Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_53123.190ON1481486617e-90
AER016C3.190ON1471486071e-81
KLTH0G16082g3.190ON1351463822e-47
TDEL0H033703.190ON1531523823e-47
Kpol_1045.683.190ON1761333773e-46
Kwal_56.231123.190ON1351473701e-45
Suva_4.2393.190ON1651243678e-45
YDL008W (APC11)3.190ON1651243661e-44
ZYRO0A04906g3.190ON1601193632e-44
Smik_4.2243.190ON1651243633e-44
Skud_4.2433.190ON1651243617e-44
SAKL0C10516g3.190ON1441373535e-43
KAFR0A012403.190ON1731533486e-42
TBLA0A002603.190ON1841343462e-41
KLLA0E17711g3.190ON1621423416e-41
CAGL0I04576g3.190ON1491213372e-40
KNAG0J012503.190ON2021433385e-40
NDAI0A065203.190ON2061363386e-40
TPHA0H006403.190ON1801403253e-38
NCAS0I019203.190ON1281122657e-30
TPHA0I005908.799ON1591611183e-07
Kpol_480.258.799ON1571611174e-07
NDAI0K007108.799ON1591611175e-07
Kwal_55.220543.28ON1111011097e-07
KLLA0C14344g8.799ON1518611131e-06
TBLA0D006508.799ON1568611132e-06
KLTH0F19228g3.28ON1101011063e-06
TDEL0B009808.799ON1559611113e-06
Suva_13.4328.799ON1559611113e-06
YMR247C (RKR1)8.799ON1562611113e-06
Skud_13.4198.799ON1564611113e-06
Smik_13.4608.799ON1566611113e-06
KNAG0J005408.799ON1561611113e-06
CAGL0E01567g3.28ON1021011053e-06
SAKL0B06226g8.799ON1557551113e-06
ZYRO0F12760g8.799ON1555611104e-06
KAFR0B036208.799ON1560611104e-06
NCAS0C044803.28ON1091011044e-06
Kpol_1014.163.28ON1071011036e-06
Ecym_20293.28ON1141011037e-06
KNAG0A012803.28ON1141011037e-06
NCAS0C006808.799ON1564601088e-06
KLTH0E13992g8.799ON1550611079e-06
Smik_15.203.28ON1211011021e-05
TBLA0B087103.28ON1221011021e-05
Kwal_27.123278.799ON1574611071e-05
YOL133W (HRT1)3.28ON1211011011e-05
Skud_15.203.28ON1211011012e-05
TDEL0A004703.28ON1181011012e-05
NDAI0G038603.28ON1231011012e-05
Suva_15.263.28ON1221011002e-05
Ecym_74188.799ON1547621052e-05
ADL181W3.28ON10894992e-05
TDEL0C027707.416ON208541023e-05
CAGL0H02651g8.799ON1544611033e-05
ZYRO0C03058g3.28ON116101984e-05
KLLA0E07151g3.28ON110101975e-05
SAKL0C13178g3.28ON13892985e-05
ABL058C8.799ON1546611017e-05
KAFR0A019902.542ON560471008e-05
CAGL0K02563g2.542ON58659972e-04
KAFR0C017803.28ON11892923e-04
Suva_8.422.542ON58553937e-04
YHL010C (ETP1)2.542ON58553938e-04
Skud_8.352.542ON58553929e-04
Smik_8.322.542ON58553929e-04
Ecym_72442.542ON53249920.001
TPHA0P014703.28ON11192870.001
ZYRO0B02244g2.542ON56353900.002
Smik_2.1963.279ON18589880.002
TDEL0B061701.389ON147076890.002
SAKL0H15686g8.317ON59944890.002
KLLA0F25740g2.542ON51746890.002
AGL079C2.542ON50647880.003
NCAS0A145507.416ON26354870.004
TDEL0A031802.542ON56747870.004
NCAS0A125502.542ON57247860.006
TBLA0I019603.279ON18458840.006
Kwal_55.21206singletonON27561850.007
Kpol_1045.247.416ON18654840.007
KLLA0E07019g7.416ON27955840.008
KNAG0C056602.542ON50747850.008
KNAG0A074303.405ON10231810.008
TBLA0F032803.405ON55551850.008
Kpol_1002.82.542ON55847850.009
ZYRO0B03938g7.416ON18358830.009
TBLA0A039008.317ON69886840.011
NDAI0B018202.542ON62549840.011
NCAS0A082803.279ON11851800.013
KLTH0D07150g2.542ON54064820.020
AGR034W3.279ON15941800.022
Kwal_27.107237.416ON22954800.024
KNAG0H035102.157ON55150810.027
SAKL0D02354g8.808ON33137800.027
AGL217W8.808ON41438800.034
KAFR0B034208.761ON103666800.035
KLLA0C15697g3.405ON30472790.040
YDR143C (SAN1)8.317ON61037790.043
TPHA0C042502.542ON55649790.043
NCAS0G025202.157ON51837790.044
NDAI0G052001.389ON158635790.046
SAKL0H17116gsingletonON54444790.047
TPHA0B036501.389ON157644790.047
KLTH0F18502gsingletonON26763780.047
Suva_4.3023.279ON15035770.050
KLTH0C06094g7.416ON19554780.050
Skud_2.1863.279ON17889770.051
Kpol_505.182.157ON58550790.052
YBR062C3.279ON18035770.055
TPHA0F018402.157ON52150780.057
NCAS0A04680singletonON27456770.066
CAGL0H10274g3.279ON17551760.066
YOL138C (RTC1)3.22ON134155780.072
Skud_4.4028.317ON61237770.075
KAFR0F007402.157ON51050770.076
ZYRO0B16258g2.157ON57937770.079
Ecym_26583.279ON15944750.083
Ecym_54453.405ON32146770.085
ZYRO0E06996g3.279ON17265750.091
ABR104W3.405ON32869760.092
YKL034W (TUL1)2.545ON75831770.099
KAFR0I020901.389ON146643770.10
Suva_2.3048.317ON62459760.11
ZYRO0G13376g8.808ON44535760.12
Smik_4.3878.317ON63437760.12
TBLA0G023102.542ON67447750.14
Ecym_26848.808ON38632750.14
SAKL0E10824g2.157ON47550750.16
Kpol_1023.322.411ON117860750.16
TBLA0D004407.416ON29353740.17
Kpol_1036.668.317ON66828750.17
KAFR0B055808.288ON112055750.18
ACR267C2.157ON46750740.18
Kwal_56.239008.317ON58939740.19
Smik_15.163.22ON132655740.20
CAGL0B02013g8.288ON112041740.20
KLLA0F23892g2.157ON51850730.24
NDAI0A074503.279ON17345720.25
Kwal_26.80902.542ON52047730.28
TDEL0D034603.279ON14435710.28
CAGL0A03432g2.411ON115163730.29
SAKL0A09746g2.542ON54847730.29
TBLA0B005606.45ON49227730.30
Ecym_54282.157ON47450720.32
KLTH0E09834g2.157ON47950720.33
TBLA0B012602.157ON88545730.34
Kwal_47.179042.157ON47050720.35
NDAI0G026308.317ON66140720.35
KLLA0F17479g2.411ON111486720.36
KNAG0A070902.545ON76231720.37
KNAG0G023908.317ON68846720.39
SAKL0E04488g2.411ON112748720.40
TDEL0G042506.45ON51729720.41
Suva_11.1892.545ON75831720.41
NDAI0K018102.545ON76234720.41
Smik_5.2617.416ON26960710.45
KAFR0B014602.545ON76131710.46
Skud_5.2637.416ON27260710.48
TBLA0B026708.808ON47836710.50
TBLA0H002303.22ON133342710.53
Ecym_72412.545ON75857710.54
KLLA0F18458g3.279ON14058690.56
ADL186C3.22ON136153710.59
CAGL0G03553g7.416ON21053700.60
Kpol_1002.72.545ON75432700.61
Smik_11.2132.545ON75931700.62
NDAI0A014907.416ON29754700.63
KLTH0G12408g8.317ON60336700.66
NCAS0B009908.808ON39236700.68
Kwal_56.225226.45ON51344700.68
Suva_5.2377.416ON26660690.68
TDEL0B052002.157ON52432700.70
Skud_11.1922.545ON75831700.72
KNAG0E027406.45ON55635700.72
ZYRO0E05632g2.545ON76531700.76
KLTH0D07216g2.545ON74731700.77
Kwal_26.80992.545ON75031700.77
Suva_15.223.22ON133655690.87
KLTH0C05258g3.279ON15244680.89
TBLA0I014902.545ON75031690.89
Kwal_27.105463.279ON10444660.93
TPHA0C042602.545ON75731691.0
SAKL0A09812g2.545ON75131691.1
Suva_14.2232.157ON58050681.1
Kpol_1052.193.279ON10347651.1
CAGL0L01947g2.545ON75731681.1
Kpol_1035.506.45ON60127681.2
YER116C (SLX8)7.416ON27460681.2
TPHA0A039903.279ON17547671.2
Skud_15.163.22ON133255681.3
NCAS0B069902.157ON52141681.3
Ecym_42508.317ON65765681.3
KAFR0A052406.45ON55327681.3
Skud_14.2162.157ON53050681.4
CAGL0E01441g8.317ON71731681.4
TDEL0B063402.545ON76227681.5
Suva_13.4158.761ON102849681.5
TBLA0C013301.389ON145234681.5
NCAS0A047602.545ON76131671.5
YNL116W (DMA2)2.157ON52250671.5
KLLA0F25674g2.545ON75731671.5
KNAG0A060302.411ON115060671.6
KLLA0E04071g8.317ON70427671.6
KAFR0C004603.279ON15774661.6
Smik_14.2122.157ON52950671.6
TDEL0F044408.317ON55432671.7
KLTH0G18150g1.389ON155434671.7
NCAS0D020106.45ON51027671.8
KLTH0C04664g8.808ON30632661.8
YMR231W (PEP5)8.761ON102971671.8
CAGL0E02299g6.45ON54527671.8
TPHA0C008508.317ON78128671.8
ZYRO0C07194g6.45ON55827671.9
NDAI0F027702.157ON55434671.9
ZYRO0C17424g3.405ON27348662.1
KLLA0C05874g6.45ON55327662.1
TPHA0A033403.405ON38427662.1
TDEL0F02870na 1ON26055662.2
YOL013C (HRD1)6.45ON55127662.2
KAFR0K019807.416ON29361662.2
Smik_15.1576.45ON55027662.4
SAKL0E01958g6.45ON52427662.5
SAKL0D03058g3.279ON15558642.5
SAKL0H22638g4.129ON126126662.6
KNAG0C034107.416ON21953652.8
KLLA0F12166g1.389ON152831662.8
Skud_15.1486.45ON54827652.8
TPHA0K007007.416ON20848642.9
TPHA0J015708.761ON101848652.9
Suva_15.1596.45ON55027652.9
Suva_1.694.129ON127132653.1
Kpol_1038.203.22ON131353653.3
Kwal_55.220763.22ON128642653.4
Kpol_1072.552.157ON42041643.5
NCAS0C033108.317ON57034653.5
Kwal_27.104198.808ON30032643.6
Smik_13.4398.761ON103071653.7
Skud_13.4008.761ON103071653.7
SAKL0F13046g7.416ON26954643.8
Smik_8.1932.157ON41633643.9
ACL019C6.45ON57527644.0
Skud_8.1762.157ON41333644.1
AFR220W2.411ON108564644.1
Suva_15.3112.157ON26933634.2
SAKL0B08976g3.405ON32247644.2
KAFR0D016708.808ON35741634.4
SAKL0D08272g1.389ON149148644.5
Suva_15.1158.808ON41136634.5
SAKL0D10890g1.448ON26565634.5
CAGL0B05049g1.389ON147048644.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_5312
         (148 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   259   7e-90
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   238   1e-81
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   151   2e-47
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   151   3e-47
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   149   3e-46
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   147   1e-45
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   145   8e-45
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   145   1e-44
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   144   2e-44
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   144   3e-44
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   143   7e-44
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   140   5e-43
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   138   6e-42
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   137   2e-41
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   135   6e-41
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   134   2e-40
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   134   5e-40
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   134   6e-40
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   129   3e-38
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   106   7e-30
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    50   3e-07
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    50   4e-07
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    50   5e-07
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    47   7e-07
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    48   1e-06
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    48   2e-06
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    45   3e-06
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    47   3e-06
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    47   3e-06
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    47   3e-06
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    47   3e-06
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    47   3e-06
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    47   3e-06
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    45   3e-06
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    47   3e-06
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    47   4e-06
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    47   4e-06
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       45   4e-06
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    44   6e-06
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    44   7e-06
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    44   7e-06
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    46   8e-06
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    46   9e-06
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    44   1e-05
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    44   1e-05
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    46   1e-05
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    44   1e-05
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    44   2e-05
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    44   2e-05
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    44   2e-05
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    43   2e-05
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    45   2e-05
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    43   2e-05
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    44   3e-05
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    44   3e-05
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    42   4e-05
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    42   5e-05
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    42   5e-05
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    44   7e-05
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    43   8e-05
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    42   2e-04
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    40   3e-04
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    40   7e-04
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    40   8e-04
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    40   9e-04
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    40   9e-04
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    40   0.001
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    38   0.001
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    39   0.002
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    39   0.002
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    39   0.002
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    39   0.002
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    39   0.002
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    39   0.003
NCAS0A14550 Chr1 complement(2867437..2868228) [792 bp, 263 aa] {...    38   0.004
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    38   0.004
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    38   0.006
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    37   0.006
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    37   0.007
Kpol_1045.24 s1045 (56271..56831) [561 bp, 186 aa] {ON} (56273.....    37   0.007
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    37   0.008
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    37   0.008
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    36   0.008
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    37   0.008
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    37   0.009
ZYRO0B03938g Chr2 complement(327333..327884) [552 bp, 183 aa] {O...    37   0.009
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    37   0.011
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     37   0.011
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    35   0.013
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    36   0.020
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    35   0.022
Kwal_27.10723 s27 (468604..469293) [690 bp, 229 aa] {ON} YER116C...    35   0.024
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    36   0.027
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    35   0.027
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    35   0.034
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    35   0.035
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    35   0.040
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    35   0.043
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    35   0.043
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    35   0.044
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    35   0.046
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    35   0.047
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    35   0.047
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    35   0.047
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    34   0.050
KLTH0C06094g Chr3 (531296..531883) [588 bp, 195 aa] {ON} some si...    35   0.050
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    34   0.051
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    35   0.052
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    34   0.055
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    35   0.057
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      34   0.066
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    34   0.066
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    35   0.072
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    34   0.075
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    34   0.076
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    34   0.079
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    33   0.083
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    34   0.085
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    33   0.091
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    34   0.092
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    34   0.099
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    34   0.10 
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    34   0.11 
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    34   0.12 
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    34   0.12 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    33   0.14 
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    33   0.14 
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    33   0.16 
Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {...    33   0.16 
TBLA0D00440 Chr4 (107763..108644) [882 bp, 293 aa] {ON} Anc_7.41...    33   0.17 
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    33   0.17 
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    33   0.18 
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    33   0.18 
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    33   0.19 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   0.20 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   0.20 
KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]...    33   0.24 
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    32   0.25 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    33   0.28 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    32   0.28 
CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} simil...    33   0.29 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    33   0.29 
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    33   0.30 
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    32   0.32 
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    32   0.33 
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    33   0.34 
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    32   0.35 
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     32   0.35 
KLLA0F17479g Chr6 complement(1601287..1604631) [3345 bp, 1114 aa...    32   0.36 
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    32   0.37 
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    32   0.39 
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    32   0.40 
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    32   0.41 
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    32   0.41 
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    32   0.41 
Smik_5.261 Chr5 complement(404258..405067) [810 bp, 269 aa] {ON}...    32   0.45 
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    32   0.46 
Skud_5.263 Chr5 (425336..426154) [819 bp, 272 aa] {ON} YER116C (...    32   0.48 
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    32   0.50 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    32   0.53 
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    32   0.54 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    31   0.56 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    32   0.59 
CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {O...    32   0.60 
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    32   0.61 
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    32   0.62 
NDAI0A01490 Chr1 (329693..330586) [894 bp, 297 aa] {ON} Anc_7.41...    32   0.63 
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    32   0.66 
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    32   0.68 
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    32   0.68 
Suva_5.237 Chr5 complement(371065..371865) [801 bp, 266 aa] {ON}...    31   0.68 
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    32   0.70 
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    32   0.72 
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...    32   0.72 
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    32   0.76 
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    32   0.77 
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    32   0.77 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    31   0.87 
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    31   0.89 
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    31   0.89 
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    30   0.93 
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    31   1.0  
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    31   1.1  
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    31   1.1  
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    30   1.1  
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    31   1.1  
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    31   1.2  
YER116C Chr5 complement(395348..396172) [825 bp, 274 aa] {ON}  S...    31   1.2  
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    30   1.2  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    31   1.3  
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    31   1.3  
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    31   1.3  
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...    31   1.3  
Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116...    31   1.4  
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    31   1.4  
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    31   1.5  
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    31   1.5  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    31   1.5  
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    30   1.5  
YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}  DMA2Ubiqu...    30   1.5  
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    30   1.5  
KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {...    30   1.6  
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    30   1.6  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    30   1.6  
Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116...    30   1.6  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    30   1.7  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    30   1.7  
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...    30   1.8  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    30   1.8  
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    30   1.8  
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    30   1.8  
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    30   1.8  
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    30   1.9  
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    30   1.9  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    30   2.1  
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    30   2.1  
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    30   2.1  
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      30   2.2  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    30   2.2  
KAFR0K01980 Chr11 complement(407855..408736) [882 bp, 293 aa] {O...    30   2.2  
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    30   2.4  
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...    30   2.5  
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    29   2.5  
SAKL0H22638g Chr8 complement(1968593..1972378) [3786 bp, 1261 aa...    30   2.6  
KNAG0C03410 Chr3 (669679..670338) [660 bp, 219 aa] {ON} Anc_7.41...    30   2.8  
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    30   2.8  
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    30   2.8  
TPHA0K00700 Chr11 (144606..145232) [627 bp, 208 aa] {ON} Anc_7.4...    29   2.9  
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    30   2.9  
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    30   2.9  
Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W ...    30   3.1  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    30   3.3  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    30   3.4  
Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON} (1262...    29   3.5  
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     30   3.5  
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    29   3.6  
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    30   3.7  
Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR23...    30   3.7  
SAKL0F13046g Chr6 complement(1026073..1026882) [810 bp, 269 aa] ...    29   3.8  
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    29   3.9  
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...    29   4.0  
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    29   4.1  
AFR220W Chr6 (830237..833494) [3258 bp, 1085 aa] {ON} Syntenic h...    29   4.1  
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    29   4.2  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    29   4.2  
KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {O...    29   4.4  
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    29   4.5  
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    29   4.5  
SAKL0D10890g Chr4 (904673..905470) [798 bp, 265 aa] {ON} similar...    29   4.5  
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    29   4.6  
Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, ...    29   4.7  
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    28   4.9  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    29   5.1  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    29   5.3  
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    29   5.6  
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    29   5.7  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    29   5.9  
TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4....    29   5.9  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    28   6.3  
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    29   6.3  
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    28   6.5  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    28   6.6  
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    28   7.0  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    28   7.6  
AEL104W Chr5 (431236..434493) [3258 bp, 1085 aa] {ON} Syntenic h...    28   7.7  
KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {O...    28   8.5  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    28   8.6  

