVILGDHGMDHTGNHGGDSRDELESTLWLHSKKHGMWD 328

Query: 282 YKAPEAQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKD 336
           + + E     ++       +Y+   ++ Q+D+VPTL  L   PIP N++G  I++
Sbjct: 329 HYSDETYDTSEL-----GKNYR---QVNQIDLVPTLSLLLGLPIPFNNLGWPIRE 375

>Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa]
           {OFF} YLL031C (GPI13) - phosphoryltransferase that adds
           phosphoethanolamine to the third mannose residue of the
           GPI anchor precursor [contig 141] PARTIAL
          Length = 602

 Score =  173 bits (438), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 176/347 (50%), Gaps = 35/347 (10%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFL 66
           S+ + Q++AI  FA GF   ++VL   +        H   EP+F+K V++VIDALR DF 
Sbjct: 51  SIAVLQIIAIAFFARGFLLTRTVLENVAT-------HADYEPKFDKCVILVIDALRFDFS 103

Query: 67  F----QANVSG--FHFVHDLINKG-EAWGYTAY-----SNPPTVTLPRLKGITTGSMPNF 114
                Q N     +H   D+ + G     +++      S+PPT TL RLKG+TTGS+P F
Sbjct: 104 IPIDPQENGYNPYYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTF 163

Query: 115 LDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFF 174
           +DA  N      +  + ++D+ + Q++ + K I F GDDTW  LF +     S    S  
Sbjct: 164 IDAGSNF-----NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLN 218

Query: 175 VSDFEEVDRNVTRHLPYDL-----SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEM 229
           V D + VD  V  +    L         WD+LI H LG+DH+GHK G     M  K ++ 
Sbjct: 219 VWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQA 278

Query: 230 DAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQR 289
           +  IK I + +D+ TL+ V+GDHGM+  GNHGG S  E  A +   S K      P+   
Sbjct: 279 NEFIKRICEKLDDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTK------PDMWN 332

Query: 290 GVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKD 336
            +     N+    +    + Q+D+V TL  L   PIP N++G  I++
Sbjct: 333 HLPQDAYNTSVLGENHREVNQIDLVSTLSLLLGLPIPFNNLGWPIQE 379

>NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON}
           Anc_4.28
          Length = 1011

 Score =  173 bits (438), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 174/345 (50%), Gaps = 36/345 (10%)

Query: 7   SLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPME--PQFEKMVVMVIDALRSD 64
           SL   Q +AI  F  GF   ++VL   +       +++ +E   +F K V++V+DALR D
Sbjct: 41  SLAALQFIAIAFFLKGFLLTRNVLDNVATL----ADYQSIENYGKFNKSVILVVDALRFD 96

Query: 65  FLFQANVSGFHFVHDLINKGEAWGYTAY--------------SNPPTVTLPRLKGITTGS 110
           F+   N S   + +D  +      Y  +              ++PPT TL RLKG+TTGS
Sbjct: 97  FVIPVNQSNPDY-NDYYHNNLKVLYEKFEDQSSSSSLLLKFMADPPTTTLQRLKGLTTGS 155

Query: 111 MPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGT 170
           +P F+DA  N        ++ ++D+ + Q+  + K++ F GDDTW  LF       S   
Sbjct: 156 LPTFIDAGSNF-----DGSVIEEDNIIKQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPF 210

Query: 171 NSFFVSDFEEVDRNV----TRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKH 226
            S  V D + VD  V      HL  + + Q W++LI H LG+DH+GHK G     M  K 
Sbjct: 211 ESLNVWDLDTVDNGVISFFNDHLLENTNDQSWNVLIGHMLGMDHVGHKFGPNHFTMKQKQ 270

Query: 227 IEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPE 286
           +++D  I++I D++D+ TL+ ++GDHGM+  GNHGG S  E  + +   SK+     A  
Sbjct: 271 LQIDKFIREIMDSIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKR---NNAWN 327

Query: 287 AQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
            Q        N    Y+    + Q+D+V TL  L   PIP N++G
Sbjct: 328 LQDTSNYDTRNQGDRYR---SVNQIDLVSTLSFLLGLPIPFNNLG 369

>Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  172 bits (437), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 170/341 (49%), Gaps = 39/341 (11%)

Query: 10  ICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQA 69
           I Q ++I  F  GF   + VL   S       E   + P+F K VV+VIDALR DF    
Sbjct: 44  ILQFISIAFFTRGFLLSRHVLDNISS----RNETSDLPPRFNKAVVLVIDALRFDFAIPV 99

Query: 70  NVS------GFH---------FVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNF 114
           N S       +H         F +D  +      + A  +PPT TL RLKG+TTGS+P F
Sbjct: 100 NESDPDHNPNYHNNILSLYDSFTNDKNSSSLLLKFIA--DPPTTTLQRLKGLTTGSLPTF 157

Query: 115 LDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFF 174
           +DA  N         + ++D+ L Q     K + F GDDTW  LF       S    S  
Sbjct: 158 IDAGSNF-----DGTIIEEDNLLKQFFLANKTVKFAGDDTWTALFYPFLSNDSFPLESLN 212

Query: 175 VSDFEEVDRNVTR----HLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMD 230
           V D + VD  V      HL  D   +EWD++I H LG+DH+GHK G     M  K I++D
Sbjct: 213 VWDLDTVDNGVMDYFHDHLQQD---KEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVD 269

Query: 231 AVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRG 290
             I  I +++D+ TL+ +LGDHGM+  GNHGG S  E  + +   SKK   ++  +A   
Sbjct: 270 RFIDWILNSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPEMWRLKDA--- 326

Query: 291 VQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
                  SD  Y Y + ++Q+D+V +L  L + PIP N++G
Sbjct: 327 --FNYNTSDSGYNYRS-VRQIDLVSSLSLLLDQPIPFNNLG 364

>KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4.28
           YLL031C
          Length = 1017

 Score =  172 bits (436), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 174/342 (50%), Gaps = 32/342 (9%)

Query: 12  QLVAILTFAIGFFPQKSVL----TGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLF 67
           Q +AI  F+ GF   + VL      DS+            P+F++ VV+++DALR DF+ 
Sbjct: 46  QFIAIAFFSRGFLLSRHVLDNISKADSQLTLQSS------PKFDRAVVLIVDALRFDFVI 99

