Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_55245.425ON41541519370.0
AER251W5.425ON4074148211e-106
KLTH0F16280g5.425ON4732904704e-53
SAKL0G02266g5.425ON4843034331e-47
ZYRO0F09812g5.425ON4162444062e-44
Kwal_55.214685.425ON4652994074e-44
Suva_2.5345.425ON4522613891e-41
KAFR0E038705.425ON3962523816e-41
Smik_4.6285.425ON4582593776e-40
Skud_4.6315.425ON4582603769e-40
YDR363W (ESC2)5.425ON4562593732e-39
NCAS0F033105.425ON4422703653e-38
KLLA0E21275g5.425ON3922453543e-37
TBLA0A037105.425ON4612513471e-35
TDEL0E020005.425ON4362623302e-33
NDAI0B056005.425ON4572853268e-33
Kpol_1027.265.425ON4432673126e-31
CAGL0A02706g5.425ON3692463024e-30
TPHA0E018105.425ON4532842811e-26
KNAG0C049805.425ON3452482392e-21
TDEL0G038606.85ON40999770.57
TPHA0B028208.625ON43754712.7
Ecym_30876.100ON161875689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_5524
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   750   0.0  
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   320   e-106
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   185   4e-53
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   171   1e-47
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   160   2e-44
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   161   4e-44
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   154   1e-41
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   151   6e-41
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   149   6e-40
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   149   9e-40
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   148   2e-39
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   145   3e-38
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   140   3e-37
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   138   1e-35
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   131   2e-33
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   130   8e-33
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   124   6e-31
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   120   4e-30
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   112   1e-26
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...    97   2e-21
TDEL0G03860 Chr7 (705400..706629) [1230 bp, 409 aa] {ON} Anc_6.8...    34   0.57 
TPHA0B02820 Chr2 (641721..643034) [1314 bp, 437 aa] {ON} Anc_8.6...    32   2.7  
Ecym_3087 Chr3 complement(160289..165145) [4857 bp, 1618 aa] {ON...    31   9.0  

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/415 (90%), Positives = 375/415 (90%)

Query: 1   MSKASEYDDIDDFFCNDLSPSLSADDGFGTADIAVPTTLFMNKSKVRGSVSSFSKECSDG 60
           MSKASEYDDIDDFFCNDLSPSLSADDGFGTADIAVPTTLFMNKSKVRGSVSSFSKECSDG
Sbjct: 1   MSKASEYDDIDDFFCNDLSPSLSADDGFGTADIAVPTTLFMNKSKVRGSVSSFSKECSDG 60

Query: 61  RDQANSEDEDGFRFRSRQRGRKERNSPGYGXXXXXXXXXXXXXXXXXXXXXXXPVRPAKR 120
           RDQANSEDEDGFRFRSRQRGRKERNSPGYG                       PVRPAKR
Sbjct: 61  RDQANSEDEDGFRFRSRQRGRKERNSPGYGSISRSNSRSRRSRSRSLSSDSLSPVRPAKR 120

Query: 121 SRNVEHSQEESDTNKFLAEIEQEAERAXXXXXXXXXXXXXXXXXEIGTNIYNVGFISKLE 180
           SRNVEHSQEESDTNKFLAEIEQEAERA                 EIGTNIYNVGFISKLE
Sbjct: 121 SRNVEHSQEESDTNKFLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLE 180

Query: 181 GSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFM 240
           GSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFM
Sbjct: 181 GSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFM 240

Query: 241 TCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGI 300
           TCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGI
Sbjct: 241 TCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGI 300

Query: 301 EFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVK 360
           EFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVK
Sbjct: 301 EFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVK 360

Query: 361 PTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSVL 415
           PTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSVL
Sbjct: 361 PTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSVL 415

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  320 bits (821), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/414 (45%), Positives = 257/414 (62%), Gaps = 8/414 (1%)