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  259 bits (661), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 125/148 (84%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCP 60
           MQLQIKNVQCVASWYWDVPKELKRDLH         VCGICRASYNGTCPNCKLPGETCP
Sbjct: 1   MQLQIKNVQCVASWYWDVPKELKRDLHEGEDEDDEDVCGICRASYNGTCPNCKLPGETCP 60

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ 120
           LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ
Sbjct: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ 120

Query: 121 QXXXXXXXXXXXXXXDQEDVMIDQEFIR 148
           Q              DQEDVMIDQEFIR
Sbjct: 121 QNVVSVSGVNAAGGVDQEDVMIDQEFIR 148

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  238 bits (607), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 115/148 (77%), Positives = 121/148 (81%), Gaps = 1/148 (0%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCP 60
           MQLQI N+QCVASWYWDVPKELKRD           VCGICR SYNGTCPNCKLPGETCP
Sbjct: 1   MQLQINNIQCVASWYWDVPKELKRDSPVYEDEDEEDVCGICRGSYNGTCPNCKLPGETCP 60

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ 120
           LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR+GIRINEPH++KFEKVLMKARQ
Sbjct: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHRDKFEKVLMKARQ 120

Query: 121 QXXXXXXXXXXXXXXDQEDVMIDQEFIR 148
           Q              DQ+DV+IDQEFIR
Sbjct: 121 Q-SVVSVAGANPVGPDQDDVIIDQEFIR 147

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  151 bits (382), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 90/146 (61%), Gaps = 14/146 (9%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCP 60
           MQL+ K V  V SW WD+P +   D           +CGICR SYNGTCP CK PG+ CP
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDDDADREIGDED----LCGICRVSYNGTCPGCKYPGDNCP 56

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ 120
           L++G C+HNFHVHCI QWL T T+KGLCPMCRQ FSL+ G+ INE   EK   +L++ R 
Sbjct: 57  LVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEKLANLLLQPRP 116

Query: 121 QXXXXXXXXXXXXXXDQEDVMIDQEF 146
                          D +D+M+DQEF
Sbjct: 117 ----------AALAADDQDMMMDQEF 132

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  151 bits (382), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXX--XXXXXXVCGICRASYNGTCPNCKLPGET 58
           M+++++ V  V +W W +PKE  +D H           VCGICRASYN TCP CK PG+ 
Sbjct: 1   MKVKLREVHSVFAWTWHIPKE-SQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDG 59

Query: 59  CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK- 117
           CPL+VG C+HNFHVHCIY+WL+T+TS+GLCPMCRQ F L+ G+ IN+    KF+++  K 
Sbjct: 60  CPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQ 119

Query: 118 --ARQQXXXXXXXXXXXXXXDQEDVMIDQEFI 147
              RQQ              DQ+D M+DQ  I
Sbjct: 120 WQTRQQEFGDQQDPETNPLEDQDDPMMDQGLI 151

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  149 bits (377), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (66%), Gaps = 12/133 (9%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKR-----------DLHXXX-XXXXXXVCGICRASYNGT 48
           M++++K V CV SW W +PK               D+H          VCGICRAS+N T
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHK 108
           CPNCK PG+ CPL++G C HNFHVHCIY+WL+TSTS+GLCPMCRQ F L+ G+ IN+ H 
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 109 EKFEKVLMKARQQ 121
           E+F ++ +K +Q+
Sbjct: 121 ERFRELAIKRQQE 133

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  147 bits (370), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 93/147 (63%), Gaps = 14/147 (9%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCP 60
           M+++ K V  V SW WD+P +   D           +CGICR SYNGTCP C+ PG+ CP
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDDNAD----KEIGDEDLCGICRVSYNGTCPGCRFPGDNCP 56

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ 120
           L++G C+HNFHVHCI QWL T+T+KGLCPMCRQ FSL+ G+ INE   +   K+L++++ 
Sbjct: 57  LVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLLQSQP 116

Query: 121 QXXXXXXXXXXXXXXDQEDVMIDQEFI 147
                          + +D+M+DQEFI
Sbjct: 117 ----------AALTTEDQDMMMDQEFI 133