Query: 68  -----QANVSGFH----FVHD-LINKGEAWG---YTAYSNPPTVTLPRLKGITTGSMPNF 114
                +AN S +H     ++D  ++  E+         ++PPT TL RLKG+TTGS+P F
Sbjct: 100 PIEKEKAN-SNYHNNINIMYDKFMDNSESCSSLLLKFMADPPTTTLQRLKGLTTGSLPTF 158

Query: 115 LDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFF 174
           +DA  N   D       ++D+ + QL+ H K + F GDDTW  LF       S    S  
Sbjct: 159 IDAGSNFNGDTI-----EEDNLIKQLYLHDKNVLFVGDDTWDALFNPFLSNNSAPFESLN 213

Query: 175 VSDFEEVDRNVTRHLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIK 234
           V D + VD  V       +  +EWD+L+ H LG+DH+GHK G     M  K  +++  I 
Sbjct: 214 VWDLDTVDNGVISFFNDHIHSKEWDVLVGHMLGVDHVGHKYGPDHFTMKEKQTQVNEFIH 273

Query: 235 DIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVP 294
            +  ++D+ TL+ V+GDHGM+  GNHGG S  E  + +   SK    + A     G Q  
Sbjct: 274 YVMQSLDDDTLLVVMGDHGMDRTGNHGGDSIDELESTLFLYSKTPGKFGA--MTDGNQSI 331

Query: 295 LINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKD 336
              SD    Y + + Q+D+V TL  +   PIP N++G  I++
Sbjct: 332 YNISDYGSSYRS-VNQIDLVSTLSLMLGTPIPFNNLGWPIEE 372

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score =  170 bits (431), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 171/345 (49%), Gaps = 40/345 (11%)

Query: 6   ISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDF 65
           I + + Q ++I  F  GF   + VL   S           + P+F K VV+V+DALR DF
Sbjct: 40  IFIAVLQFISIAFFTRGFLLSRHVLDNISAL-----NETSIPPRFNKAVVLVVDALRFDF 94

Query: 66  LFQANVSGFHFVHDLINKGEAWG-YTAYSN--------------PPTVTLPRLKGITTGS 110
           +   N S  +  H+L         Y +++N              PPT TL RLKG+TTGS
Sbjct: 95  VIPVNESSSN--HNLNYHNNILSLYDSFANDEDASSLLLKFIADPPTTTLQRLKGLTTGS 152

Query: 111 MPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGT 170
           +P F+DA  N         + ++D+ L QLH   K + F GDDTW+ LF       S   
Sbjct: 153 LPTFIDAGSNF-----DGTVIEEDNLLKQLHLVNKTVKFAGDDTWMALFHPFLSNDSFPL 207

Query: 171 NSFFVSDFEEVDRNVTR----HLPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKH 226
            S  V D + VD  V      HL  D   +EWD++I H LG+DH+GHK G     M  K 
Sbjct: 208 ESLNVWDLDTVDNGVMDYFHDHLQQD---KEWDVMIGHMLGIDHVGHKYGPNHFTMKEKQ 264

Query: 227 IEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPE 286
            ++D  I  I  ++D+ TL+ +LGDHGM+  GNHGG S  E  + +   SKK   +   +
Sbjct: 265 FQVDQFIAWILKSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNMWNFKD 324

Query: 287 AQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
           A       + N   DY+    ++Q+D+V +L  L   PIP N++G
Sbjct: 325 AS---NYNITNLGCDYR---SVRQIDLVSSLSLLLGQPIPFNNLG 363

>TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]
           {ON} Anc_4.28 YLL031C
          Length = 1065

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 176/351 (50%), Gaps = 30/351 (8%)

Query: 2   LFRAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDAL 61
           +F   S+ I Q ++I  F+ GF   ++VL   S     P      +PQF+K V++++DAL
Sbjct: 55  VFFIFSIAILQFISIAFFSRGFLLTRNVLDNIST-DNNPNSILNDKPQFDKTVILIVDAL 113

Query: 62  RSDFLFQANVSGFHFVHDLINKGEAWGYTAYSN--------------PPTVTLPRLKGIT 107
           R +F+   +V    +  +  N  +   Y  + N              PPT T+ RLKG+T
Sbjct: 114 RFNFVIPVDVDSMDYNPNYHNNIDVL-YDTFKNSQDSSSVLLKFIADPPTTTMQRLKGLT 172

Query: 108 TGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQR- 166
           TG++P F+DA  N    D S  L+D       L+K    I+F GDDTW  LF  +  Q+ 
Sbjct: 173 TGTLPTFIDAGSNF---DGSVILEDNLIKQLYLNKFWNDIYFVGDDTWDALFKPYLNQQF 229

Query: 167 SDGTNSFFVSDFEEVDRNVTRHLPYDLSYQE------WDILILHYLGLDHIGHKGGSASQ 220
           S   +S  V D + VD  V  +    L  Q       +  LI H LG+DH+GHK G    
Sbjct: 230 SRPFDSLNVWDLDTVDNGVISYFHEYLIDQSSKDQMTYKTLIGHMLGVDHVGHKYGPNHF 289

Query: 221 FMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLA 280
            M  K ++++  +K+I +++D+ TL+ V+GDHGM+  GNHGG S  E  + +   +KK  
Sbjct: 290 TMKEKQLQINQFLKEIINSIDDNTLLVVMGDHGMDHTGNHGGDSVDELESTLFMYAKK-K 348

Query: 281 NYKAPEAQRGVQVPLINSDGDYQYLTRIQQVDIVPTLVSLFNFPIPQNSVG 331
           N    +        + N    Y+   ++ Q+D+VPTL  L +  IP NS+G
Sbjct: 349 NSFTLDKDYETSYNISNFGESYK---QVNQIDLVPTLSLLLDLQIPFNSLG 396

>TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1040

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 137/319 (42%), Gaps = 62/319 (19%)

Query: 95  PPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDT 154
           PPT TL R+K IT GS+P+F+D  +         ++ ++D+ L Q++ + + I+F GD  
Sbjct: 151 PPTDTLQRVKCITGGSVPSFIDTGITFY-----GSMIEEDNILKQMYLNNRSIYFTGDKF 205

Query: 155 WLKLFPSHF---------------FQR-SDGTNSFFVSDFEEVDRNVT--RHLPYDLS-- 194
           W  L+  +F               FQ+ +  TN  +       D+ ++   +L  ++S  
Sbjct: 206 WNSLYSKYFQNFKLANNIDDIIDYFQKITTSTNHSYGESNRSSDKPISLDTNLLQNISSI 265