Query: 1   MSKASEYDDIDDFFCNDLSPSLSADDGFGTADIAVPTTLFMNKSKVRGSVSSFSKECSDG 60
           M + +EYDDIDDFFCND+SP     D FG+ DIA+P+ L+    K R   S   ++  + 
Sbjct: 1   MGEFNEYDDIDDFFCNDISPLHDEADEFGSTDIALPSQLYGKGPKPRAGESKALRD-RNK 59

Query: 61  RDQANSEDEDGFRFRSRQRGRKERNSPGYGXXXXXXXXXXXXXXXXXXXXXXXPVRPAKR 120
              + +E E      + +RGR      G                         PVRPAKR
Sbjct: 60  ESGSGTESEAKGDTLATKRGRSSWRR-GASESSRSSSLGSSSPSDSSSGRSLSPVRPAKR 118

Query: 121 SRNVEHSQEESDTNKFLAEIEQEAERAXXXXXXXXXXXXXXXXXEIGTNIYNVGFISKLE 180
            R  E  Q ES+ N+FLAE+E++ E +                 +    +YNVGFIS++E
Sbjct: 119 KRTDEQ-QPESEANRFLAEMERDIELSAGPGGGETATGKGGRDTD--ARVYNVGFISRIE 175

Query: 181 GSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFM 240
           GS N+R+NV++TG+K+F+ FL IAL  F K++ I  SL  KYQ D VKIYREGVE+FKFM
Sbjct: 176 GSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVKIYREGVEVFKFM 235

Query: 241 TCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGI 300
           TCDSFNI E Y +S+ DIEVYIVP + A+ FE +WK+K E +++ +S S+    +D    
Sbjct: 236 TCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVMDDIED 295

Query: 301 EFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVK 360
           +  NDDF VNEYEK L NARSL+ETE+    + +  D+ ++L+K+VLLGSDNKKV+++V+
Sbjct: 296 D--NDDFLVNEYEKALVNARSLNETELAV-REGTPADESSQLLKIVLLGSDNKKVFIHVR 352

Query: 361 PTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSV 414
           PTTT  K+AEHYR  K+LPPT +L L FDH++ID  +TI +  IED DI+EV V
Sbjct: 353 PTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTICNIDIEDGDIIEVVV 406

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  185 bits (470), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 157/290 (54%), Gaps = 21/290 (7%)

Query: 125 EHSQEESDTNKFLAEIEQEAERAXXXXXXXXXXXXXXXXXEIGTNIYNVGFISKLEGSTN 184
           +H ++E D  KF  E+E+EA R                   +   IYN+ FIS LEGS  
Sbjct: 202 QHEKDEDD--KFFEELEREASRTASTVKESSPA--------VAQRIYNIKFISDLEGSAG 251

Query: 185 KRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDS 244
           +RINV++ GK+ F   LP+ALKT +KEYKI  +LH  Y+ D V +YR+GV+I  FM C+S
Sbjct: 252 RRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNS 311

Query: 245 FNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGIEFGN 304
             I   +     D+ + I+       FE  ++Q   +  + V     P      G E   
Sbjct: 312 LQIPLEFKGEVSDVCLTIISKGQEQNFEALYEQSKHSNHELVPAFIEP------GTE--T 363

Query: 305 DDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVKPTTT 364
            DF V EYEK+L N      T +Q  NQ   P   ++ I++ L+  DNKK+ V  +P TT
Sbjct: 364 PDFTVEEYEKELRNVDFNKNTSVQ--NQ-PPPQSVDDNIRIALMSQDNKKIIVTARPETT 420

Query: 365 FEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSV 414
           F  LAEHY+++  LPP  +++L FD++++   + +  A +EDDDIVEV +
Sbjct: 421 FAALAEHYQKLTSLPPQQQVLLFFDNEELHLDSKVSDADVEDDDIVEVVI 470

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  171 bits (433), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 166/303 (54%), Gaps = 22/303 (7%)