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  145 bits (367), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 86/124 (69%), Gaps = 3/124 (2%)

Query: 1   MQLQIKNVQCVASWYWDVPK---ELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGE 57
           M+++I  V  V +W W +P+   E + +           VCGICRASYNGTCP+CK PG+
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTNENDDDEDVCGICRASYNGTCPSCKFPGD 60

Query: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK 117
            CPL++G CHHNFH HCIY+WL+TS SKGLCPMCRQ F L+ G+ IN+ H  KF +V+ +
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAHIRKFVEVVSR 120

Query: 118 ARQQ 121
            R++
Sbjct: 121 RREE 124

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  145 bits (366), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 84/124 (67%), Gaps = 3/124 (2%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXX---XXXXXXVCGICRASYNGTCPNCKLPGE 57
           M+++I  V  V +W W +P     D              VCGICRASYNGTCP+CK PG+
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60

Query: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK 117
            CPL++G CHHNFH HCIY+WL+T TSKGLCPMCRQ F L+ G+ IN+ H +KF +++ +
Sbjct: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120

Query: 118 ARQQ 121
            R++
Sbjct: 121 RREE 124

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  144 bits (363), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 84/119 (70%), Gaps = 2/119 (1%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCP 60
           M++ I+ V  V +W W +PK+ K             VCGICRASYN TCP+CK PG+ C 
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKDNKD--GSLEADDDDDVCGICRASYNATCPSCKYPGDECS 58

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKAR 119
           L+VG C+HNFHVHCIY+WL+T+TSKGLCPMCRQ F L+ G+ IN+   EKF+++ ++ R
Sbjct: 59  LVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQLEKFKELQLRKR 117

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  144 bits (363), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 85/124 (68%), Gaps = 3/124 (2%)

Query: 1   MQLQIKNVQCVASWYWDVPK---ELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGE 57
           M+++I  V  V +W W +P    E   +           VCGICRASYNGTCP+CK PG+
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDKLNDNDENEDVCGICRASYNGTCPSCKFPGD 60

Query: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK 117
            CPL++G CHHNFH HCIY+WL+T TSKGLCPMCRQ F L+ G+ IN+ H +KF +++ +
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120

Query: 118 ARQQ 121
            R++
Sbjct: 121 RREE 124

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  143 bits (361), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 85/124 (68%), Gaps = 3/124 (2%)

Query: 1   MQLQIKNVQCVASWYWDVPK---ELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGE 57
           M+++I  V  V +W W +P    E+  +           VCGICRASYNGTCP+CK PG+
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVPNENDEDEDVCGICRASYNGTCPSCKYPGD 60

Query: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK 117
            CPL++G CHHNFH HCIY+WL+TS SKGLCPMCRQ F L+ G+ IN+ H +KF  ++ +
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120

Query: 118 ARQQ 121
            R++
Sbjct: 121 RREE 124

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  140 bits (353), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 88/137 (64%), Gaps = 5/137 (3%)

Query: 11  VASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCPLIVGSCHHNF 70
           V SW W +P++               VCGICR SYNGTCP+CK PG+ CPL+VG C+HNF
Sbjct: 11  VCSWSWHIPRDGTH--QHEAADTEEDVCGICRVSYNGTCPSCKYPGDECPLVVGECNHNF 68

Query: 71  HVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQQXXXXXXXXX 130
           HVHCI QWL+T+TS+GLCPMCRQ FSL+ G+ IN+   + F K+L K  +          
Sbjct: 69  HVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQLDHFAKLLNKVNR---AGATELA 125

Query: 131 XXXXXDQEDVMIDQEFI 147
                +++D+M++Q+F+
Sbjct: 126 NAGLAEEQDLMMEQDFL 142

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  138 bits (348), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 91/153 (59%), Gaps = 15/153 (9%)

Query: 1   MQLQIKNVQCVASWYWDV---PKELKRDLHX---XXXXXXXXVCGICRASYNGTCPNCKL 54
           M++ +K +  V +W WD+     E K D++            VCGICRASYNGTCP+CK+
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKSDVYSVLDKYRSEKDDVCGICRASYNGTCPSCKI 60

Query: 55  PGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKV 114
           PG  CPLIVGSC+HNFH HCI++WLNT  SKGLCPMCRQ F L   + IN  + +KFE +
Sbjct: 61  PGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSDYLQKFEVL 120

Query: 115 LMKARQQXXXXXXXXXXXXXXDQEDVMIDQEFI 147
             K R++              D+ED  ID   I
Sbjct: 121 ARKNRER---------RALNVDEEDNGIDNMII 144

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  137 bits (346), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 91/134 (67%), Gaps = 13/134 (9%)

Query: 1   MQLQIKNVQCVASWYWDVP----------KELKRDLHX--XXXXXXXXVCGICRASYNGT 48
           M++++K +  V +W WD+P          +EL  D             VCGICR +YN T
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHK 108
           CPNCK+PG+ CPL+VG+C HNFHVHCIY+WL+T+TSKGLCPMCRQ F L++G+ +N+  +
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 109 EKFEKVLMK-ARQQ 121
           + F+ + +K ARQ+
Sbjct: 121 DVFKSLELKQARQR 134

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  135 bits (341), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 85/142 (59%), Gaps = 21/142 (14%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXX---------------------VCG 39
           M++++ +V  V++W WD+PK+L +  H                              VCG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 40  ICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRD 99
           ICR  Y+ TCP+C  PG  CP+++G C+HNFHVHCI QWL+T TSKGLCP+CRQ F LR 
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 100 GIRINEPHKEKFEKVLMKARQQ 121
            + IN+ H ++F+K+LM  RQ 
Sbjct: 121 NVLINKMHHDEFQKLLMSVRQH 142

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  134 bits (337), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 81/121 (66%), Gaps = 1/121 (0%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCP 60
           M++++  V  V +W WD+PK   R L          VCGICRASY+  CPNC+ PGE+C 
Sbjct: 1   MRIELTEVHGVFNWVWDIPKNEDR-LDESMADEDEDVCGICRASYHAPCPNCRYPGESCA 59

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMKARQ 120
           +++G C HNFHVHCI +W++T TSKGLCPMCRQ F L    +INEPH   F+++ +K  +
Sbjct: 60  IVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHIPLFKEIEIKRYR 119

Query: 121 Q 121
           Q
Sbjct: 120 Q 120

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  134 bits (338), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 84/143 (58%), Gaps = 22/143 (15%)

Query: 1   MQLQIKNVQCVASWYWD----------------------VPKELKRDLHXXXXXXXXXVC 38
           M+L IK V  V +W WD                      V K    + +         VC
Sbjct: 1   MKLDIKRVNPVFTWSWDTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDVC 60

Query: 39  GICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR 98
           GICRASYNGTCP+CK+PG++CPL+ G CHH+FH HCI++WL+T+TSKGLCPMCRQ F L 
Sbjct: 61  GICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQLN 120

Query: 99  DGIRINEPHKEKFEKVLMKARQQ 121
             + IN P+ EKFE +    R++
Sbjct: 121 SKLPINRPYLEKFESITKAIRER 143

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  134 bits (338), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 80/136 (58%), Gaps = 15/136 (11%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRD---------------LHXXXXXXXXXVCGICRASY 45
           M+++++N+  + +W WD+PK L                             VCGICRASY
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 46  NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINE 105
           NGTCPNCK PG  CPL++G C+HNFH HCIYQWL T TSKGLCPMCRQ F L+    +N 
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNATVNT 120

Query: 106 PHKEKFEKVLMKARQQ 121
            H   F+++ +  R +
Sbjct: 121 DHLGAFKELAITTRAR 136

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  129 bits (325), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 86/140 (61%), Gaps = 20/140 (14%)

Query: 1   MQLQIKNVQCVASWYWDVPK---ELKRDLHXXXXXXXXXV----------------CGIC 41
           M++QIKNV  V +W W +PK   ++K+D H         V                CGIC
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHDQKVKKD-HNNSIVSGSDVDHQEQNSDDEDDEEDFCGIC 59

Query: 42  RASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGI 101
           RAS+   CPNCK P + CP+++G C HNFHVHCI++WL T  S+GLCPMCRQ F LR G+
Sbjct: 60  RASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGV 119

Query: 102 RINEPHKEKFEKVLMKARQQ 121
            IN+ H   F+++++K +++
Sbjct: 120 VINDLHYVTFKELILKRQKE 139

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  106 bits (265), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 66/112 (58%), Gaps = 8/112 (7%)

Query: 1   MQLQIKNVQCVASWYWDVPKELKRDLH--------XXXXXXXXXVCGICRASYNGTCPNC 52
           M+L+++ V  V  W WD+  E ++  +                 VCGICRA YN  CP+C
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNAVCPSC 60

Query: 53  KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRIN 104
             PG TCP++VG+C H FHVHC+  WL T+ ++G CPMCRQ F+L    R+N
Sbjct: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC ++ +    + KLP + CP    +C++ FH  C+Y+W  +S +   CP+CR   +L
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWFRSSNNN-TCPLCRSEIAL 1589

Query: 98   R 98
            R
Sbjct: 1590 R 1590

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CPMCR   ++
Sbjct: 1517 CAICYSILHAV--DRKLPTKTCP----TCRNKFHGACLYKWFR-SSGNNTCPMCRSEIAI 1569

Query: 98   R 98
            R
Sbjct: 1570 R 1570

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR   +L
Sbjct: 1537 CAICYSVLHAV--DRKLPTKTCP----TCKNKFHGACLYKWFK-SSGNNTCPLCRSEIAL 1589

Query: 98   R 98
            R
Sbjct: 1590 R 1590

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 42/101 (41%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + ++K    VA W WD+  E                C ICR      C  C+    T   
Sbjct: 24  KFEVKKWTAVAFWSWDIAVE---------------NCAICRNHIMEPCIQCQPTAMTDTD 68

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C+H FH+HCI +WL T   +  CP+  Q +S 
Sbjct: 69  NECVAAWGTCNHAFHLHCINKWLQT---RNACPLDNQPWSF 106

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC    +    + KLP + CP    +C++ FH  C+Y+W   S+    CP+CR  F+L
Sbjct: 1464 CAICYYVLHAI--DRKLPTKVCP----TCNNRFHGACLYKWFK-SSGNNTCPLCRGEFNL 1516

Query: 98   R 98
            R
Sbjct: 1517 R 1517

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C++ +H  C+Y+W   S+    CPMCR     
Sbjct: 1514 CAICYSILHAV--DRKLPSKTCP----TCNNKYHGACLYKWFR-SSGNNTCPMCRSEIPF 1566

Query: 98   R 98
            R
Sbjct: 1567 R 1567

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + ++K    VA W WD+  E                C ICR      C  C+    T   
Sbjct: 23  RFEVKKWTAVAFWSWDIAVE---------------NCAICRNHIMEPCIQCQPTAMTDTD 67

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C+H FH+HCI +WL T   +  CP+  Q +  
Sbjct: 68  NECVAAWGACNHAFHLHCINKWLQT---RNACPLDNQTWQF 105

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWFR-SSGNNTCPLCRSEIPF 1557

Query: 98   R 98
            R
Sbjct: 1558 R 1558

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFR-SSGNNTCPLCRSEIPF 1557

Query: 98   R 98
            R
Sbjct: 1558 R 1558

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1508 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFR-SSGNNTCPLCRSEIPF 1560

Query: 98   R 98
            R
Sbjct: 1561 R 1561

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1510 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFR-SSGNNTCPLCRSEIPF 1562

Query: 98   R 98
            R
Sbjct: 1563 R 1563

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1512 CAICYSILHAV--DRKLPSKTCP----TCKNRFHGACLYKWFR-SSGNNTCPLCRSEIPF 1564