Query: 195 -----------YQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDER 243
                       ++WDILI H +  D +  K            +++++ + D  +++D  
Sbjct: 266 PTISNATVTTPSKDWDILIGHIME-DTMNEK---------VTQLKVNSFLNDTINSIDND 315

Query: 244 TLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQ 303
           TL+ VLGD+   +  NH           +   +KK  N+   +   G      N D   +
Sbjct: 316 TLLLVLGDYSTAN--NH------MLDTGLFMYTKKFKNFWNLQNHLGEY----NVDNFGE 363

Query: 304 YLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFL-PLLGTFAEIKV---KDNFRQLMKL 359
               I Q D+VP+L  L   PIP N++G  I + + P+     +++         QL   
Sbjct: 364 NYRVIDQFDVVPSLSLLLGLPIPFNNLGWPIDEIISPINSNLNDVRTLWYNSTLSQLKHY 423

Query: 360 ANNTPEFAGASIDMLLEQM 378
            + T      S + +L+++
Sbjct: 424 KDKTTISKSRSKNAILQKL 442

>KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 919

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 108/470 (22%), Positives = 171/470 (36%), Gaps = 118/470 (25%)

Query: 39  MPEEHKPMEPQFEKMVVMVIDALRSDFLFQA---NVSGFH-----FVHDLINKGEAWGYT 90
           M +     E   +++ ++V D LR+D  F      V+G H     ++ DL+     +G  
Sbjct: 37  MKQHQSTDEAPAKRLFLIVGDGLRADTTFDKILHPVTGEHDYLAPYIRDLVRNEATYG-V 95

Query: 91  AYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFY 150
           +++  PT + P    +  G    F + +  V +     N  D DS+ +Q     K  + +
Sbjct: 96  SHTRMPTESRPGHVAMIAG----FYEDVSAVTKG-WQENPVDFDSFFNQ----SKHTYSF 146

Query: 151 GDDTWLKLFPSHFFQRSDGTNS------FFVSDFE-------EVDRNVTRHLPYDL---- 193
           G    L +F        DG          +  +FE       E+D  V RH+ Y+L    
Sbjct: 147 GSPDILPMF-------KDGATPNKVDAWMYGHEFEDFTQSSIELDAFVFRHI-YELFNNT 198

Query: 194 ---------SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV---- 240
                      Q+ ++  LH LG D  GH     S   +     +D  +K + + V    
Sbjct: 199 KSNKTLETEIKQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFF 258

Query: 241 -DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVF----ISKKLANYKAPEAQRGVQVPL 295
            DE T      DHGM+  G+HG      T   +V     I+K + N          Q P+
Sbjct: 259 DDEDTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGINKPVKN----------QAPI 308

Query: 296 INSDGDYQYLTRIQ-----QVDIVPTLVSLFNFPIPQNSVG------------------- 331
            ++  +   L  I+     Q DI   +  L     P NSVG                   
Sbjct: 309 FDNYTENWNLADIKRNDVNQADIASLMSYLIGANYPVNSVGELPLNFIDAPEDKKLNALF 368

Query: 332 ----------------IIIKDFL-PLLGTFAEIKVKDNFRQ----LMKLANNTPEFAGAS 370
                           II   F+      F EI  ++  +Q    + ++A    E    +
Sbjct: 369 NNAKAILEQYLVKEQEIIASQFVYKEYEAFVEIPYQEYLQQIESLIERIAKGENELEPDA 428

Query: 371 IDMLLEQMKITQDDLATAAT-NYNYIFLIIGLSILCFITIIISCEFYRTF 419
           I +  E MK+T D LA   T N+ +I  I+ L  L +I    S  F R F
Sbjct: 429 IKLTEELMKVTLDGLAYLTTYNWRFIRTIVTLGFLGWIVYSFSI-FLRLF 477

>TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {ON}
           Anc_1.184 YKL165C
          Length = 920

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 81/182 (44%), Gaps = 21/182 (11%)

Query: 163 FFQRSDGTNSFFVSDFEEVDRNVTRHLPYDLS---YQEWDILILHYLGLDHIGH--KGGS 217
           F Q S   ++F      E+ +N T  L  DL+    Q+ +   LH LG D  GH  +  S
Sbjct: 177 FSQSSLELDAFVFDHVNELFKNAT--LDSDLNEQIKQDGNCFFLHLLGCDTAGHSYRPYS 234

Query: 218 ASQFMFPKHIEMD--AVIKDIYDAV-DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVF 274
           A  +   K+I+M    +++ + D   D++T      DHGM+  G+HG      T   +V 
Sbjct: 235 AEYYDNVKYIDMQISQLVEKVNDFFGDDQTAFVFTADHGMSAFGSHGDGHPNNTRTPLVA 294

Query: 275 ISKKLANYKAPEAQRGVQVPLINSDGD---YQYLTR--IQQVDIVPTLVSLFNFPIPQNS 329
                A    PE     Q P++N+  +   + Y+ R  ++Q DI   +  L     P NS
Sbjct: 295 WG---AGINKPEKH---QYPIVNNYTESWGFDYIKRNDVKQADIASLMSYLIGTNYPANS 348

Query: 330 VG 331
           VG
Sbjct: 349 VG 350

>YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON}
           MCD4Protein involved in glycosylphosphatidylinositol
           (GPI) anchor synthesis; multimembrane-spanning protein
           that localizes to the endoplasmic reticulum; highly
           conserved among eukaryotes
          Length = 919

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 92/393 (23%), Positives = 148/393 (37%), Gaps = 70/393 (17%)

Query: 40  PEEHKPMEPQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYTA 91
           P +  P  P  +++ ++V D LR+D  F      VSG       F+  L+     +G  +
Sbjct: 39  PYQSTPTPPA-KRLFLIVGDGLRADTTFDKVTHPVSGKTEFLAPFIRSLVMNNATYG-IS 96

Query: 92  YSNPPTVTLP-----------RLKGITTG--SMPNFLDAILNVAEDDTSSNLKDQDSWLS 138
           ++  PT + P            +  +T G  S P   D+  N +    S    D      
Sbjct: 97  HTRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFNQSTHTYSFGSPDILPMFK 156