Query: 114 PVRPAKRSRNVEHSQ-EESDTNKFLAEIEQEAERAXXXXXXXXXXXXXXXXXEIGTNIYN 172
           P +  KRS  +     EE DT+ F  EI + A R                  E+    Y 
Sbjct: 203 PSKRTKRSAVISKPVVEEDDTDAFFTEITRNANRTSTVIRESSP--------ELDKRTYK 254

Query: 173 VGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYRE 232
           + FISKL+GS +K+I V+  GK  F+  LP  L   VK Y+I  ++ + Y++DNV +Y  
Sbjct: 255 ISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWN 314

Query: 233 GVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASP 292
           G +I  FMTC+S  I + Y     D+++ +V  E   ++E ++K+ +E ++     S S 
Sbjct: 315 GAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKEMVENEL-----SGSS 369

Query: 293 VDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDN 352
           VD+ +       DDF  NEYE  L  + S + + ++ S  I    DG+  IK+ L+G DN
Sbjct: 370 VDVKN----VKKDDFATNEYELQLEKSESAEPSLLKSSENIR---DGS-FIKLALVGQDN 421

Query: 353 KKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEV 412
           KK++V  + +T F+K+A++Y+ +K LP  TKL L+FDH ++   + +    +ED+D++EV
Sbjct: 422 KKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSLEDRVEDHEMEDEDMIEV 481

Query: 413 SVL 415
           +++
Sbjct: 482 AIV 484

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  160 bits (406), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 149/244 (61%), Gaps = 12/244 (4%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           IYNV F+SKL+GS +K + +++ GK  F++ LP  L  F++EYKI   +   Y  +NV +
Sbjct: 181 IYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTL 240

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           Y +  ++  FMTC+S  I +A+ +   DI++ ++P E  +EFE    Q I +++  +   
Sbjct: 241 YWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFE----QMINSRL--LEDE 294

Query: 290 ASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGN-ELIKVVLL 348
            +P     D  E GN D RV E+EK+L N  +   T  + +  I   D+G+ +L+K+ L+
Sbjct: 295 QNP----PDTAETGNLDARVEEFEKELKNVDN-STTNHETTELIDLEDEGDTDLMKIALV 349

Query: 349 GSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDD 408
           G DNKK++VNV+ TT   K+AE+YR  KKLP    + L FDH++++ + +I    +ED+D
Sbjct: 350 GEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDED 409

Query: 409 IVEV 412
           ++EV
Sbjct: 410 MIEV 413

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  161 bits (407), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 151/299 (50%), Gaps = 22/299 (7%)

Query: 116 RPAKRS--RNVEHSQEESDTNKFLAEIEQEAERAXXXXXXXXXXXXXXXXXEIGTNIYNV 173
           R  KRS   N+  + E+++  KF  E+++EA R                       +YN+
Sbjct: 184 RTNKRSITANISLAAEDNEDEKFFEELQREAGRTTSTLKEGSPAT--------AKRVYNI 235

Query: 174 GFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREG 233
            F+S LEGS N +INV++ GK  FS  LPIALKT +KEYK++  L   YQ +NV +YR G
Sbjct: 236 KFLSNLEGSLNDKINVKVKGKHAFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNG 295

Query: 234 VEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPV 293
           ++I  FM C+S +I   Y     D+ + +V  +   E+    +Q         S  A+P 
Sbjct: 296 LKILNFMNCNSLHIPLNYEGEVSDVSMTLVSRDREQEYVKTLEQ---------SRHATP- 345

Query: 294 DLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNK 353
           DL  +        F + E+EKDL    S +   +      ++ + G   IK+ L+  DNK
Sbjct: 346 DLSREETSPKIPGFSIEEFEKDLEGFESGESNNLLEDTPQTENNHGT--IKIALMAQDNK 403

Query: 354 KVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEV 412
           K+YVNV+ TTT   L EHYR  K L    +    FD++D+  S  I    +ED DI+EV
Sbjct: 404 KIYVNVRQTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQLSTKIDDLDMEDGDIIEV 462