Query: 98   R 98
            R
Sbjct: 1565 R 1565

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1507 CAICYSILHAV--DRKLPNKTCP----TCKNRFHGACLYKWFR-SSGNNTCPLCRNEIPF 1559

Query: 98   R 98
            R
Sbjct: 1560 R 1560

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar
          to uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
          RING-box protein
          Length = 102

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 42/101 (41%), Gaps = 23/101 (22%)

Query: 2  QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
          + QIK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 15 KFQIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 59

Query: 59 --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C    G+C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 60 NECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHL 97

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
            C IC +  +    + KLP +TCP    +C++ FH  C+Y+W   S+    CPMCR
Sbjct: 1503 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWFR-SSGNNTCPMCR 1550

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1501 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGSCLYKWFR-SSGNNTCPLCRGEIPF 1553

Query: 98   R 98
            R
Sbjct: 1554 R 1554

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1506 CAICYSILHAI--DRKLPSKTCP----TCKNRFHGACLYKWFR-SSGNNTCPLCRSEIPF 1558

Query: 98   R 98
            R
Sbjct: 1559 R 1559

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 22  KFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 66

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 67  NECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQL 104

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 44.3 bits (103), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 20  RFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPNAMTETD 64

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 65  NECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQL 102

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 44.3 bits (103), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + QIK    VA W WD+  E                C ICR      C  C+    T   
Sbjct: 27  KFQIKKWTAVAFWSWDIAVE---------------NCAICRNHIMEPCIQCQPNAMTDTD 71

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C+H FH+HCI +WL T   +  CP+  + +  
Sbjct: 72  NECVAAWGTCNHAFHLHCINKWLLT---RNACPLDNKTWQF 109

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 44.3 bits (103), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + QIK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 27  KFQIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 71

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 72  NECVAAWGACGHAFHLHCINKWIKT---RDACPLDNQPWQL 109

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TCP    +C + FH  C+Y+W   S+    CP+CR    L
Sbjct: 1510 CAICYSILHAV--DRKLPTKTCP----TCKNKFHGACLYKWFR-SSGNNTCPLCRSEIPL 1562

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP + CP    +C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1496 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWFR-SSGNNTCPLCRSEIPF 1548

Query: 98   R 98
            R
Sbjct: 1549 R 1549

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 34  RFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 78

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 79  NECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + Q+K    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 35  RFQVKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 79

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 80  TDCVAAWGTCNHAFHLHCINKWIKT---REACPLDNQPWQL 117

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP + CP    +C++ FH  C+Y+W   S+    CP+CR     
Sbjct: 1520 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWFR-SSGNNTCPLCRSEIPF 1572

Query: 98   R 98
            R
Sbjct: 1573 R 1573

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 34  RFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 78

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 79  NECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 34  RFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 78

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 79  NECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 31  RFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPLAMTDTD 75

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G+C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 76  NECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHL 113

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 36  RFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 80

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 81  NECVAAWGVCNHAFHLHCINKWIQT---RDACPLDNQPWQL 118

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 35  RFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDTD 79

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 80  NECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 117

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 38   CGICRASYNGTCP-NCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
            C IC   Y+   P + KLP + CP    +C++ FH  C+Y+W  +S +   CP+CR    
Sbjct: 1493 CAIC---YSILHPVDRKLPTKVCP----TCNNRFHGACLYKWFRSSGNNS-CPLCRSEIP 1544

Query: 97   LR 98
             R
Sbjct: 1545 FR 1546

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 39/94 (41%), Gaps = 23/94 (24%)

Query: 2  QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
          + QIK    VA W WD+  E                C ICR      C  C+    T   
Sbjct: 21 KFQIKKWIAVAFWSWDIAVE---------------NCAICRNHIMEPCIQCQPNAMTDTE 65

Query: 59 --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPM 90
            C    G+C+H FH+HCI +WL T   +  CP+
Sbjct: 66 NECVAAWGTCNHAFHLHCINKWLLT---RNACPL 96

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTS---TSKGLCPMCRQAFSLRD 99
           CP C  P E    ++  C H F V C++Q LN+S      GLC +CR++ ++RD
Sbjct: 139 CPICFDPPENS--VITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCRKSVAIRD 190

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP +TC     +C + FH  C+Y+W   S+    CP+CR   + 
Sbjct: 1490 CAICYSILHAV--DRKLPTKTC----STCKNKFHGACLYKWFR-SSGNNTCPLCRSEINF 1542

Query: 98   R 98
            R
Sbjct: 1543 R 1543

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 41/101 (40%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET--- 58
           + +IK    VA W WD+  +                C ICR      C  C+    T   
Sbjct: 29  KFEIKKWTAVAFWSWDIAVD---------------NCAICRNHIMEPCIECQPMAMTDTD 73

Query: 59  --CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 74  NECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 111

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 23/101 (22%)

Query: 2   QLQIKNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPG----- 56
             +I     VA W WD+  +                C ICR      C NC+        
Sbjct: 23  NFEITKWTAVAFWSWDIDVD---------------NCAICRNHIMEPCVNCQQEATFNSE 67

Query: 57  ETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
             C    G C+H FH+HCI QW+    S+ +CP+  + + L
Sbjct: 68  HECVAAWGECNHAFHLHCITQWIK---SRNVCPLDNKPWKL 105

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 37/92 (40%), Gaps = 23/92 (25%)

Query: 11  VASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET-----CPLIVGS 65
           VA W WD+  E                C ICR      C  C+    T     C    G+
Sbjct: 60  VAFWSWDIAVE---------------NCAICRNHIMEPCIQCQPTAMTDTDNECVAAWGT 104

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C+H FH+HCI +WL T   +  CP+  Q +  
Sbjct: 105 CNHAFHLHCINKWLQT---RNACPLDNQPWQF 133

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
            C IC +  +    + KLP + CP    +C + FH  C+Y+W   S+    CP+CR     
Sbjct: 1492 CAICYSILH--VVDRKLPSKVCP----TCSNRFHGACLYKWFK-SSGNNTCPLCRGEIPF 1544

Query: 98   R 98
            R
Sbjct: 1545 R 1545

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           TCP C  ++  ET  LI   C H FH  C+ +W N+      CP+CR
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCR 281

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 9/59 (15%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR-QAFSL-RDGIR 102
           TCP C  ++  ET  LI   C H FH  C+ +W N+      CP+CR  +F L RD +R
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRLSSFRLSRDTLR 299

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 37/92 (40%), Gaps = 23/92 (25%)

Query: 11  VASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKL-----PGETCPLIVGS 65
           VA W WD+  +                C ICR      C  C+      P   C    G 
Sbjct: 40  VAFWSWDIAVD---------------NCAICRNHIMEPCIECQPKAMTDPDNECVAAWGV 84

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 85  CNHAFHLHCINKWIKT---RDACPLDNQPWQL 113

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR 98
           TCP C  ++  ET  L+   C H FH  C+ +W N+      CP+CR + SLR
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS-SLR 285

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR 98
           TCP C  ++  ET  L+   C H FH  C+ +W N+      CP+CR + SLR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS-SLR 285

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR 98
           TCP C  ++  ET  L+   C H FH  C+ +W N+      CP+CR + SLR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS-SLR 285

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR 98
           TCP C  ++  ET  L+   C H FH  C+ +W N+      CP+CR + SLR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS-SLR 285

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQA 94
           TCP C  ++  +T  LI  +C H FH  C+ QW       G CP+CR +
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCRYS 277

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 23/92 (25%)

Query: 11  VASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGET-----CPLIVGS 65
           VA W WD+  +                C ICR      C  C+    T     C +   +
Sbjct: 33  VAFWSWDIAVD---------------NCAICRNHIMEPCIECQPMAMTETDNECVVAWAA 77

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C+H FH+HCI +W+ T   +  CP+  Q + L
Sbjct: 78  CNHAFHLHCINKWIKT---RDACPLDNQPWQL 106

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR 98
           TCP C  ++  +T  LI   C H FH  C+ +W N+      CP+CR + SLR
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRYS-SLR 279

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 40/89 (44%), Gaps = 20/89 (22%)

Query: 6   KNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCPLIVG- 64
           KN  C  S+   +P+  KR L           C IC  +Y        L  E  PL+V  
Sbjct: 88  KNAGCPDSFASSLPRINKRKLKVTDN------CSICYTNY--------LEDEY-PLVVEL 132

Query: 65  -SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
             CHH F + C+  WL+ ST+   CP+CR
Sbjct: 133 PHCHHKFDLECLSVWLSRSTT---CPLCR 158

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 38.9 bits (89), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 23/76 (30%)

Query: 58   TCPLIVGS--------CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL---------RDG 100
            +CP+ +G         C H F   CI+ WL    S   CPMC+ + S+          D 
Sbjct: 1153 SCPICLGKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMCKTSTSIMEVYNFKFQNDD 1209

Query: 101  IRINEPHKEK---FEK 113
              +NEP  E    FEK
Sbjct: 1210 AEVNEPQNESSQDFEK 1225

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 38.9 bits (89), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKE 109
           C H F   CIYQW     S   CP+CR     R+G+  + P +E
Sbjct: 247 CGHRFGRMCIYQWTKEHNS---CPICRAEIVGREGLNRDLPDEE 287

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 49  CPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           CP C  KL  E   L+   C H FH  C+ QW N     G CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQWKN-----GNCPVCR 255

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           TCP C  ++  +T  LI  +C H FH  C+ +W +     G CP+CR
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKWKD-----GRCPVCR 252

>NCAS0A14550 Chr1 complement(2867437..2868228) [792 bp, 263 aa] {ON}
           Anc_7.416 YER116C
          Length = 263

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLRD 99
           CP C  P ET   ++  C H F   C++Q +N+S +    G C +CR+   LRD
Sbjct: 197 CPICMDPPETA--LIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKEVRLRD 248

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           TCP C  ++  +T  LI   C H FH  C+ +W N+      CP+CR
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 274

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           TCP C  +L  ET  LI   C H FH  C+ +W N+      CP+CR
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 278

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 37.0 bits (84), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 14/58 (24%)

Query: 37  VCGICRASYNGTCPNCKLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +C ICR         CK   +  PLI+   +C H F + CI  WL  ++S   CP+CR
Sbjct: 114 ICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS---CPICR 159

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 12/61 (19%)

Query: 37  VCGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
            C IC+  +N     C L           C+H FH +CI QW+    +   CP+C++++S
Sbjct: 119 TCAICQEDFNKLNNVCLL----------GCNHVFHTYCIDQWI--CRNSACCPLCKRSYS 166

Query: 97  L 97
           L
Sbjct: 167 L 167

>Kpol_1045.24 s1045 (56271..56831) [561 bp, 186 aa] {ON}
           (56273..56833) [561 nt, 187 aa]
          Length = 186

 Score = 37.0 bits (84), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTS---TSKGLCPMCRQAFSLRD 99
           CP C  P ET   ++  C H +   C++  +N+S     +G+C +CR+  S RD
Sbjct: 120 CPICFDPPETA--MIAPCGHIYCNRCLFPMVNSSRVGKKQGVCALCRKGISFRD 171

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS----KGLCPMCRQAFSLRD 99
           CP C  P E    +V  C H F   C+Y  +N+S       GLC +CR+   L+D
Sbjct: 212 CPICMEPPEAA--LVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKLQD 264

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
            CP C  ++  ET  LI   C H FH  C+ +W N+      CP+CR
Sbjct: 170 ACPVCLERMDSETTGLITIPCQHTFHCQCLNRWKNSK-----CPVCR 211

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa]
          {ON} Anc_3.405 YPR093C
          Length = 102

 Score = 35.8 bits (81), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 66 CHHNFHVHCIYQWLNTSTS---KGLCPMCRQ 93
          CHH FH  CI +W  T+T    + LCP CR+
Sbjct: 29 CHHKFHSDCIRKWHTTTTGEIRRPLCPFCRE 59