Query: 139 QLHKHGKRIHFYGDDTWLKLFP-SHFFQRSDGTNSFFVSDFEEVDRNVTRH--LPYDLSY 195
                  ++     DTW+       F Q S   ++F     +++  N T +  L Y++  
Sbjct: 157 DGASDPNKV-----DTWMYDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNSTLDYEIR- 210

Query: 196 QEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLG 250
           Q+ ++  LH LG D  GH     S   +     +D  I  + D V     D++T      
Sbjct: 211 QDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTA 270

Query: 251 DHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDG-----DYQYL 305
           DHGM+  G+HG      T   +V     L         + V  P   SD      +   +
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGL--------NKPVHNPFPVSDNYTENWELSSI 322

Query: 306 TR--IQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLANNT 363
            R  ++Q DI   +  L     P+NSVG      LP+    A I  K++  +L  L NN 
Sbjct: 323 KRNDVKQADIASLMSYLIGVNYPKNSVGE-----LPI----AYIDGKES-DKLAALYNNA 372

Query: 364 PEFAGASIDMLLEQMKITQDDLATAATNYNYIF 396
                     +LEQ  + QD++  +   Y   F
Sbjct: 373 RS--------ILEQYLVKQDEVIDSQFFYKEYF 397

>Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 90/386 (23%), Positives = 151/386 (39%), Gaps = 78/386 (20%)

Query: 40  PEEHKPMEPQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYTA 91
           P +  P  P  +++ ++V D LR+D  F      V+G       F+  L+     +G  +
Sbjct: 39  PYQSTPTPPA-KRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYG-IS 96

Query: 92  YSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQ-LHKHG----KR 146
           ++  PT + P    +  G    F + +  V +    SN  D DS+ +Q  H +       
Sbjct: 97  HTRMPTESRPGHVAMIAG----FYEDVSAVTKG-WKSNPVDFDSFFNQSAHTYSFGSPDI 151

Query: 147 IHFYGD--------DTWLKLFP-SHFFQRSDGTNSFFVSDFEEVDRNVTRH--LPYDLSY 195
           +  + D        DTW+       F Q S   +++     +++ RN T +  L Y++  
Sbjct: 152 LPMFRDGASDPNKVDTWMYDHTFEDFTQSSIELDAYVFRHLDQLFRNSTLNSTLDYEIR- 210

Query: 196 QEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLG 250
           Q+ ++  LH LG D  GH     S   +     +D  I  + + V     D++T      
Sbjct: 211 QDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIEKVNRFFADDKTAFVFTA 270

Query: 251 DHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTR--- 307
           DHGM+  G+HG      T   ++                G+  P+ NS   +   T    
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLI------------AWGAGLNKPVHNSYPVFDNYTENWE 318

Query: 308 --------IQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKL 359
                   I+Q DI   +  L     P+NSVG      LP+    A I  K++  +L  L
Sbjct: 319 LSNIKRNDIKQADIASLMSYLIGVNYPKNSVGE-----LPI----AYIDGKES-DKLAAL 368

Query: 360 ANNTPEFAGASIDMLLEQMKITQDDL 385
            NN           +LEQ  + QD++
Sbjct: 369 YNNARS--------ILEQYLVKQDEV 386

>KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {ON}
           Anc_1.184 YKL165C
          Length = 922

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 128/321 (39%), Gaps = 53/321 (16%)

Query: 48  PQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYTAYSNPPTVT 99
           P  +++ ++V D LR+D  F+     V+G       F+  L+     +G  +++  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFEKVTHPVTGKTEYLAPFIRSLVLNNATYG-VSHTRMPTES 104

Query: 100 LPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLF 159
            P    +  G    F + +  V +     N  D DS+ +Q     +  + +G    L +F
Sbjct: 105 RPGHVAMIAG----FYEDVSAVTKG-WKENPVDFDSFFNQ----SRHTYSFGSPDILPMF 155

Query: 160 P------------------SHFFQRSDGTNSFFVSDFEEVDRNVTRHLPYDLSY-QEWDI 200
                                F Q S   +++   + +E+  N T     D    QE ++
Sbjct: 156 KDGASDPNKVDAWMYGHEFEDFTQSSIELDAYVFRNLDELFYNSTIDATLDFEIKQEGNV 215

Query: 201 LILHYLGLDHIGH--KGGSASQFMFPKHI--EMDAVIKDIYDAV-DERTLVCVLGDHGMN 255
             LH LG D  GH  +  SA  +   K+I  ++  +I  ++D   D+ T      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSAEYYDNIKYIDEQLSILIPKVHDFFNDDDTAFIFTADHGMS 275

Query: 256 DMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTRI-----QQ 310
             G+HG      T   +V      A    P+  +   VP+ ++  +   L+ I     +Q
Sbjct: 276 AFGSHGDGHPNNTRTPLVAWG---AGLNKPQINK---VPIYDNYTESWNLSHIKRNDVKQ 329

Query: 311 VDIVPTLVSLFNFPIPQNSVG 331
            DI   +  L     P NSVG
Sbjct: 330 ADIASLMSYLIGTNYPVNSVG 350

>Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 73/330 (22%), Positives = 126/330 (38%), Gaps = 56/330 (16%)

Query: 40  PEEHKPMEPQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYTA 91
           P +  P  P  +++ ++V D LR+D  F      V+G       F+  L+     +G  +
Sbjct: 39  PYQSTPTPPA-KRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYG-IS 96

Query: 92  YSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYG 151
           ++  PT + P    +  G    F + +  V +    SN  D DS+ +Q        + +G
Sbjct: 97  HTRMPTESRPGHVAMIAG----FYEDVSAVTKG-WKSNPVDFDSFFNQ----STHTYSFG 147

Query: 152 DDTWLKLFP------------------SHFFQRSDGTNSFFVSDFEEVDRNVTRH--LPY 191
               L +F                     F Q S   +++     +++ RN T +  L Y
Sbjct: 148 SPDILPMFKDGASDPNKVDAWMYDHTFEDFTQSSIELDAYVFKHLDQLFRNSTLNSTLDY 207

Query: 192 DLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLV 246
           ++  Q+ ++  LH LG D  GH     S   +     +D  I  + + V     D++T  
Sbjct: 208 EIR-QDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPTLIEKVNKFFDDDKTAF 266

Query: 247 CVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLT 306
               DHGM+  G+HG      T   +V     L              P+ ++  +   L+
Sbjct: 267 VFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGL------NKPVHTSYPVFDNYTENWELS 320