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  154 bits (389), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 147/261 (56%), Gaps = 20/261 (7%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           +YN+ F SKLEG+ NK + V++ GK +FS  LP AL   +K YKI   + D Y+ +NV +
Sbjct: 195 VYNIKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTL 254

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFE---------------IQ 274
           Y    ++ KFMTC+S +I + + +   DI++ IV  E    FE                +
Sbjct: 255 YWNNAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAK 314

Query: 275 WKQKIETKMKRVSISASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQIS 334
            +Q++E K+++        +      E  N    V E E+  AN   ++E  ++  N + 
Sbjct: 315 ERQEMEMKLEKKRNEREESEFREFEFELRN----VEETEELKANETFMNEHSLREGNSVK 370

Query: 335 KPDDGNE-LIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDI 393
           + + GNE ++K+ L+G DNKK+YVNV+ +T F K+AE+YR  K+LP   ++ L FDHD++
Sbjct: 371 ENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDEL 430

Query: 394 DPSNTIFSAAIEDDDIVEVSV 414
           + +  I    +ED+D+V+V V
Sbjct: 431 NLNECIADQDMEDEDMVDVIV 451

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  151 bits (381), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 141/252 (55%), Gaps = 22/252 (8%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           IYN+ FISKL+GS NK + V++ GK  FS  LP ALK  +  YKI + + + Y ++NV +
Sbjct: 161 IYNIRFISKLDGSINKSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGL 220

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           Y    ++  FMTCDS +I  A+ +   ++++ IV  E   + E   + K   +  ++   
Sbjct: 221 YWNNAKLLNFMTCDSLSIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQEEAKLERQ 280

Query: 290 ASPVDLDSDGIEFGNDDFRVNEYEKDL-----ANAR-SLDETEIQYSNQISKPDDGNELI 343
               D+D        DDF + E+E +L     +NA  SLD          +  +D   L+
Sbjct: 281 EEIKDVDE------GDDFVLKEFEAELRDVAPSNANLSLD----------TDGEDSEPLM 324

Query: 344 KVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAA 403
           K+ L+G DNKK+YVNV+ +T   KL E+Y++ K L    K+ L FDHD++D + T+    
Sbjct: 325 KLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLNETVGDQD 384

Query: 404 IEDDDIVEVSVL 415
           +ED+D+++V V+
Sbjct: 385 MEDEDMIDVVVV 396

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  149 bits (377), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 143/259 (55%), Gaps = 16/259 (6%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           +YN+ F+SKLEG+ NK + V++ GK +FS  LP AL    K YKI   + D Y+++NV +
Sbjct: 201 VYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTL 260

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           Y +  ++  FMTC+S +I + + +   DI+V IV  E    FE   + K++ +   + + 
Sbjct: 261 YWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNFEASLESKLKEEEAALLVK 320

Query: 290 AS---PVDLDSDGIEFGNDDFRVNEYEKDLANA-----RSLDETEIQYS------NQISK 335
                   L+    E    ++R  E+E +L N      R+ +ET I         N +  
Sbjct: 321 EHEEIERKLERKRNEQEESEYR--EFEFELRNVKEKQERTENETVINIKNLQEDDNLLEN 378

Query: 336 PDDGNELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDP 395
             D  +++K+ L G DNKK+YVNV+ +T F K+AE+YR  K+LP   ++ L FDHD +D 
Sbjct: 379 NSDSEKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDM 438

Query: 396 SNTIFSAAIEDDDIVEVSV 414
              I    +ED+D+++V +
Sbjct: 439 HECIADQDMEDEDMIDVII 457

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  149 bits (376), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 88/260 (33%), Positives = 146/260 (56%), Gaps = 18/260 (6%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           +YN+ F+SKLEG+ NK + V++ GK +FS  LP AL   VK YKI   +   Y++ NV +
Sbjct: 201 VYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTL 260