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa]
          {ON} Anc_3.405 YPR093C
          Length = 555

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 6/51 (11%)

Query: 51 NCKLPGETCPLIVGS---CHHNFHVHCIYQWLNTSTSKGL-CPMCRQAFSL 97
          NC +  E    I+GS   C HNFH +CI QW    TSK L CP+CR+  ++
Sbjct: 4  NCPICLEDITDILGSLKVCQHNFHFNCIRQW--HLTSKSLECPVCRRVSNI 52

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           TCP C  +L   T  LI   C H FH  C+ +W N+      CP+CR
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 275

>ZYRO0B03938g Chr2 complement(327333..327884) [552 bp, 183 aa] {ON}
           some similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 183

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLRDGIRI 103
           CP C  P +T   ++  C H F V C++Q +N+S +    G C +CR    L+D IR+
Sbjct: 118 CPICFEPPDTA--VMTPCGHIFCVACLFQMVNSSRTHRKSGNCALCRSEVKLKD-IRL 172

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 37.0 bits (84), Expect = 0.011,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 15/86 (17%)

Query: 40  ICRASYNGTCPNCKLPGET-------CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +  +S + T P    P E         P+ + SC H F   C+Y+W   S  K  CP+CR
Sbjct: 305 VAPSSMDSTIPTSSTPDENKKHEYHNSPVQL-SCKHIFCRSCLYEW---SKLKNSCPLCR 360

Query: 93  QAF----SLRDGIRINEPHKEKFEKV 114
           +      ++ + I+ +    E FE++
Sbjct: 361 KKIVETPTVENNIQNDANSNEAFERI 386

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQA 94
           TCP C  ++  ET  LI   C H FH  C+ +W ++      CP+CR +
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCRYS 310

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON}
          Anc_3.279 YBR062C
          Length = 118

 Score = 35.4 bits (80), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 46 NGTCPNC--KLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
          N  CP C  K   +  PLIV    C+H F + CI  WL+ S +   CP+CR
Sbjct: 46 NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCR 93

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 14/64 (21%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR-------QAFSLR 98
           TCP C  +L  E   L    C H FH  C+ +W ++      CP+CR       ++  LR
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDSR-----CPVCRYSGLKVTKSSLLR 300

Query: 99  DGIR 102
            G+R
Sbjct: 301 QGVR 304

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 35.4 bits (80), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 60  PLIV--GSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLR 98
           PL+V   +C H F + C+  WL+ ST+   CPMCR    +R
Sbjct: 103 PLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDVLVR 140

>Kwal_27.10723 s27 (468604..469293) [690 bp, 229 aa] {ON} YER116C
           (SLX8) -  [contig 33] FULL
          Length = 229

 Score = 35.4 bits (80), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTS---TSKGLCPMCRQAFSLRD 99
           CP C  P E    +V  C H F   C++Q +N+S   +  G C +CR+    RD
Sbjct: 164 CPICFEPPEAA--LVTPCGHVFCTECLFQMVNSSRGQSRAGHCALCRRGVHFRD 215

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 35.8 bits (81), Expect = 0.027,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H HC+ + +  S  + +CP CR A  L
Sbjct: 451 CSICLSKIKPCQAIFISPCSHSWHFHCVRRLVMLSYPQFVCPNCRSACDL 500

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
          similar to uniprot|Q12161 Saccharomyces cerevisiae
          YOL054W PSH1 Nuclear protein putative RNA polymerase II
          elongation factor isolated as Pob3p/Spt16p- binding
          protein
          Length = 331

 Score = 35.4 bits (80), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCRQAFSL 97
          ++ SC HN+   CI  WLN + +  L CP CR + S+
Sbjct: 5  VMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSV 41

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 35.4 bits (80), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 60 PLIVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCRQAFS 96
          P++ G C HN+   CI  WLN ++S  L CP CR + +
Sbjct: 48 PVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRSSIT 84

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
           YMR231W
          Length = 1036

 Score = 35.4 bits (80), Expect = 0.035,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 46  NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGL--CPMCRQAFSLRDGIRI 103
           N TC  CKLP    P++   C H +H +C+ +  +T  ++ +  CP C     L    R+
Sbjct: 933 NQTCFMCKLPMHL-PMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKC--IVELETSNRL 989

Query: 104 NEPHKE 109
           +E  KE
Sbjct: 990 SEAQKE 995

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 35.0 bits (79), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 15/72 (20%)

Query: 37  VCGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR-QAF 95
           +CGIC  S N T       GE  P     C H +HV CI +W +  ++   CP CR ++ 
Sbjct: 4   ICGICLESMNET-----DQGELLP-----CEHRYHVSCIRKW-HLYSNDFKCPTCRKESK 52

Query: 96  SLR---DGIRIN 104
           SLR   D I I+
Sbjct: 53  SLRRKHDDIEID 64

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 35.0 bits (79), Expect = 0.043,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 3/37 (8%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIR 102
           C H F   CIY+W     S   CP+CRQ  S   G++
Sbjct: 257 CGHIFGRECIYKWSRLENS---CPLCRQKISESVGVQ 290

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 35.0 bits (79), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQA 94
           TCP C  K+      LI   C H FH  C+ +W N+      CP+CR  
Sbjct: 240 TCPVCLEKMDSLVTGLITIPCSHTFHCQCLDKWKNSK-----CPVCRHT 283

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 35.0 bits (79), Expect = 0.044,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           + +  C H++H HCI + +  S  + +CP CR A  L
Sbjct: 442 IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCRSACDL 478

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 35.0 bits (79), Expect = 0.046,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 4/35 (11%)

Query: 66   CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDG 100
            C H F   CIY WL T T   +CP+C+   SL DG
Sbjct: 1282 CGHFFCEDCIYDWLQTRT---ICPICKHKASL-DG 1312

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 35.0 bits (79), Expect = 0.047,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKE 109
           C H F   CIYQW   + S   CP+CR     R+G+    P  +
Sbjct: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGLIQRSPDDQ 271

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 35.0 bits (79), Expect = 0.047,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 11/44 (25%)

Query: 58   TCPLIVG--------SCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
            TCP+ +G        SC H F  +CI+ WL  +++   CP+C++
Sbjct: 1270 TCPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSN---CPLCKR 1310

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 38  CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C IC+  +N          E   + V  C H FH HCI +W+  ++    CP+C++++SL
Sbjct: 110 CVICQEQFN----------ELNNIRVLGCSHIFHSHCIDRWICRNS--ACCPLCKRSYSL 157

Query: 98  RDG 100
             G
Sbjct: 158 PVG 160

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 34.3 bits (77), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 60  PLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           PL+V    CHH F + C+  WL+ ST+   CP+CR
Sbjct: 92  PLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 123

>KLTH0C06094g Chr3 (531296..531883) [588 bp, 195 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 195

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTS---TSKGLCPMCRQAFSLRD 99
           CP C  P E    +V  C H F   C++Q +N+S    S G C +CR+    +D
Sbjct: 130 CPICFDPPEAA--LVTPCGHVFCTECLFQMVNSSRGQRSAGHCALCRRDVRFKD 181

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 34.3 bits (77), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 20/89 (22%)

Query: 6   KNVQCVASWYWDVPKELKRDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCPLIVG- 64
           KN  C  S+   +P+  ++ L+          C IC  +Y        L  E  PL+V  
Sbjct: 81  KNTGCPDSFAASLPRINRKKLNSTDN------CSICYTNY--------LEDEY-PLVVEL 125

Query: 65  -SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
             C+H F + C+  WL+ ST+   CP+CR
Sbjct: 126 PHCNHRFDLECLSVWLSRSTT---CPLCR 151

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 35.0 bits (79), Expect = 0.052,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H HCI + +  S  + +CP CR +  L
Sbjct: 502 CSICLSAIKPCQAIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDL 551

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 34.3 bits (77), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 60  PLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           PL+V    CHH F + C+  WL+ ST+   CP+CR
Sbjct: 122 PLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 153

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 34.7 bits (78), Expect = 0.057,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H HCI + +  S  + +CP CR +  L
Sbjct: 413 CSICLSAIKPCQAIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDL 462

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 34.3 bits (77), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 38  CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           C ICR +Y+          ET    + +C H+FH  CI  WL  ++   LCP+CR 
Sbjct: 210 CPICRIAYSDDF-------ETEITCLPNCSHHFHFECIKLWLQKNS---LCPLCRD 255

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 33.9 bits (76), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 46  NGTCPNC--KLPGETCPLIV--GSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           + TCP C      +  PL+V    C H F   C+  WL  +T+   CPMCR
Sbjct: 101 DDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTT---CPMCR 148

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 34.7 bits (78), Expect = 0.072,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWL---NTSTSKGLCP 89
            C  C+   N +C  C+ P +   +++  C H  H  CI +W    N     G CP
Sbjct: 1283 CDSCKKK-NTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 34.3 bits (77), Expect = 0.075,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIR 102
           C H F   CIY+W     S   CP+CR   S   GI+
Sbjct: 256 CGHIFGRECIYKWSKLENS---CPLCRHKISESAGIQ 289

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 34.3 bits (77), Expect = 0.076,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H HCI + +  S  + +CP CR +  L
Sbjct: 403 CSICLSKIKPCQAIFISPCSHSWHFHCIRRLVMVSYPQFVCPNCRASCDL 452

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 34.3 bits (77), Expect = 0.079,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           + +  C H++H  CI + + TS  + +CP CR A  L
Sbjct: 506 MFISPCSHSWHFQCIRRLVMTSYPQFVCPNCRCACDL 542

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 33.5 bits (75), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 52  CKLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           C    ++ PL+V   +C+H F + CI  WL+ S++   CPMCR 
Sbjct: 95  CVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST---CPMCRN 135

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
          similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 34.3 bits (77), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 4/46 (8%)

Query: 49 CPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
          CP C   +      LI   C H FH+ CI +W ++  S   CP CR
Sbjct: 9  CPICWDSMADNVAKLI--PCQHEFHLSCIRKWYHSRISDRTCPNCR 52

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 33.5 bits (75), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 46  NGTCPNC--KLPGETCPLI--VGSCHHNFHVHCIYQWLNTSTSKGLCPMCR-QAFSLRDG 100
           + +CP C      +  PL+  +  C+H F + CI  WL+ STS   CP+CR    S + G
Sbjct: 100 DDSCPICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS---CPLCRDDVMSHKPG 156

Query: 101 IRINE 105
           I  ++
Sbjct: 157 IDTSQ 161

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 33.9 bits (76), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 9/69 (13%)

Query: 49  CP--NCKLPGETCPLIVGS---CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRI 103
           CP   C +  E+ P  VG    C H +H+ CI +W +  +    CP+CR   S    + +
Sbjct: 13  CPQDECSICWESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCRTEAS----VLV 68

Query: 104 NEPHKEKFE 112
           +  H+ K +
Sbjct: 69  DTDHEVKID 77

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 34.3 bits (77), Expect = 0.099,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C+H FH  C+  W+N    K  CP+CR
Sbjct: 725 MVTPCNHVFHTSCLENWMNY---KLQCPVCR 752

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 34.3 bits (77), Expect = 0.10,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 11/43 (25%)

Query: 59   CPLIVGS--------CHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
            CP+ + +        C H F  HCI+ WL    +K +CP+C++
Sbjct: 1151 CPICLNTIYMGSIIKCGHFFCKHCIFSWLK---NKSVCPICKK 1190

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 33.9 bits (76), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 12/59 (20%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRI---------NEPHKEKFEKVL 115
           C H F   C+Y+W     S   CP+CR   S   G+ +         NE   E+  +VL
Sbjct: 275 CGHVFGRECLYKWSRLENS---CPLCRHKISESAGVPVQQDTDEVAANEAAFERIRRVL 330

