Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_52693.138ON24124111911e-167
AER206C3.138ON2322217404e-99
SAKL0C08184g3.138ON2502216601e-86
Kwal_56.229033.138ON2602226376e-83
KLTH0C08360g3.138ON2552226132e-79
TBLA0F010103.138ON2252215712e-73
TDEL0D048603.138ON2222215693e-73
ZYRO0B05478g3.138ON2302215617e-72
CAGL0K01265g3.138ON2462245514e-70
NCAS0C003603.138ON2272225433e-69
Kpol_1053.113.138ON2282215355e-68
KAFR0C011703.138ON2322215349e-68
KNAG0K009803.138ON2192205251e-66
KLLA0D03795g3.138ON2342215174e-65
TPHA0M005103.138ON2312245164e-65
Skud_7.3713.138ON2362224775e-59
Smik_6.1573.138ON2382194767e-59
Suva_7.3573.138ON2422214741e-58
YGR075C (PRP38)3.138ON2422194681e-57
NDAI0A068003.138ON2392314506e-55
Kpol_348.72.529ON66097790.17
NCAS0A048102.529ON65989730.77
NDAI0K018702.529ON69290730.92
Smik_11.2242.529ON67090711.5
Suva_11.1952.529ON67090711.6
CAGL0L02035g2.529ON658192711.6
TPHA0J018106.117ON39084701.9
Skud_11.1982.529ON67090692.4
Ecym_24028.671ON67267649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_5269
         (241 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_5269 Chr5 (554751..555476) [726 bp, 241 aa] {ON} similar to...   463   e-167
AER206C Chr5 complement(1020446..1021144) [699 bp, 232 aa] {ON} ...   289   4e-99
SAKL0C08184g Chr3 (757467..758219) [753 bp, 250 aa] {ON} similar...   258   1e-86
Kwal_56.22903 s56 complement(321790..322572) [783 bp, 260 aa] {O...   249   6e-83
KLTH0C08360g Chr3 (709211..709978) [768 bp, 255 aa] {ON} similar...   240   2e-79
TBLA0F01010 Chr6 complement(246433..247110) [678 bp, 225 aa] {ON...   224   2e-73
TDEL0D04860 Chr4 complement(883478..884146) [669 bp, 222 aa] {ON...   223   3e-73
ZYRO0B05478g Chr2 complement(435448..436140) [693 bp, 230 aa] {O...   220   7e-72
CAGL0K01265g Chr11 (117543..118283) [741 bp, 246 aa] {ON} simila...   216   4e-70
NCAS0C00360 Chr3 (53393..54076) [684 bp, 227 aa] {ON} Anc_3.138 ...   213   3e-69
Kpol_1053.11 s1053 (14305..14991) [687 bp, 228 aa] {ON} (14305.....   210   5e-68
KAFR0C01170 Chr3 complement(234805..235503) [699 bp, 232 aa] {ON...   210   9e-68
KNAG0K00980 Chr11 (193396..194055) [660 bp, 219 aa] {ON} Anc_3.1...   206   1e-66
KLLA0D03795g Chr4 complement(322289..322993) [705 bp, 234 aa] {O...   203   4e-65
TPHA0M00510 Chr13 complement(93362..94057) [696 bp, 231 aa] {ON}...   203   4e-65
Skud_7.371 Chr7 complement(623406..624116) [711 bp, 236 aa] {ON}...   188   5e-59
Smik_6.157 Chr6 complement(262091..262807) [717 bp, 238 aa] {ON}...   187   7e-59
Suva_7.357 Chr7 complement(612532..613260) [729 bp, 242 aa] {ON}...   187   1e-58
YGR075C Chr7 complement(636147..636875) [729 bp, 242 aa] {ON}  P...   184   1e-57
NDAI0A06800 Chr1 complement(1549698..1550417) [720 bp, 239 aa] {...   177   6e-55
Kpol_348.7 s348 (13865..15847) [1983 bp, 660 aa] {ON} (13865..15...    35   0.17 
NCAS0A04810 Chr1 complement(961785..963764) [1980 bp, 659 aa] {O...    33   0.77 
NDAI0K01870 Chr11 complement(423325..425403) [2079 bp, 692 aa] {...    33   0.92 
Smik_11.224 Chr11 complement(369746..371758) [2013 bp, 670 aa] {...    32   1.5  
Suva_11.195 Chr11 complement(364534..366546) [2013 bp, 670 aa] {...    32   1.6  
CAGL0L02035g Chr12 complement(240413..242389) [1977 bp, 658 aa] ...    32   1.6  
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    32   1.9  
Skud_11.198 Chr11 complement(361569..363581) [2013 bp, 670 aa] {...    31   2.4  
Ecym_2402 Chr2 (782551..784569) [2019 bp, 672 aa] {ON} similar t...    29   9.8  