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           Y    ++  FMTC+S NI++ + +   DI+V IV  E    FE   + K++     + + 
Sbjct: 261 YWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVK 320

Query: 290 ASP---VDLDSDGIEFGNDDFRVNEYE-KDLANARSLDETEIQYSNQISKPDDGN----- 340
                   L+    E    ++R  E+E +++   + L+E EI  +   +KP  GN     
Sbjct: 321 QRQEIERKLEKKRNEQEESEYREFEFELRNVKETQELEENEIIIN---TKPLQGNNSLKG 377

Query: 341 ------ELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDID 394
                 ++IK+ L+G DNKK++VNV+ +T   K+AE+YR  K+LP   ++ L FDHD+++
Sbjct: 378 NNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELN 437

Query: 395 PSNTIFSAAIEDDDIVEVSV 414
            S  +    +ED+D+++V V
Sbjct: 438 MSECVADQDMEDEDMIDVIV 457

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  148 bits (373), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 146/259 (56%), Gaps = 16/259 (6%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           +YN+ F+SKLEG+ NK + V++ GK +FS  LP AL   +K YKI   + D Y+++NV +
Sbjct: 199 VYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTL 258

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           Y    ++  FMTC+S +I + + +   DI+V IV  E    FE   + K++ +   + I 
Sbjct: 259 YWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNFEATLESKLKEEEAALLIK 318

Query: 290 ASP---VDLDSDGIEFGNDDFRVNEYEKDLAN---ARSLDETEIQYSNQISKPDDG---- 339
                   L+    E    ++R  E+E +L N    + + E +   + ++ +        
Sbjct: 319 ERQEMERKLEKKRNEQEESEYR--EFESELKNVEETQEIKENDTVMNTKLLQEGGSLSGN 376

Query: 340 ----NELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDP 395
                E++++ L+G DNKK+YV+V+ +T F K+AE+YR  K+LP  T++ L FDHD++D 
Sbjct: 377 SSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDM 436

Query: 396 SNTIFSAAIEDDDIVEVSV 414
           +  I    +ED+D+V+V +
Sbjct: 437 NECIADQDMEDEDMVDVII 455

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  145 bits (365), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 148/270 (54%), Gaps = 36/270 (13%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           +Y++ F+S+L+G+ NK + V++ GK +F   LP  L+  +K Y I   L   Y++DNV +
Sbjct: 183 VYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTL 242

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           Y    ++  FMTC+S NI +A+ +   ++++ I+  E   E E + ++K+  + K   + 
Sbjct: 243 YWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMK 302

Query: 290 ASPVDL--------------DSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISK 335
              +DL              +S   E+      + E+EK+L +A  L ++++        
Sbjct: 303 ---LDLEKEREKEGEKNKPKESKNTEYAK---AIAEFEKELKDATELKDSQVHGGE---- 352

Query: 336 PDDGN-----------ELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKL 384
            +DGN            ++K+ L+G DNKK+YVNV+ +T F KLAE+YR  K+LP   K+
Sbjct: 353 -NDGNMNIDGSDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKI 411

Query: 385 ILSFDHDDIDPSNTIFSAAIEDDDIVEVSV 414
            L FDHD+++   T+    +ED+D++EV +
Sbjct: 412 QLMFDHDELNLEETVGDQDMEDEDMIEVVI 441

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  140 bits (354), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 142/245 (57%), Gaps = 2/245 (0%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           IYN+ FIS LEGS +KR+NV++TG K F + LPI ++TF++ YKI   L   Y    + +
Sbjct: 149 IYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVL 208

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           +R GVE+  F  CDS  I +  +     +++ IV +  A+ ++ ++K+  E++++   + 
Sbjct: 209 FRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSF-LD 267

Query: 290 ASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLG 349
            S ++ + D +E    D +   +EK+L +A  L E      + +    + +  I++ L+ 
Sbjct: 268 ESNIE-EQDPLEQPARDEKFKLFEKELESAPKLAERTDDVIDLLDSDIESSNSIRLTLID 326