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
          {ON} some similarities with uniprot|Q12161
          Saccharomyces cerevisiae YOL054W PSH1 Nuclear protein
          putative RNA polymerase II elongation factor isolated
          as Pob3p/Spt16p- binding protein
          Length = 445

 Score = 33.9 bits (76), Expect = 0.12,   Method: Composition-based stats.
 Identities = 10/35 (28%), Positives = 21/35 (60%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
          ++  C HN+   C+  W ++++++  CP CR + S
Sbjct: 41 VMTQCGHNYCYDCLSSWFDSNSNELSCPQCRASIS 75

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 33.9 bits (76), Expect = 0.12,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 3/37 (8%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIR 102
           C H F   CIY+W     S   CP+CR   S   G++
Sbjct: 267 CGHIFGRECIYKWSRLENS---CPLCRHKISENAGVQ 300

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +CP C  ++      LI   C H FH  C+ +W N+      CP+CR
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKWKNSK-----CPICR 323

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa]
          {ON} similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCR 92
          ++ SC HN+  +CI  WLN + +  L CP CR
Sbjct: 5  VMTSCGHNYCYYCISNWLNNNNATELNCPQCR 36

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 33.5 bits (75), Expect = 0.16,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  C+ + + TS  + +CP CR +  L
Sbjct: 389 CSICLSKIKPCQAIFISPCSHSWHYQCVRRLVMTSYPQFVCPNCRSSCDL 438

>Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {ON}
           complement(68737..72273) [3537 nt, 1179 aa]
          Length = 1178

 Score = 33.5 bits (75), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 49  CPNCKL-PGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGL---CPMCRQAFSLRDGIRIN 104
           CP C   P +   +I   C H F   C+ ++ +    K L   CP CRQ  S    +++N
Sbjct: 925 CPICTTEPIDANNIIFTECGHCFCESCLQEYFDFQVQKKLETKCPNCRQIISTNRVLKLN 984

>TBLA0D00440 Chr4 (107763..108644) [882 bp, 293 aa] {ON} Anc_7.416
           YER116C
          Length = 293

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 5/53 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTS---TSKGLCPMCRQAFSLR 98
           CP C  P ET   +V  C H F   C +Q LN S   T  G C +CR   +L+
Sbjct: 226 CPICLEPPETS--VVTPCGHVFCAGCAFQMLNQSRARTRHGHCALCRNNVNLQ 276

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 33.5 bits (75), Expect = 0.17,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 3/28 (10%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           CHH F   C+Y+W   +  +  CP+CR 
Sbjct: 264 CHHIFGRECLYKW---TRHENTCPLCRH 288

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_8.288
            YDR128W
          Length = 1120

 Score = 33.5 bits (75), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 8/55 (14%)

Query: 48   TCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCP-----MCRQAFSL 97
            +C  C L  +    I GSC H  H  C  +W    T+ G CP     +C + + L
Sbjct: 1068 SCNYCNLKVKGTAFICGSCQHILHSSCAKEWW---TTGGECPAGCGCICPEMYDL 1119

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 33.1 bits (74), Expect = 0.18,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  CI + + T   + +CP CR +  L
Sbjct: 368 CSICLCKIKPCQAIFISPCSHSWHYQCIRRLVMTQYPQFICPNCRSSCDL 417

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 33.1 bits (74), Expect = 0.19,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 3/39 (7%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRIN 104
           C H F   CI QW N   +   CP+CR      DG+  N
Sbjct: 227 CSHVFGRECIRQWTNLHNT---CPICRANIVGADGLNNN 262

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 33.1 bits (74), Expect = 0.20,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 4/55 (7%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWL---NTSTSKGLCP 89
            C  C+   N  C  C+ P +   +++  C H  H  CI +W    N     G CP
Sbjct: 1268 CDSCKKK-NTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 33.1 bits (74), Expect = 0.20,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 3/41 (7%)

Query: 49   CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCP 89
            C  C L  +    + G+C H  H+ C  +W N S     CP
Sbjct: 1069 CTYCHLKAQYSIFVCGNCQHVLHLKCSKEWWNVSKE---CP 1106

>KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]
           {ON} some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 518

 Score = 32.7 bits (73), Expect = 0.24,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  + +  C H++H  CI Q ++ +  + +CP CR    L
Sbjct: 392 CSICLSKIKACQAVFIAPCSHSWHFKCIRQLVSKTYPQFVCPNCRAVCDL 441

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 5/45 (11%)

Query: 52  CKLPGETCPLI--VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQA 94
           CK   +  PL+  +  C H F + CI  WL+ S +   CP+CR +
Sbjct: 109 CKFLEDKYPLVAELPHCGHRFDLECISVWLSKSDT---CPLCRDS 150

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           TCP C  +L  E   L    C H FH  C+ +W +       CP+CR
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWGDNR-----CPVCR 267

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 5/35 (14%)

Query: 60  PLIV--GSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           PL+V    C H+F + C+  W + STS   CP+CR
Sbjct: 88  PLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCR 119

>CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032w RAD5
          Length = 1151

 Score = 32.7 bits (73), Expect = 0.29,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 13/63 (20%)

Query: 38  CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGL---CPMCRQA 94
           C IC A           P E+   +V  C H F   C+ ++ N    K L   CP CR+ 
Sbjct: 897 CSICTAE----------PIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRRD 946

Query: 95  FSL 97
            +L
Sbjct: 947 INL 949

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 48  TCPNC--KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +CP C  ++  +   LI   C H FH  C+ +W ++      CP+CR
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKWKDSR-----CPVCR 277

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 32.7 bits (73), Expect = 0.30,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H++C+  W+  S +   CPMCR
Sbjct: 352 CGHILHMNCLKNWMERSQT---CPMCR 375

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 32.3 bits (72), Expect = 0.32,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  CI + + T   + +CP CR +  L
Sbjct: 377 CSICLCKIKPCQAIFISPCSHSWHYQCIRRLVMTQYPQFVCPNCRSSCDL 426

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 32.3 bits (72), Expect = 0.33,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  C+ + + T+  + +CP CR +  L
Sbjct: 398 CSICLSKIKPCQAIFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDL 447

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 32.7 bits (73), Expect = 0.34,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C  C    + C  I +  C H++H HCI + +     + +CP CR
Sbjct: 769 CSICLSKIKPCQAIFISPCSHSWHFHCIRRLVMLQYPQFVCPNCR 813

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 32.3 bits (72), Expect = 0.35,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  C+ + + T+  + +CP CR +  L
Sbjct: 389 CSICLSKIKPCQAIFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDL 438

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 32.3 bits (72), Expect = 0.35,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 3/40 (7%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINE 105
           C H F   C+Y+W     S   CP+CR      D  R +E
Sbjct: 246 CDHIFGRECLYKWSKLENS---CPLCRHKIIESDSERASE 282

>KLLA0F17479g Chr6 complement(1601287..1604631) [3345 bp, 1114 aa]
           {ON} similar to uniprot|P32849 Saccharomyces cerevisiae
           YLR032W RAD5 Single-stranded DNA-dependent ATPase
           involved in postreplication repair
          Length = 1114

 Score = 32.3 bits (72), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 33/86 (38%), Gaps = 12/86 (13%)

Query: 24  RDLHXXXXXXXXXVCGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTST 83
           RD+H          C IC          C  P     + +  C H F   C+ +++    
Sbjct: 844 RDIHSASEQLPSFECAICTTE-------CIEP--LSAVSITECLHTFCEPCLAEYIEFQQ 894

Query: 84  SKGL---CPMCRQAFSLRDGIRINEP 106
           +K L   CP CR   S  + +++ EP
Sbjct: 895 NKKLSINCPYCRMPISEANVLKLKEP 920

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 32.3 bits (72), Expect = 0.37,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C+H FH  C+  W+   + K  CP+CR
Sbjct: 729 MVTPCNHIFHTECLENWM---SYKLQCPVCR 756

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 32.3 bits (72), Expect = 0.39,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL--RDGIRINEPHKE 109
           C H F   CI++W +   S   CP+CR+A  +  R+    N P  E
Sbjct: 340 CGHIFGRDCIFKWSHLENS---CPLCRKAIVVIDRNDASQNNPLNE 382

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 32.3 bits (72), Expect = 0.40,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGL---CPMCRQAFSLRDGIRINE 105
           +I   C H F  HC+ ++++  T K L   CP CR++   +  + + E
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKE 935

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 32.3 bits (72), Expect = 0.41,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 3/29 (10%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQA 94
           C H  H++C+  W+  S +   CP+CR A
Sbjct: 347 CGHVLHLYCLKNWMERSQT---CPICRLA 372

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 32.3 bits (72), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C+H FH  C+  W+   + K  CP+CR
Sbjct: 725 MVTPCNHVFHTSCLENWM---SYKLQCPVCR 752

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 32.3 bits (72), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAF 95
           +V  C+H FH  C+  W+     K  CP+CR + 
Sbjct: 729 MVTPCNHIFHTECLENWMGY---KLQCPVCRSSL 759

>Smik_5.261 Chr5 complement(404258..405067) [810 bp, 269 aa] {ON}
           YER116C (REAL)
          Length = 269

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 43  ASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLRD 99
           A+ +  CP C  P ET  + +  C H F   C++Q +N+S +    G C +CR    L+D
Sbjct: 196 AAKDYRCPICFEPPETALMTL--CGHVFCCSCLFQMVNSSRTCRQFGHCALCRSKVYLKD 253

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 32.0 bits (71), Expect = 0.46,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C+H FH  C+  W+   + K  CP+CR
Sbjct: 728 MVTPCNHIFHTSCLENWM---SYKLQCPVCR 755

>Skud_5.263 Chr5 (425336..426154) [819 bp, 272 aa] {ON} YER116C
           (REAL)
          Length = 272

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 43  ASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLRD 99
           A+ +  CP C  P ET  + +  C H F   C++Q +N+S +    G C +CR    L+D
Sbjct: 198 AAKDYRCPICFDPPETALMTL--CGHVFCCSCLFQMVNSSRTCRQFGHCALCRSKVYLKD 255

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON}
          Anc_8.808 YOL054W
          Length = 478

 Score = 32.0 bits (71), Expect = 0.50,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCRQAFS 96
          +V  C H+F   C+  W ++S   GL CP CR + +
Sbjct: 41 MVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSIT 76

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 32.0 bits (71), Expect = 0.53,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWL 79
            C  CR   N  C  C+ P +   + +  C H FH  C  QW 
Sbjct: 1275 CDSCRKP-NTLCVICEQPMKKLAICLLECGHEFHFECGQQWF 1315

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 32.0 bits (71), Expect = 0.54,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 5/57 (8%)

Query: 38  CGICRASYNGTCPNCKLPGETCP--LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C IC +       +     +T P   +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 699 CAICMSEVAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWM---SYKLQCPVCR 752

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 31.2 bits (69), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 14/58 (24%)

Query: 37  VCGICRASYNGTCPNCKLPGETCPLI--VGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
            C IC+         C    +  PL+  V  C+H F + C+  WL  + +   CPMCR
Sbjct: 70  TCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHT---CPMCR 115

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 32.0 bits (71), Expect = 0.59,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQW-LNTSTSKGLCP 89
            C  CR   N  C  C+ P +   L   +C H  H  C+ QW L+   S+  CP
Sbjct: 1304 CDSCRKP-NSLCVYCEQPMKKLALSFLNCGHGGHFECLQQWFLDEGMSE--CP 1353

>CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {ON}
           weakly similar to uniprot|P40072 Saccharomyces
           cerevisiae YER116c YEU6
          Length = 210

 Score = 31.6 bits (70), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLR 98
           CP C  P +    I+  C H F   C++Q +N S +    G+C +CR+  +++
Sbjct: 146 CPICFEPPDVA--IMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMK 196