Query: 307 RI-----QQVDIVPTLVSLFNFPIPQNSVG 331
            I     +Q DI   +  L     P+NSVG
Sbjct: 321 SIKRNDVKQADIASLMSYLIGVNYPKNSVG 350

>Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {ON}
           YKL165C (REAL)
          Length = 945

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 89/385 (23%), Positives = 145/385 (37%), Gaps = 69/385 (17%)

Query: 48  PQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYTAYSNPPTVT 99
           P  +++ ++V D LR+D  F      V+G       ++  L+     +G  +++  PT +
Sbjct: 72  PPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPYIRSLVMNNATYG-ISHTRMPTES 130

Query: 100 LP-----------RLKGITTG--SMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKR 146
            P            +  +T G  S P   D+  N +    S    D             R
Sbjct: 131 RPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFNQSTHTYSFGSPDILPMFKDGASDPNR 190

Query: 147 IHFYGDDTWLKLFP-SHFFQRSDGTNSFFVSDFEEVDRNVTRH--LPYDLSYQEWDILIL 203
           +     DTW+       F Q S   +++      E+  N T +  L Y++  Q+ ++  L
Sbjct: 191 V-----DTWMYDHTFEDFTQSSIELDAYVFRHLNELFHNSTLNSTLDYEIR-QDGNVFFL 244

Query: 204 HYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLGDHGMNDMG 258
           H LG D  GH     S   +     +D  I  + D V     D++T      DHGM+  G
Sbjct: 245 HLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTADHGMSAFG 304

Query: 259 NHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQ--VPLINSDGDYQYLTRI-----QQV 311
           +HG      T   +V     L         + VQ   P+ ++  D   L+ I     +Q 
Sbjct: 305 SHGDGHPNNTRTPLVAWGAGL--------NKPVQNSFPVFDNYTDNWELSNIKRNDVKQA 356

Query: 312 DIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLANNTPEFAGASI 371
           DI   +  L     P+NSVG      LP+   + + K  D   +L  L NN         
Sbjct: 357 DIASLMSYLIGVNYPKNSVGE-----LPI--AYLDGKESD---KLSALYNNARS------ 400

Query: 372 DMLLEQMKITQDDLATAATNYNYIF 396
             +LEQ  + QD++  +   Y   F
Sbjct: 401 --ILEQYLVKQDEVIDSQFFYKEYF 423

>NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {ON}
           Anc_1.184 YKL165C
          Length = 925

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 77/180 (42%), Gaps = 17/180 (9%)

Query: 163 FFQRSDGTNSFFVSDFEEVDRNVTRHLPYDLS-YQEWDILILHYLGLDHIGH--KGGSAS 219
           F Q S   +++     + + +N T ++  D    QE ++  LH LG D  GH  +  SA 
Sbjct: 176 FTQSSIELDAYVFRHLDSLFKNSTSNVTLDHEIRQEGNVFFLHLLGCDTAGHSYRPYSAE 235

Query: 220 QFMFPKHI--EMDAVIKDIYDAV-DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFIS 276
            +   K+I  ++  ++  ++D   DE T      DHGM+  G+HG      T   +V   
Sbjct: 236 YYDNVKYIDEQVSLLVDKVHDFFGDEDTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWG 295

Query: 277 KKLANYKAPEAQRGVQVPLINSDGDYQYLT-----RIQQVDIVPTLVSLFNFPIPQNSVG 331
              A    P      +VP+ ++  +   L       I+Q DI P +  L     P NSVG
Sbjct: 296 ---AGLNKPVKN---EVPIYDNYTESWGLADIKRNDIKQADITPLMSYLIGANYPANSVG 349

>TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa]
           {ON} Anc_1.184 YKL165C
          Length = 947

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 127/340 (37%), Gaps = 76/340 (22%)

Query: 41  EEHKPM-EPQFEKMVVMVIDALRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVT 99
           ++HK   EP  +++ ++V D LR+D  F           D IN     G T Y  P   +
Sbjct: 38  QQHKSTNEPPAKRLFLIVGDGLRADTTF-----------DKINH-PITGETDYLAPFLRS 85

Query: 100 LPRLKG--------ITTGSMPNFLDAILNVAEDDTS------SNLKDQDSWLSQLHKHGK 145
           +   +G        + T S P  +  I    ED ++       N  + DS+ +Q     K
Sbjct: 86  IVLEEGTYGISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQ----SK 141

Query: 146 RIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFE-------EVDRNVTRH---------- 188
             + +G    L +F       +      +  +FE       E+D  V RH          
Sbjct: 142 HTYSFGSPDILPMFKDGASDINRIDTWMYGHEFEDFTQSSIELDAYVFRHMNELFFNSTV 201

Query: 189 ---LPYDLSYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV----- 240
              L Y++  Q+ ++  LH LG D  GH     S   +     +D ++  + D V     
Sbjct: 202 NETLNYEIR-QDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKMVSKLVDDVTTFFN 260

Query: 241 DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVF----ISKKLANYKAPEAQRGVQVPLI 296
           D  T      DHGM+  G+HG      T   ++     I+K + N          +VP+ 
Sbjct: 261 DNDTAFIFTADHGMSAFGSHGDGHPNNTRTPLIAWGAGINKPVKN----------EVPIF 310

Query: 297 NSDGDYQYLTRI-----QQVDIVPTLVSLFNFPIPQNSVG 331
           ++  +   L  I     +Q DI   +  L     P NSVG
Sbjct: 311 DNYTEGWNLGSIKRNDVKQADIASLMSYLIGANYPANSVG 350

>KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {ON}
           Anc_1.184 YKL165C
          Length = 931

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 125/328 (38%), Gaps = 49/328 (14%)

Query: 39  MPEEHKPMEPQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYT 90
           M +     +P  +++ ++V D LR+D  F      V+G       ++  L+     +G  
Sbjct: 37  MKQYRSTEQPPAKRLFLIVGDGLRADTTFDMITHPVTGKTEYLAPYIRSLVENNATYG-I 95

Query: 91  AYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQ----------- 139
           +++  PT + P    +  G    F + +  V +     N  D DS+ +Q           
Sbjct: 96  SHTRMPTESRPGHVAMIAG----FYEDVSAVTKG-WKENPVDFDSFFNQSTHTYSFGSPD 150