Query: 350 SDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDI 409
             NK+  ++V P TTF ++A  Y+ I  L     ++L FD+++++P+ T+ S  +E+DDI
Sbjct: 327 KANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEGLEEDDI 386

Query: 410 VEVSV 414
           +E+ +
Sbjct: 387 LEIKI 391

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  138 bits (347), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 143/251 (56%), Gaps = 11/251 (4%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           IYNV FISK+EG+ +K++ V++ GK  FS  LP ALK F +EYKI   L   Y+++NV +
Sbjct: 217 IYNVRFISKIEGTLDKKVQVKVLGKFPFSKILPPALKAFSEEYKIPNVLKQYYRVNNVTL 276

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIV--PNELASE--FEIQWKQKIETKMKR 285
           Y    ++  FMTC+S NI + Y +   D+E+ ++   NE + E    +  KQ IE  + +
Sbjct: 277 YWNDSKLLNFMTCNSLNIPQIYENEISDVEIIVITKTNEKSYEDKINMSLKQNIEQNLAQ 336

Query: 286 VSISASPV-DLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIK 344
            S     +  L  +  E  +    + E+EK+L           Q +N    P++ +  IK
Sbjct: 337 KSNEIKELRKLKVESFEHNS----IQEFEKELKELSQDGVDTKQTANIDDIPNESH--IK 390

Query: 345 VVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAI 404
           + LL  DNKK+YV V+ +T F +L  ++R  K+L  T ++ L FD++++D + T+    +
Sbjct: 391 IALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDLNETVGDQDM 450

Query: 405 EDDDIVEVSVL 415
           ED+D++EV ++
Sbjct: 451 EDEDMIEVVLI 461

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  131 bits (330), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 141/262 (53%), Gaps = 32/262 (12%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           I+N+ F+SKLEG+ ++ I +++ GK  F++ L   L+  V+E+KI   +  +Y +DNV +
Sbjct: 190 IFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYPVMHQYTVDNVTL 249

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNE-------------LASEFEIQWK 276
           Y  G ++ KFMTCDS  I+    +   +IEV +V                L  E E   K
Sbjct: 250 YWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSKSDEERFEEEERARLLRVEKEAMSK 309

Query: 277 QKIETKMKRVSISASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKP 336
            K+ T     +  A P D      + G  D  +   E D     S  E+E++  ++++  
Sbjct: 310 AKLPT-----TFEADPSD------DNGEADCSIEIIEMD----DSSRESEMKEGSKLAPV 354

Query: 337 D----DGNELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDD 392
           D    D  E+IK+ L+G DN ++YVNV+ +T F K+AE+Y+  K LP   KL L FDH+ 
Sbjct: 355 DLEDEDELEVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEK 414

Query: 393 IDPSNTIFSAAIEDDDIVEVSV 414
           +D + T+    +ED+D++EV +
Sbjct: 415 LDLNETVGDQELEDEDMLEVVI 436

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  130 bits (326), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 90/285 (31%), Positives = 148/285 (51%), Gaps = 29/285 (10%)

Query: 128 QEESDTN-KFLAEIEQEAERAXXXXXXXXXXXXXXXXXEIGTNIYNVGFISKLEGSTNKR 186
           Q E D N +F  EI +EA++                  ++   IYN+ FISKL+G+ NK 
Sbjct: 161 QMEPDENDEFFKEIAKEAKKIPSLTKESTPD-------KLPKRIYNIRFISKLDGTMNKC 213

Query: 187 INVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFN 246
           + V++ GK +F   LP AL   +K Y I + L   Y +DNV +Y    ++  FMTC+S N
Sbjct: 214 VQVKVLGKFQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLN 273