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 31.6 bits (70), Expect = 0.61,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 3/32 (9%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
            ++  C+H FH  C+  W+     K  CP+CR
Sbjct: 720 FMITPCNHVFHTQCLENWMGY---KLQCPVCR 748

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 31.6 bits (70), Expect = 0.62,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C+H FH  C+  W+   + K  CP+CR
Sbjct: 726 MVTPCNHVFHTPCLENWM---SYKLQCPVCR 753

>NDAI0A01490 Chr1 (329693..330586) [894 bp, 297 aa] {ON} Anc_7.416
           YER116C
          Length = 297

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSK---GLCPMCRQAFSLRD 99
           CP C  P +    ++  C H F   C++Q +N+S +    G C +CR +  L+D
Sbjct: 227 CPICMDPPDEA--LLTPCGHVFCCDCLFQMVNSSRTNRRDGHCALCRSSVKLKD 278

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 31.6 bits (70), Expect = 0.66,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 3/36 (8%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGI 101
           C H F   CI QW N   +   CP+CR      DG+
Sbjct: 231 CGHIFGRECIRQWTNEHNT---CPICRARIVGADGL 263

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa]
          {ON} Anc_8.808 YOL054W
          Length = 392

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCRQAFS 96
          ++ SC HN+   C+  W++T++ K L CP CR   +
Sbjct: 41 MMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDIT 76

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score = 31.6 bits (70), Expect = 0.68,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 8/44 (18%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C N K   +  P     C+H  H+ C+  W+  S +   CP+CR
Sbjct: 329 CTNAKQKPKRLP-----CNHCLHLGCLKSWMERSQT---CPICR 364

>Suva_5.237 Chr5 complement(371065..371865) [801 bp, 266 aa] {ON}
           YER116C (REAL)
          Length = 266

 Score = 31.2 bits (69), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 43  ASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLRD 99
           A+ +  CP C  P ET  + +  C H F   C++Q +N+S +    G C +CR    L+D
Sbjct: 192 AAKDYRCPICFDPPETALMTL--CGHVFCCSCLFQMVNSSRTCRQFGHCALCRSKVYLKD 249

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 31.6 bits (70), Expect = 0.70,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           + +  C H +H  CI + + TS  + +CP CR
Sbjct: 449 MFISPCSHCWHFQCIRRLVMTSYPQFVCPNCR 480

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 31.6 bits (70), Expect = 0.72,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 725 MVTPCDHVFHTSCLENWM---SYKLQCPVCR 752

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score = 31.6 bits (70), Expect = 0.72,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDG 100
           C H  H  C+  W+  S +   CP+CR     +DG
Sbjct: 400 CGHMLHFSCLKNWMERSQT---CPICRVPVFDKDG 431

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 31.6 bits (70), Expect = 0.76,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 732 MVTPCAHIFHTQCLENWM---SYKLQCPVCR 759

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 31.6 bits (70), Expect = 0.77,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 714 MITPCSHIFHTQCLESWM---SYKLQCPVCR 741

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 31.6 bits (70), Expect = 0.77,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 717 MITPCSHIFHTQCLESWM---SYKLQCPVCR 744

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 31.2 bits (69), Expect = 0.87,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 4/55 (7%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSK---GLCP 89
            C  C+   N  C  C+ P +   +++  C H  H  CI +W      +   G CP
Sbjct: 1278 CDSCKKR-NSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWFLNEKERECPGGCP 1331

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 30.8 bits (68), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query: 52  CKLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           C    +T PL+V    C H F + C+  WL+ S +   CP+CR 
Sbjct: 88  CGYLDDTHPLVVKLPHCSHRFDLECVAVWLSKSRT---CPLCRD 128

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 31.2 bits (69), Expect = 0.89,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 717 MITPCNHIFHTTCLENWM---SYKLQCPVCR 744

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa]
          {ON} YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 30.0 bits (66), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query: 52 CKLPGETCPLIV--GSCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
          C    +  PL+V    C+H F + C+  WL+ S +   CP+CR 
Sbjct: 40 CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPLCRD 80

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 31.2 bits (69), Expect = 1.0,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C+H FH  C+  W+     K  CP+CR
Sbjct: 724 MVTPCNHIFHTACLENWMGY---KLQCPVCR 751

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 718 MVTPCGHIFHTQCLESWM---SYKLQCPVCR 745

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 30.8 bits (68), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  C+ + +  S  + +CP CR +  L
Sbjct: 491 CSICLCKIKPCQAIFISPCAHSWHFRCVRRLVMLSYPQFICPNCRSSCDL 540

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
          (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 52 CKLPGETCPLI--VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
          C    +  PLI  +  C HNF   C+  WL+ + +   CPMCR   +
Sbjct: 39 CTYADDKYPLISKLPHCGHNFDYECLSIWLSKNKT---CPMCRDDIT 82

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 30.8 bits (68), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 724 MITPCDHMFHTSCLESWM---SYKLQCPVCR 751

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H++C+  W+  S +   CP+CR
Sbjct: 371 CGHILHLNCLKNWMERSQT---CPICR 394

>YER116C Chr5 complement(395348..396172) [825 bp, 274 aa] {ON}
           SLX8Subunit of the Slx5-Slx8 SUMO-targeted ubiquitin
           ligase (STUbL) complex; stimulated by prior attachment
           of SUMO to the substrate; contains a C-terminal RING
           domain
          Length = 274

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 43  ASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLRD 99
           A+ +  CP C  P ET  + +  C H F   C++Q +N+S +    G C +CR    L+D
Sbjct: 200 AAKDYRCPICFEPPETALMTL--CGHVFCCPCLFQMVNSSRTCRQFGHCALCRSKVYLKD 257

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 52  CKLPGETCPLI--VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
           CK   +  PLI  +  C H+F   CI  WL+ + +   CP+CR   +
Sbjct: 111 CKYTDDDYPLIAQLPHCGHHFDFECISIWLSKNET---CPICRDNLT 154

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWL---NTSTSKGLCP 89
            C  C+   N  C  C+ P +   +++  C H  H  CI +W          G CP
Sbjct: 1274 CDSCKKK-NTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/41 (26%), Positives = 18/41 (43%)

Query: 57  ETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           E  P+ +  C H++H  C+   +        CP C+  F L
Sbjct: 354 EGKPIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDL 394

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 13/65 (20%)

Query: 59  CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIR---------INEPHKE 109
           CP  +  C H F   CI++W     S   CP+CR      +G+          ++E  ++
Sbjct: 275 CPTEL-PCGHIFGRDCIFKWTKEHNS---CPICRSRIVEDEGLNHAINDSPVVMDEFDRQ 330

Query: 110 KFEKV 114
            FE++
Sbjct: 331 SFERI 335

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 392 CGHMLHLSCLKNWMERSQT---CPICR 415

>Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116W
           (REAL)
          Length = 530

 Score = 30.8 bits (68), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  C+ + +  S  + +CP CR +  L
Sbjct: 441 CSICLCKIKPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDL 490

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 30.8 bits (68), Expect = 1.4,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
           C H F   C+Y+W     S   CP+CR+  +
Sbjct: 295 CGHIFGRSCLYEWTRLENS---CPLCRKKIA 322

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H FH  C+  W+   + K  CP+CR
Sbjct: 733 CGHVFHTQCLENWM---SYKLQCPVCR 756

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 46  NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKG---LCPMC 91
           N TC  C L  +  P++   C H +H HC+ +  +T  S+     CP C
Sbjct: 923 NQTCFMCNLTLDI-PVVFFKCGHTYHQHCLNEEEDTLESERKLFKCPKC 970

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 66   CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRD 99
            C H +   CI+ WL  S  K  CP+C+   ++ D
Sbjct: 1152 CGHYYCQDCIWNWLEKSKKKN-CPICKIETNIND 1184

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           +V  C H FH  C+  W+     K  CP+CR
Sbjct: 728 MVTPCDHIFHTDCLENWMGY---KLQCPVCR 755

>YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}
           DMA2Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma1p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 522

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  C+ + +  S  + +CP CR +  L
Sbjct: 433 CSICLCKIKPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDL 482

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 724 MITPCSHIFHTECLENWM---SYKLQCPVCR 751

>KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1150

 Score = 30.4 bits (67), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 46  NGTCPNCKL-PGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGL---CPMCRQAFSLRDGI 101
           N  C  C   P +   LI+  C H F   CI +++     K L   CP+CR+      G+
Sbjct: 891 NLECSICTTEPIDPHKLILTDCGHPFCDKCILEYITYQKEKKLDVKCPICREMLDDTSGM 950

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 30.4 bits (67), Expect = 1.6,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H F   C+Y+W   +T    CP+CR
Sbjct: 219 CGHVFGRECLYKW---TTEHNSCPICR 242

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 17/74 (22%)

Query: 50  PNCKLPGETC------------PLIV--GSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAF 95
           P  K+P + C            PL++    C H F + CI  WL   +S   CP+CR   
Sbjct: 78  PKDKIPNDLCSICFENFREDEYPLVIELPHCSHKFDLQCISVWL---SSNSTCPVCRDKV 134

Query: 96  SLRDGIRINEPHKE 109
           +    + I+    E
Sbjct: 135 NHNAKLDIDTTEAE 148

>Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116W
           (REAL)
          Length = 529

 Score = 30.4 bits (67), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 49  CPNCKLPGETCPLI-VGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSL 97
           C  C    + C  I +  C H++H  C+ + +  S  + +CP CR +  L
Sbjct: 440 CSICLCKIKPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDL 489

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 30.4 bits (67), Expect = 1.7,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 3/32 (9%)

Query: 62  IVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           +V  C+H F   C+++W     S   CP+CR 
Sbjct: 214 VVLPCNHVFGRECLFKWSQLENS---CPLCRH 242

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 30.4 bits (67), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 3/34 (8%)

Query: 66   CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRD 99
            C H F   CI+ WL    S   CP+C+   S+ +
Sbjct: 1238 CGHFFCQSCIFSWLKNHAS---CPLCKMQTSMSE 1268

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score = 30.4 bits (67), Expect = 1.8,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 375 CGHFLHLSCLKNWMERSQT---CPICR 398

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
          similarities with uniprot|Q12161 Saccharomyces
          cerevisiae YOL054W PSH1 Nuclear protein putative RNA
          polymerase II elongation factor isolated as
          Pob3p/Spt16p- binding protein
          Length = 306

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCR 92
          ++ SC HN+   CI  WL ++ +  L CP CR
Sbjct: 5  VMTSCGHNYCYECISNWLVSNNANELTCPQCR 36

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}
           PEP5Component of CORVET tethering complex; peripheral
           vacuolar membrane protein required for protein
           trafficking and vacuole biogenesis; interacts with Pep7p
          Length = 1029

 Score = 30.4 bits (67), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query: 46  NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKG---LCPMCRQAFSLRDGIR 102
           N TC  C+L  +  P++   C H +H HC+ +  +T  S+     CP C     L    +
Sbjct: 925 NQTCFMCRLTLDI-PVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC--LVDLETSNK 981

Query: 103 INEPHKEKFEK 113
           + E   E  EK
Sbjct: 982 LFEAQHEVVEK 992

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 30.4 bits (67), Expect = 1.8,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 377 CGHVLHLSCLKNWMERSQT---CPICR 400

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 30.4 bits (67), Expect = 1.8,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 14/28 (50%), Gaps = 3/28 (10%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           C H F   C+Y+W     +   CP+CR 
Sbjct: 281 CKHIFGRECLYKWTRVQNT---CPLCRH 305

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 367 CGHVLHLFCLKNWMERSQT---CPICR 390

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQA 94
           + +  C H++H HCI + +  +  + +CP CR A
Sbjct: 484 IFISPCAHSWHFHCIRRLVMLTYPQFVCPNCRSA 517