>Ecym_5269 Chr5 (554751..555476) [726 bp, 241 aa] {ON} similar to
           Ashbya gossypii AER206C
          Length = 241

 Score =  463 bits (1191), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/241 (92%), Positives = 224/241 (92%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM
Sbjct: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY
Sbjct: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL
Sbjct: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPWXXXXXXXXXXXXXXXXXHT 240
           HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW                 HT
Sbjct: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPWLIEILEAEADEESDGSDHT 240

Query: 241 S 241
           S
Sbjct: 241 S 241

>AER206C Chr5 complement(1020446..1021144) [699 bp, 232 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR075C
           (PRP38)
          Length = 232

 Score =  289 bits (740), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 136/221 (61%), Positives = 167/221 (75%), Gaps = 5/221 (2%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           M +EF VES ISDKQL++QSTSLVIPKI RLRIHNSMYYK+NL+P  LRG T+K + +V+
Sbjct: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           +R+LG CK+RS      CG  EFQCLLMK++EIRPTWSQ++ +LQL D   K G FNNKY
Sbjct: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGD-ERKTGKFNNKY 119

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           I VLILVYLRIQYY+L ++  E   P    +  GD+ A K+K LFAHFL D RK+K ++L
Sbjct: 120 IAVLILVYLRIQYYFLADEKAESFPP----EADGDVTAAKVKALFAHFLADYRKVKCLDL 175

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D WS + QK V + H+DEIVDWLCT DSIWG+PLG+C W
Sbjct: 176 EVDCWSGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216

>SAKL0C08184g Chr3 (757467..758219) [753 bp, 250 aa] {ON} similar to
           uniprot|Q00723 Saccharomyces cerevisiae YGR075C PRP38
           Unique component of the U4/U6.U5 tri-snRNP particle
           dispensable for spliceosome assembly but required for
           conformational changes which lead to catalytic
           activation of the spliceosome
          Length = 250

 Score =  258 bits (660), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 159/221 (71%), Gaps = 2/221 (0%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MSREFQVE+ +S+KQLNHQSTSLVIP++TR+R+HNSMYYKVNL    LRG  M  ++KV+
Sbjct: 1   MSREFQVEANLSNKQLNHQSTSLVIPQLTRVRVHNSMYYKVNLDAVGLRGVNMCQLAKVI 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           +R+LG+  +  T +   CG VEF+CLL K+V IRPTW Q+  ML L    + AG FNNKY
Sbjct: 61  VRDLGSLAHGGTCTAGVCGGVEFKCLLTKLVHIRPTWRQVVAMLGLGK-PQHAG-FNNKY 118

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           IVVL+LVYLR QYYYL  +G      +  L     + +  ++ LF HF+ D RK+KS +L
Sbjct: 119 IVVLVLVYLRAQYYYLPAEGGTMAGGVEQLAKLNRVSSRALRQLFGHFINDYRKVKSFSL 178

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D WS+S++KRV++ H+DE+VDWLCT + IWG+PLG C W
Sbjct: 179 AADCWSSSVEKRVELLHVDEVVDWLCTKNEIWGIPLGICQW 219

>Kwal_56.22903 s56 complement(321790..322572) [783 bp, 260 aa] {ON}
           YGR075C (PRP38) - RNA splicing factor [contig 184] FULL
          Length = 260

 Score =  249 bits (637), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 119/222 (53%), Positives = 159/222 (71%), Gaps = 3/222 (1%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           M  EF  +  +S+KQLNHQSTSLVIP++TR RIHNSMYYKVNLHPA+LRG  M  + K +
Sbjct: 1   MPLEFHFDESVSEKQLNHQSTSLVIPQLTRARIHNSMYYKVNLHPAALRGINMLQLIKKI 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           +++ GT +  S +    CG VEF+CLLMK+V +RPTWSQ+ L+LQ  +  EK   F+NKY
Sbjct: 61  VKQFGTTRGGSHLVSVVCGGVEFKCLLMKLVHLRPTWSQVLLILQRGN--EKTSKFDNKY 118