Query: 247 IAEAYAS--SSIDIEVYIVPNELASEFEIQWK---------QKIETKMKRVSIS------ 289
           I +A+ +  +++DIE+    +E+ +E  I  K          K+E   K   I       
Sbjct: 274 IPQAFENEVTNVDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQEKLAKE 333

Query: 290 -ASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLL 348
            A     +    EF ++   V+E +    N    D + +  +N+++  +   +++K+ L+
Sbjct: 334 LAKEEKENEVFEEFEHELENVSELK---TNGYDADASTVNEANELALEEGNADVMKIALV 390

Query: 349 GSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDI 393
           G DNKK++VNV+ TT F K+AE+YR  K+LP   K+ L FDH+++
Sbjct: 391 GQDNKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEEL 435

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  124 bits (312), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 138/267 (51%), Gaps = 24/267 (8%)

Query: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229
           IYN+ F SKL+GS +K++  R+ GK++FS  +   L ++ K YK++      Y+ D V +
Sbjct: 179 IYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTV 238

Query: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289
           Y +  ++  FMTC+S  I   + S    IE+ I+  E   +FE   K ++E   K  +  
Sbjct: 239 YWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTNK 298

Query: 290 ASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPD----DGNE---- 341
                  + GIE   D+   N+ + +       +   I   +Q +  D    DG+E    
Sbjct: 299 TEVGSSKNFGIESQIDE---NKKKYEEYENELNESIPISVPSQGTAEDPMHIDGDEENAV 355

Query: 342 -------------LIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSF 388
                        ++K+ L+G+DNKK++VN + TT F KLAE+Y   +KLP +TK+ L F
Sbjct: 356 DIIGKATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIF 415

Query: 389 DHDDIDPSNTIFSAAIEDDDIVEVSVL 415
           D + ID  + +    +EDDD++EV ++
Sbjct: 416 DDEQIDLDSMVKDQDVEDDDMIEVVII 442

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  120 bits (302), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 132/246 (53%), Gaps = 28/246 (11%)

Query: 169 NIYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVK 228
            +Y V FIS ++G+  K + V+  G   FS  +  AL   ++ +++ + +   YQ ++V 
Sbjct: 151 KVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVV 210

Query: 229 IYREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSI 288
            Y    ++  FMTCD+  + + Y S  ++I+  +VP +  +++    +Q++  + +R   
Sbjct: 211 SYWNRAKVLGFMTCDTLRVPQRYGSDYLEIQ--LVPVKEEAQY---LEQEVFEEPERAPT 265

Query: 289 SASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLL 348
                                 E+E++L +A+ +    +   ++        E+++V L 
Sbjct: 266 PEE---------------DAEEEFERELRDAKEVRAPVVDLESE--------EVLRVALQ 302

Query: 349 GSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDD 408
           G DNKKVYVNVKPTTTF ++ E+YR  K+LP +T++ L+ D + +DP  T+ S  IED+D
Sbjct: 303 GQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKSQDIEDED 362

Query: 409 IVEVSV 414
           ++EV +
Sbjct: 363 MLEVRL 368

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  112 bits (281), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 137/284 (48%), Gaps = 43/284 (15%)

Query: 165 EIGTNIYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQI 224
           EI    YN+ +ISKL GS  +RI  ++ G + F+  LP  L T +K  KI + L   Y+ 
Sbjct: 178 EILNRKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKA 237

Query: 225 DNVKIYREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFE-------IQWKQ 277
           +NV +Y    ++  FM CDS  I + Y +   ++E+ ++  E   +FE       ++ +Q
Sbjct: 238 ENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISELEIILISKEEEQKFEEQFKMQLLEDEQ 297

Query: 278 KIETKMKRVSISASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLD----------ETEI 327
             +  ++  + S  P D+ +            NEYEK+L N  S D            + 
Sbjct: 298 LSQKNIENFNDSNKPFDILNTS---------YNEYEKELENWNSKDFNVTNDVLDVSNDE 348