Query: 140 ---LHKHGKRIHFYGDDTWLKLFP-SHFFQRSDGTNSFFVSDFEEV--DRNVTRHLPYDL 193
              + K G   H    D W+       F Q S   +++  +  +++  +  V R L  ++
Sbjct: 151 ILPMFKDGASDH-NKVDAWMYGHEFEDFTQSSIELDAYVFNHMDQLFYNSTVNRTLDNEI 209

Query: 194 SYQEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCV 248
             Q  ++  LH LG D  GH     S   +     +D  ++ + D V     D+ T    
Sbjct: 210 R-QNGNVFFLHLLGCDTAGHSYRPYSPEYYDNVKYIDREVEKLMDKVHNFFDDDDTAFIF 268

Query: 249 LGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTRI 308
             DHGM+  G+HG      T   +V     L   K  +      VP+ ++      L+ I
Sbjct: 269 TADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNRPKLND------VPIYDNYTKPWNLSHI 322

Query: 309 Q-----QVDIVPTLVSLFNFPIPQNSVG 331
           Q     Q DI   +  L     P NSVG
Sbjct: 323 QRNDVKQADIASLMSYLIGANYPVNSVG 350

>SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa]
           {ON} similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 1035

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 80/359 (22%), Positives = 132/359 (36%), Gaps = 75/359 (20%)

Query: 48  PQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYTAYSNPPTVT 99
           P  +++ ++V D LR+D  F      VSG       F+  L+     +G  +++  PT +
Sbjct: 157 PPAKRLFLIVGDGLRADTTFDKITHPVSGETTYLAPFIRSLVKNNATYG-ISHTRMPTES 215

Query: 100 LPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLF 159
            P    +  G    F + +  V +     N  D DS+ +Q        + +G    L +F
Sbjct: 216 RPGHVAMIAG----FYEDVSAVTKG-WQENPVDFDSFFNQ----SAHTYSFGSPDILPMF 266

Query: 160 PSHFFQRSDGTNSFFVSDFE-------EVDRNVTRHL-------PYDLSYQE-----WDI 200
                         +  +FE       E+D  V RHL         D + +E      ++
Sbjct: 267 KEGASDPHRVDAWMYGHEFEDFTQSSIELDAYVFRHLDQLFHNSTVDTALREEIMQHGNV 326

Query: 201 LILHYLGLDHIGH--KGGSASQFMFPKHIEMDAVI-----KDIYDAVDERTLVCVLGDHG 253
             LH LG D  GH  +  SA  +   ++I+    +     +D +   D+ T      DHG
Sbjct: 327 FFLHLLGCDTAGHSYRPYSAEYYDNVRYIDEQVAVLVEKVRDFFG--DDDTAFIFTADHG 384

Query: 254 MNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTR------ 307
           M+  G+HG      T   +V                G+  P+ N   +Y   T       
Sbjct: 385 MSAFGSHGDGHPNNTRTPLVAWGA------------GLNTPVRNEKPEYDNYTATWDLAE 432

Query: 308 -----IQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVK---DNFRQLMK 358
                + Q DI   +  L     P NSVG +    L  L    E K+K   +N R +++
Sbjct: 433 VRRNDVNQADIASLMAYLIGTNYPANSVGELP---LAYLAGTEEAKLKALYNNARSILE 488

>Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {ON}
           YKL165C (MCD4) - (putative) involved in cell polarity
           [contig 108] FULL
          Length = 922

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 127/322 (39%), Gaps = 55/322 (17%)

Query: 48  PQFEKMVVMVIDALRSDFLFQA---NVSG-----FHFVHDLINKGEAWGYTAYSNPPTVT 99
           P  +++ ++V D LR+D  F+     VSG       F+  L+     +G  +++  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFEKITHPVSGETAHLAPFIRSLVLNNATYG-VSHTRMPTES 104

Query: 100 LPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLF 159
            P    +  G    F + +  V +     N  D DS+ +Q        + +G    L +F
Sbjct: 105 RPGHVAMIAG----FYEDVSAVTKG-WKENPVDFDSFFNQ----SAHTYSFGSPDILPMF 155

Query: 160 PSHFFQRSDGTNSFFVSDFE-------EVDRNVTRHLP--YDLSY----------QEWDI 200
                         +  +FE       E+D  V RHL   ++ S           Q  ++
Sbjct: 156 KDGATDPHKVDAWMYGHEFEDFTQSSIELDAFVFRHLDNLFNTSTTNETLRQEITQSGNV 215

Query: 201 LILHYLGLDHIGH--KGGSASQFMFPKHI--EMDAVIKDIYDAV-DERTLVCVLGDHGMN 255
             LH LG D  GH  +  SA  +   K+I  E+  ++  + D   D+ T      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGDDDTAFIFTADHGMS 275

Query: 256 DMGNHGGSSAGETSAAMVFISKKLAN-YKAPEAQRGVQVPLIN--SDG-DYQYLTR--IQ 309
             G+HG      T   +V     L    K P       VP+ +  ++G D   + R  ++
Sbjct: 276 AFGSHGDGHPNNTRTPLVAWGAGLNKPVKNP-------VPIYDNYTEGWDLATIQRNDVK 328

Query: 310 QVDIVPTLVSLFNFPIPQNSVG 331
           Q DI   +  L     P NSVG
Sbjct: 329 QADIASLMSYLIGANYPANSVG 350

>Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AEL113C
          Length = 926

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/330 (20%), Positives = 110/330 (33%), Gaps = 69/330 (20%)

Query: 47  EPQFEKMVVMVIDALRSDFLFQ------ANVSGF--HFVHDLINKGEAWGYTAYSNPPTV 98
           +P  +++ ++V D LR+D  F       A  + F   F+  L+     +G +    P   
Sbjct: 45  QPPAKRLFLIVGDGLRADTTFDKITYPSAGEAEFLAPFIRSLVMNNATYGISHTRMP--- 101

Query: 99  TLPRLKGITTGSMPNFLDAILNVAED--DTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWL 156
                    T S P  +  I    ED    +   K+       +       + +G    L
Sbjct: 102 ---------TESRPGHVSMIAGFYEDVSAVTKGWKENPVNFDSVFNQSAHTYSFGSPDIL 152

Query: 157 KLFPSHFFQRSDGTNSFFVSDFE-------EVDRNVTRHLPY------------DLSYQE 197
            +F       +  +   +  +FE       E+D  V RHL              +  +Q+
Sbjct: 153 PMFKDGASDPNKVSAWMYGHEFEDFTQSSIELDAYVFRHLDQLFRNSTVNATLNEEIFQD 212