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
          {ON} weakly similar to uniprot|Q06834 Saccharomyces
          cerevisiae YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 273

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 48 TCPNCKLPGETCPLIVGS---CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
          TCP C     T    +G+   C+H FH  C+ +W +      +CP+CR
Sbjct: 4  TCPICLDDDRTNIESIGTLQPCNHKFHRDCLRRW-HLYAHDLVCPICR 50

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 30.0 bits (66), Expect = 2.1,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 378 CTHALHLSCLKNWIARSPT---CPICR 401

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON}
          Anc_3.405 YPR093C
          Length = 384

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 66 CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
          C+H +H+ CI  W N S     CP CR
Sbjct: 36 CNHKYHIDCIRTWHNYSNDLN-CPTCR 61

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 10/55 (18%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKG----LCPMCR------QAFSLRDGIRINE 105
           +++  C H FH  C+ +W +          +CP+CR      +AF +R G+ ++E
Sbjct: 180 IVMIPCQHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDIVKCKAFCMRLGLLMSE 234

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 30.0 bits (66), Expect = 2.2,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 377 CGHILHLSCLKNWMERSQT---CPICR 400

>KAFR0K01980 Chr11 complement(407855..408736) [882 bp, 293 aa] {ON}
           Anc_7.416 YER116C
          Length = 293

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 42  RASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSK---GLCPMCRQAFSLR 98
           +A+ +  CP C  P E    ++  C H F   C++Q +N+S +    G C +CR+   L 
Sbjct: 222 KAARDYRCPICFDPPEVA--MMTPCGHVFCCDCLFQMVNSSRTYRKLGHCALCRKDVRLH 279

Query: 99  D 99
           D
Sbjct: 280 D 280

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 30.0 bits (66), Expect = 2.4,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 376 CGHILHLSCLKNWMERSQT---CPICR 399

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score = 30.0 bits (66), Expect = 2.5,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 337 CGHILHLSCLKSWMERSQT---CPICR 360

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 14/58 (24%)

Query: 38  CGICRASYNGTCPNCKLPGETCPLIVG--SCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           C IC + YN          +  PL+V    C H F + C+  WL  +++   CP+CR 
Sbjct: 86  CSICCSKYNE---------DDYPLVVELPHCSHRFDLECLTPWLLKNST---CPLCRD 131

>SAKL0H22638g Chr8 complement(1968593..1972378) [3786 bp, 1261 aa]
            {ON} similar to uniprot|P39702 Saccharomyces cerevisiae
            YAL002W VPS8 involved in vacuolar protein sorting
            required for localization and trafficking of the CPY
            sorting receptor Vps8p is a membrane-associated
            hydrophilic protein which contains a C-terminal
            cysteine-rich region that conforms to the H2 variant of
            the RING finger Zn2 binding motif.
          Length = 1261

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 50   PNCKLPGETCPLIVGSCHHNFHVHCI 75
            PN  +  + C L+V  CHH FH  C+
Sbjct: 1216 PNENIFVQDCGLVVFKCHHGFHQMCL 1241

>KNAG0C03410 Chr3 (669679..670338) [660 bp, 219 aa] {ON} Anc_7.416
           YER116C
          Length = 219

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 5/53 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSK---GLCPMCRQAFSLR 98
           CP C  P +    +   C H F   C++  +N S ++   GLC +CR     +
Sbjct: 153 CPICFDPPDVA--MAAPCGHVFCCECLFNMVNNSRNRGNFGLCALCRSKVDFK 203

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 66   CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
            C H F   C+  W   +TS   CPMC+   S
Sbjct: 1223 CGHFFCKDCVTHWFKKNTS---CPMCKNRMS 1250

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 29.6 bits (65), Expect = 2.8,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 372 CGHILHLSCLKNWMERSQT---CPICR 395

>TPHA0K00700 Chr11 (144606..145232) [627 bp, 208 aa] {ON} Anc_7.416
           YER116C
          Length = 208

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTST----SKGLCPMCR 92
           CP C  P      ++ +C H F   C++  +N+S     S G+C +CR
Sbjct: 141 CPICMDPPTAA--VITNCGHIFCNDCLFPMINSSKKNARSDGICALCR 186

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1018

 Score = 29.6 bits (65), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 46  NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWL--NTSTSKGLCPMC 91
           N  C  CK   E  P+I   C H +H  C+ + L  N+     +CP C
Sbjct: 915 NEKCDYCKANLEI-PIIYFQCGHTYHERCLNKELDQNSGDEVYVCPKC 961

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 29.6 bits (65), Expect = 2.9,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 375 CGHILHLSCLKNWMERSQT---CPICR 398

>Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W
            (REAL)
          Length = 1271

 Score = 29.6 bits (65), Expect = 3.1,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 60   PLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMC 91
            PL++  CHH FH  C+ + L    +K  C +C
Sbjct: 1234 PLVIFKCHHGFHQTCL-ENLAQKPNKYTCLIC 1264

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
            complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 29.6 bits (65), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQW-LNTSTSKGLCP 89
            C  C+   N  C  C+ P +   + V +C H  H  C+  W LN   ++  CP
Sbjct: 1257 CDACKKP-NSLCVLCEKPMKKLVMCVLACGHEGHFQCLRDWFLNEGMNE--CP 1306

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 29.6 bits (65), Expect = 3.4,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 1/42 (2%)

Query: 38   CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWL 79
            C +C +  N  C  C+ P +   + + SC H  H  C  +W 
Sbjct: 1228 CDLC-SRMNTLCALCERPLKKLTMCILSCGHEGHPECFQRWF 1268

>Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON}
           (126281..127543) [1263 nt, 421 aa]
          Length = 420

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 19/41 (46%)

Query: 60  PLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDG 100
           P+ +  C H +H +CI   + T+  +  CP CR      D 
Sbjct: 356 PVFISHCFHFWHFNCIMPIIQTTYPQFNCPNCRSFIDFLDA 396

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 29.6 bits (65), Expect = 3.5,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 3/34 (8%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRD 99
           C H F   C+Y+W     +   CP+CR   +  D
Sbjct: 235 CGHIFGRECLYRWCKLENT---CPLCRHVIAEVD 265

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W
          - Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCR 92
          ++ +C HN+   CI  WL ++ +  L CP CR
Sbjct: 5  VMTTCGHNYCYDCISNWLVSNNANELTCPQCR 36

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 29.6 bits (65), Expect = 3.7,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query: 46  NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNT-STSKGL--CPMCRQAFSLRDGIR 102
           N TC  C L  +  P++   C H +H HC+ +  +T    + L  CP C     L    +
Sbjct: 926 NQTCFMCNLTLDV-PVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC--LVELETSNK 982

Query: 103 INEPHKEKFEK 113
           + E  +E  EK
Sbjct: 983 LFEAQQEVVEK 993

>Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 29.6 bits (65), Expect = 3.7,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 46  NGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNT-STSKGL--CPMCRQAFSLRDGIR 102
           N  C  C L  E  P++   C H +H HC+ +  +T    + L  CP C     L    +
Sbjct: 925 NQVCFMCNLKLEI-PVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC--LVELETSNK 981

Query: 103 INEPHKEKFEK 113
           + E  +E  EK
Sbjct: 982 LYEAQREVVEK 992

>SAKL0F13046g Chr6 complement(1026073..1026882) [810 bp, 269 aa]
           {ON} weakly similar to uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 269

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTS---KGLCPMCRQAFSLRD 99
           CP C  P +    ++  C H F   C++Q +N+S      G C +CR+    +D
Sbjct: 203 CPICFDPPDAA--LMTPCGHIFCTECLFQMVNSSRGYRKHGHCALCRKDVKFKD 254

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           + +  C H++H HC+ + +  S  + +CP CR 
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRS 372

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score = 29.3 bits (64), Expect = 4.0,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 3/27 (11%)

Query: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           C H  H  C+  W+  S +   CP+CR
Sbjct: 345 CGHMLHFGCLKSWMERSQT---CPICR 368

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           + +  C H++H HC+ + +  S  + +CP CR 
Sbjct: 335 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRS 367

>AFR220W Chr6 (830237..833494) [3258 bp, 1085 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR032W (RAD5)
          Length = 1085

 Score = 29.3 bits (64), Expect = 4.1,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 24/64 (37%), Gaps = 12/64 (18%)

Query: 38  CGICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKG---LCPMCRQA 94
           C IC          C+       ++   C H F   C+ +++     KG   +CP CR A
Sbjct: 832 CSIC---------TCEAISPLTSVVFTRCGHPFCESCLLEYIQFQNKKGSETICPNCRAA 882

Query: 95  FSLR 98
              R
Sbjct: 883 VESR 886

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 61  LIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQ 93
           + +  C H++H HC+ + +  S  + +CP CR 
Sbjct: 193 IFISPCAHSWHFHCVRRLVILSYPQFMCPNCRS 225

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa]
          {ON} weakly similar to uniprot|Q06834 Saccharomyces
          cerevisiae YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 322

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 47 GTCPNC-KLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92
           TC  C +  G+    +V +C H +H+ CI +W N S     CP CR
Sbjct: 4  ATCSICLEALGQNIGRLV-TCQHEYHLECIREWHNHSQDFK-CPTCR 48

>KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa]
          {ON} Anc_8.808 YOL054W
          Length = 357

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 58 TCPLIVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCRQAFSL 97
          + P++V  C H +   C+  W   + ++ L CP CR +  +
Sbjct: 41 SIPMMVTPCGHTYCYECLLTWFKNNENRELNCPDCRVSIEV 81

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 29.3 bits (64), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 11/48 (22%)

Query: 66   CHHNFHVHCIYQWLNTSTSKGLCPMCRQ--------AFSLRDGIRINE 105
            C H F   CI+ WL    +K  CP+C+         +F L+D  R  E
Sbjct: 1179 CGHFFCKSCIHSWLR---NKNACPLCKMETNITEVYSFKLQDEDRKTE 1223

>Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054W
          (REAL)
          Length = 411

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 62 IVGSCHHNFHVHCIYQWLNTSTSKGL-CPMCRQAFS 96
          ++  C HN+   C+  W +++T K L CP CR   +
Sbjct: 41 MMTPCGHNYCYGCLNTWFSSNTQKELACPQCRSDIT 76

>SAKL0D10890g Chr4 (904673..905470) [798 bp, 265 aa] {ON} similar to
           uniprot|P38632 Saccharomyces cerevisiae YEL019C MMS21
           Protein involved in DNA repair mutants are sensitive to
           the alkylating agent methyl methanesulfonate and show
           increased spontaneous mutation and mitotic recombination
          Length = 265

 Score = 28.9 bits (63), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 3/65 (4%)

Query: 40  ICRASYNGTCPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCP--MCRQAFSL 97
           I   S   TCP    P E  P+I   C H F +  I ++L        CP   C Q   +
Sbjct: 173 IAGGSIELTCPITCKPYEK-PMISKKCGHVFDLSGIQEYLKDHRGPKKCPQGACGQEVEM 231

Query: 98  RDGIR 102
           RD ++
Sbjct: 232 RDFVQ 236

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 29.3 bits (64), Expect = 4.6,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 5/48 (10%)

Query: 49   CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFS 96
            C  C  P     ++  +C H F   CI+ WL    ++  CP+C+   S
Sbjct: 1164 CSICLQPITNGAMV--NCGHLFCTSCIFSWLK---NRKTCPLCKHPTS 1206

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.473 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,017,599
Number of extensions: 436695
Number of successful extensions: 1505
Number of sequences better than 10.0: 292
Number of HSP's gapped: 1424
Number of HSP's successfully gapped: 293
Length of query: 148
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 49
Effective length of database: 42,129,465
Effective search space: 2064343785
Effective search space used: 2064343785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)