Query: 328 QYSNQISKPDDGN-----------------ELIKVVLLGSDNKKVYVNVKPTTTFEKLAE 370
             SN +   D  N                  +IK+ L+ +DNKK++VNV+ +T  +KL +
Sbjct: 349 NSSNNVKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVD 408

Query: 371 HYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSV 414
           ++++ K L    ++ + FDHD +   + I    IED+DIVE+ +
Sbjct: 409 YFKKCKNLTSNQRIKVIFDHDVLSLDSMIGDNDIEDEDIVEMII 452

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 102/248 (41%), Gaps = 30/248 (12%)

Query: 166 IGTNIYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQID 225
           + + +Y V F S+LEG+  K + V++ G +     LP  L   V+  ++   L   Y   
Sbjct: 127 VPSPVYRVRFQSQLEGTLGKSVQVKVIGTRPLGTVLPSVLSALVRACRVPQVLQGGYTEG 186

Query: 226 NVKIYREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKR 285
            V +YR G  +  FM C+S  + + + +  ++++V +                +ET    
Sbjct: 187 AVGMYRGGARVLPFMNCNSLGVVQEFENEVLEVDVVL------------RALNLETPASD 234

Query: 286 VSISASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKV 345
           VS               G +     E    +        T    S     P     L+K+
Sbjct: 235 VS--------------GGQEATNGTEAAASVPVPVPAPATAASESPGNPAP----ALMKI 276

Query: 346 VLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIE 405
            LL +DN+++YV V   T   +L E+YR  + LP    L L  D + + P   I    +E
Sbjct: 277 ALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQVSPETHISELDLE 336

Query: 406 DDDIVEVS 413
           D D++E++
Sbjct: 337 DGDVLEIA 344

>TDEL0G03860 Chr7 (705400..706629) [1230 bp, 409 aa] {ON} Anc_6.85
           YLR288C
          Length = 409

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 47/99 (47%), Gaps = 4/99 (4%)

Query: 257 DIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGIEFGNDDFRVNEYEKDL 316
           D ++ I+ NEL    EI W   +++ M++     +P   +++ ++  +DD R+ +     
Sbjct: 258 DAQLKIIVNELDWNLEICWNGPLDSVMQQ----TTPSQTENEQVQAADDDLRIEDSTMSG 313

Query: 317 ANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKV 355
           AN + +D   +  S  + + +  N  +  V +   + KV
Sbjct: 314 ANPQDIDVELVDVSAMVQRAEQENLSVNEVYMRCRDWKV 352

>TPHA0B02820 Chr2 (641721..643034) [1314 bp, 437 aa] {ON} Anc_8.625
           YOR209C
          Length = 437

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 356 YVNVK-----PTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAI 404
           YV V+     P    +K+A HY  + KLP  TK+I     D ++P   I  AAI
Sbjct: 297 YVGVRQDSGDPEEYTKKIAHHYHHVLKLPKDTKVICY--SDSLNPEKAIHYAAI 348

>Ecym_3087 Chr3 complement(160289..165145) [4857 bp, 1618 aa] {ON}
            similar to Ashbya gossypii AAR147W
          Length = 1618

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 302  FGNDDFRVNEYEKDLANARSLDETEIQYS----NQISKPDDGNELIKVVLLGSDNKKVYV 357
            F  DD R+ EYEK++   RS  + + Q +    +Q  K     E+I+ VL  ++N+KV V
Sbjct: 1396 FTEDDLRL-EYEKEMDKRRSRLKYDYQINFELLHQSKKVQQCLEIIRSVLASTENEKVVV 1454

Query: 358  NVKPTTTFEKLAEHY 372
              + T  F+ L EH+
Sbjct: 1455 FSQFTAFFDIL-EHF 1468

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,633,132
Number of extensions: 1851302
Number of successful extensions: 5274
Number of sequences better than 10.0: 59
Number of HSP's gapped: 5435
Number of HSP's successfully gapped: 60
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)