Query: 198 WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLGDH 252
            ++  LH LG D  GH     S   +     +D  I  + D V     D+ T      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKQISLLVDKVRDFFGDDDTAFLFTADH 272

Query: 253 GMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTR----- 307
           GM+  G+HG      T   +V                G+  P+ N    +   T+     
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLV------------AWGAGLNKPVRNKHPIHDNYTKNWELS 320

Query: 308 ------IQQVDIVPTLVSLFNFPIPQNSVG 331
                 + Q DI   +  L     P NSVG
Sbjct: 321 DIKRNDVNQADIASLMSYLIGANYPANSVG 350

>Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {ON}
           complement(37667..40735) [3069 nt, 1023 aa]
          Length = 1022

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 142/332 (42%), Gaps = 53/332 (15%)

Query: 46  MEPQFEKMVVMVIDALRSDFL----------FQANVSGFHFVHDLINKGEAWGY-----T 90
           ++PQF K +V+V+D+L  D +          F   +S      D I+  + + Y     T
Sbjct: 82  IDPQFSKAIVLVLDSLSLDSIAFSELSANDNFNHQLSSLTSPDDEISSQKLFSYVSKEYT 141

Query: 91  AYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFY 150
             +   T    +L+ + +G++ +    + N      ++ L  +D++L +L+ + K ++F 
Sbjct: 142 FEAESSTHHTSKLQDLFSGTVTDLAKCVKNF-----TNCLLFEDNFLHKLNLNYKNVYFA 196

Query: 151 GDDTWLKL---FPSHFFQRSDGT--NSFFVSDFEEVDRNVTRHLPYDL------SYQEWD 199
            +  W  +   F S+  QR   T  N+  +  +       T +  Y+         ++W+
Sbjct: 197 NEHYWDSIDGIFSSN--QRLPATLANNAEIDTYTIDPNKDTINFLYETVIDKSNDIEKWE 254

Query: 200 ILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDERTLVCVLGDHGMNDMGN 259
           +LI H  GL        +    +    IE+D +I D+  ++D  TL+ V+        GN
Sbjct: 255 VLIGHLYGLKPHDENLETNDPSILRNQIEIDKLITDLKKSMDNDTLLMVVS-------GN 307

Query: 260 HGGSSAG--ETSAAMVFISKK---LANYKAPEAQRGVQVPLINSDGDYQYLTRIQQVDIV 314
              S+    + +  ++++      L NY   +    +    I  D      + I +VDI+
Sbjct: 308 SKFSTKDVIKNNKNILYLYSNVPNLWNYSVADNSNLI----IGKDNSTLKYSNIDKVDII 363

Query: 315 PTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAE 346
           P++  L + P+P +S+G+    F+P L    E
Sbjct: 364 PSISLLLDLPLPVDSLGL----FIPELANSEE 391

>Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]
           {ON} (81621..83408,83411..84382) [2760 nt, 920 aa]
          Length = 919

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 53/152 (34%), Gaps = 28/152 (18%)

Query: 196 QEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLG 250
           Q+ ++  LH LG D  GH     S   +     +D  +  + D V     D+ T      
Sbjct: 211 QDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDNQVSVLVDKVREFFGDDETAFVFTA 270

Query: 251 DHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTR--- 307
           DHGM+  G+HG      T   +V                GV  P+ N    Y   T    
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLV------------AWGAGVNKPVRNEYPIYDNYTEGWN 318

Query: 308 --------IQQVDIVPTLVSLFNFPIPQNSVG 331
                   ++Q DI   +  L     P NSVG
Sbjct: 319 LADIKRNDVKQADIASLMSYLIGVNYPSNSVG 350

>NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON}
           Anc_1.184 YKL165C
          Length = 924

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 56/146 (38%), Gaps = 16/146 (10%)

Query: 196 QEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLG 250
           QE ++  LH LG D  GH     S   +     +D  +  + D V     D+ T      
Sbjct: 211 QEGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTAFIFTA 270

Query: 251 DHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTRI-- 308
           DHGM+  G+HG      T   +V      A    P      +VP+ ++  +   L  I  
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWG---AGLNKPVKN---EVPIYDNYTESWKLADIKR 324

Query: 309 ---QQVDIVPTLVSLFNFPIPQNSVG 331
              +Q DI   +  L     P NSVG
Sbjct: 325 NDVKQADITSLMSYLIGTNYPANSVG 350

>ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} highly
           similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 921

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 76/179 (42%), Gaps = 28/179 (15%)

Query: 196 QEWDILILHYLGLDHIGH--KGGSASQFMFPKHIE--MDAVIKDIYDAV-DERTLVCVLG 250
            + ++  LH LG D  GH  +  SA  +   K+I+  ++ +++ + D   D+ T      
Sbjct: 211 HDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDGKVETLVEQVRDFFGDDETAFVFTA 270

Query: 251 DHGMNDMGNHGGSSAGETSAAMVF----ISKKLANYKAPEAQRGVQVPLINSDGDYQYLT 306
           DHGM+  G+HG      T   +V     ++K + N K P      Q        D  ++ 
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHNLK-PVYDNYTQ------GWDLSHIK 323

Query: 307 R--IQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLANNT 363
           R  ++Q DI   +  L     P NSVG +  D++            D+  +L  L NN+
Sbjct: 324 RHDVKQADIASLMSYLIGANYPANSVGELPLDYIS----------GDDAAKLSALYNNS 372

>AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL165C
           (MCD4)
          Length = 925

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/325 (22%), Positives = 125/325 (38%), Gaps = 59/325 (18%)

Query: 47  EPQFEKMVVMVIDALRSDFLF---QANVSG-----FHFVHDLINKGEAWGYTAYSNPPTV 98
           EP  +++ ++V D LR+D  F   +  V+G       ++  L+     +G  +++  PT 
Sbjct: 45  EPPAKRLFLIVGDGLRADTSFDKVKHPVTGKTEFLAPYLRSLVEHNATYG-ISHTRMPTE 103

Query: 99  TLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKL 158
           + P    +  G    F + +  V +     N  D DS  +Q        + +G    L +
Sbjct: 104 SRPGHVAMIAG----FYEDVSAVTKG-WKENPVDFDSVFNQ----STHTYSFGSPDILPM 154

Query: 159 FPSHFFQRSDGTNSFFVSDFE-------EVDRNVTRH-------------LPYDLSYQEW 198
           F S     +      +  +FE       E+D  V RH             L +++  Q+ 
Sbjct: 155 FKSGASDPTKVDAWMYGHEFEDFTQSSIELDAYVFRHMDALFRNATVDSKLRHEM-MQDG 213

Query: 199 DILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLGDHG 253
           ++  LH LG D  GH     S   +     +D+ ++ +   V     D+ T      DHG
Sbjct: 214 NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDTAFVFTADHG 273

Query: 254 MNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGV--QVPLINS---DGDYQYLTR- 307
           M+  G+HG      T   +V     L         R V   VP+ ++   + D  ++ R 
Sbjct: 274 MSAFGSHGDGHPNNTRTPLVAWGAGL--------NRPVLNDVPVYDNYTENWDLAHVRRN 325

Query: 308 -IQQVDIVPTLVSLFNFPIPQNSVG 331
            + Q DI   +  L     P NSVG
Sbjct: 326 DVNQADIASLMSYLIGLNYPTNSVG 350

>TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.184
           YKL165C
          Length = 920

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 88/377 (23%), Positives = 130/377 (34%), Gaps = 86/377 (22%)

Query: 39  MPEEHKPMEPQFEKMVVMVIDALRSDFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTV 98
           M +      P  +++ ++V D LR+D  F           DLI    + G T Y  P   
Sbjct: 37  MNQYQSTDNPPAKRLFLIVGDGLRADTTF-----------DLITHPTS-GKTEYLAPYIR 84

Query: 99  TL---PRLKGIT-----TGSMPNFLDAILNVAEDDTS------SNLKDQDSWLSQLHKHG 144
           +L       GI+     T S P  +  I    ED ++       N  D DS+ +Q     
Sbjct: 85  SLVLNNATYGISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQ----S 140

Query: 145 KRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFE-------EVDRNVTRHLPYDLSYQ- 196
              + +G    L +F       S      +  +FE       E+D  V RHL  DL +  
Sbjct: 141 AHTYSFGSPDILPMFKEGASDPSRVDTWTYGHEFEDFTQSSIELDAYVFRHLD-DLFHNS 199

Query: 197 ------------EWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV---- 240
                       + +++ LH LG D  GH     S   +     +D  +  + D V    
Sbjct: 200 TRDSTLNDEIRGDGNVVFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQVSMLSDKVRSFF 259

Query: 241 -DERTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSD 299
            D+ T      DHGM+  G+HG      T   +V                G+  PL N  
Sbjct: 260 GDDDTAFIFTADHGMSAFGSHGDGHPNNTRTPLV------------AWGAGLNKPLKNDY 307

Query: 300 GDYQYLT-----------RIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIK 348
             +   T            ++Q DI   +  L     P NSVG      LPL   + + K
Sbjct: 308 PVFDNYTFTWGLEDVQRHDVKQADIASLMSYLIGVNYPANSVGE-----LPL--AYIDGK 360

Query: 349 VKDNFRQLMKLANNTPE 365
             D    L K A +  E
Sbjct: 361 ESDKLHALYKNARSILE 377

>KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 922

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 121/329 (36%), Gaps = 69/329 (20%)

Query: 48  PQFEKMVVMVIDALRSDFLFQ----------ANVSGFHFVHDLINKGEAWGYTAYSNPPT 97
           P  +++ ++V D LR+D  F           A+++ F  +  L+     +G  +++  PT
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKITHPTTGETAHLAPF--LRSLVLNNATYG-VSHTRMPT 102

Query: 98  VTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLK 157
            + P    +  G    F + +  V +     N  D DS+ +Q        + +G    L 
Sbjct: 103 ESRPGHVAMIAG----FYEDVSAVTKG-WKENPVDFDSFFNQ----SAHTYSFGSPDILP 153

Query: 158 LFPSHFFQRSDGTNSFFVSDFE-------EVDRNVTRHLP------------YDLSYQEW 198
           +F       +      +  +FE       E+D  V RHL             ++   Q  
Sbjct: 154 MFKDGASDPNKVDAWMYGHEFEDFTQSSIELDAYVFRHLDNLFYNSTMDRELHEQIMQPG 213

Query: 199 DILILHYLGLDHIGH--KGGSASQFMFPKHI--EMDAVIKDIYDAV-DERTLVCVLGDHG 253
           ++  LH LG D  GH  +  S   +   K+I  E+  ++  + D   D+ T      DHG
Sbjct: 214 NVFFLHLLGCDTAGHSYRPYSPEYYDNVKYIDDEVSKLVPKVRDFFGDDDTAFVFTADHG 273

Query: 254 MNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTR------ 307
           M+  G+HG      T   ++                G+  P++N    Y   T       
Sbjct: 274 MSAFGSHGDGHPNNTRTPLI------------AWGAGLNRPVLNKAPIYDNYTEGWDLAN 321

Query: 308 -----IQQVDIVPTLVSLFNFPIPQNSVG 331
                ++Q DI   +  L     P NSVG
Sbjct: 322 IQRNDVKQADIASLMTYLIGADYPANSVG 350

>CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa]
           {ON} highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165c sporulation protein
          Length = 921

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 77/197 (39%), Gaps = 28/197 (14%)

Query: 196 QEWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDE-----RTLVCVLG 250
           Q+ +   LH LG D  GH     S   +   I +D  ++ +   V+E      T      
Sbjct: 211 QDGNAFFLHLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFTA 270

Query: 251 DHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDYQYLTR--I 308
           DHGM+  G+HG      T   +V      A    P      +      + +   + R  +
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWG---AGLNRPVRLDTPEFDEYTENWNLANIKRNDV 327

Query: 309 QQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLANNTPEFAG 368
           +Q DI   +  L     P NSVG      LPL    A I+  +  ++L  L NN      
Sbjct: 328 KQADIAALMSYLIGTNYPANSVGE-----LPL----AYIEGSEG-QKLEALLNNA----- 372

Query: 369 ASIDMLLEQMKITQDDL 385
              + +LEQ ++ ++++
Sbjct: 373 ---ESILEQYRVKENEV 386

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,470,781
Number of extensions: 3853810
Number of successful extensions: 13290
Number of sequences better than 10.0: 69
Number of HSP's gapped: 13262
Number of HSP's successfully gapped: 71
Length of query: 806
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 688
Effective length of database: 39,950,811
Effective search space: 27486157968
Effective search space used: 27486157968
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 70 (31.6 bits)