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKP-LSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSIN 179
           +V+L+LVYLR+QYYYL      E K  + +++  GD+ + K++ LF  ++ D RK+KS++
Sbjct: 119 LVILVLVYLRVQYYYLPKPAARENKTCILDVEKQGDVTSDKLQNLFRIYINDYRKVKSMD 178

Query: 180 LHDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           L  D WS    K+VD+ HIDEIVDWLCT D IWG+PLGK  W
Sbjct: 179 LDIDCWSNLTGKKVDVLHIDEIVDWLCTQDHIWGIPLGKSQW 220

>KLTH0C08360g Chr3 (709211..709978) [768 bp, 255 aa] {ON} similar to
           uniprot|Q00723 Saccharomyces cerevisiae YGR075C PRP38
           Unique component of the U4/U6.U5 tri-snRNP particle
           dispensable for spliceosome assembly but required for
           conformational changes which lead to catalytic
           activation of the spliceosome
          Length = 255

 Score =  240 bits (613), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 122/222 (54%), Positives = 159/222 (71%), Gaps = 3/222 (1%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MSREF V+  +S KQLNHQSTSLVIP++ R RIHNSMYYK+NL PASLRG+TM  +SK M
Sbjct: 1   MSREFHVDENVSTKQLNHQSTSLVIPQLARTRIHNSMYYKINLDPASLRGDTMVQLSKTM 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           +R+ GTC++ +      CG VEF+CLLMK+V +RP W Q+  +LQ  +  E++  F+NKY
Sbjct: 61  MRDFGTCRDNARRMALVCGGVEFKCLLMKLVHLRPQWGQIVTILQKGN--ERSSKFDNKY 118

Query: 121 IVVLILVYLRIQYYYLVNKGTEE-IKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSIN 179
           +VVL+LVYLRIQYY+L +   EE +  + NL+  G + +G ++ LF  +L D RK+KSIN
Sbjct: 119 LVVLVLVYLRIQYYFLPDTSDEEKVTGVLNLNKRGSVSSGTLRGLFRIYLSDYRKVKSIN 178

Query: 180 LHDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           L  D W  S  K     HIDE+VDWLCT D IWG+PLG+C W
Sbjct: 179 LETDYWYNSASKVPKTLHIDEVVDWLCTQDQIWGIPLGRCQW 220

>TBLA0F01010 Chr6 complement(246433..247110) [678 bp, 225 aa] {ON}
           Anc_3.138 YGR075C
          Length = 225

 Score =  224 bits (571), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 152/221 (68%), Gaps = 18/221 (8%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MS+EF VES++S KQLNHQS SLVIP++TR +IH+++YYKVNL   S+RG T+  ++ V+
Sbjct: 3   MSKEFFVESQVSSKQLNHQSVSLVIPRLTRDKIHSALYYKVNLQDPSMRGNTLLGLNNVI 62

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           IR+LGT  N S       G VEF+C+LMK+VE+RPT  QL ++L++ D +   G FNNKY
Sbjct: 63  IRDLGTLNNESINKKNVLGGVEFKCILMKLVELRPTIEQLDIILEISDAT---GEFNNKY 119

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           I+ LILVYLRIQYYY  N+ ++E              A + K LF  ++ D RK+K+I+L
Sbjct: 120 IIALILVYLRIQYYY-ANETSDE--------------AKRFKALFQQYINDYRKMKAISL 164

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           + D WS S    V++ H+DE+V WL   D+IWG+PLGKC W
Sbjct: 165 NIDCWSQSQIITVELIHMDELVHWLSAKDNIWGIPLGKCSW 205

>TDEL0D04860 Chr4 complement(883478..884146) [669 bp, 222 aa] {ON}
           Anc_3.138 YGR075C
          Length = 222

 Score =  223 bits (569), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 147/221 (66%), Gaps = 20/221 (9%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MSREF VES +S K+LN+QS SLVIP++TR RIHN +YYK NLH  +LRG+TMK + KV+
Sbjct: 1   MSREFYVESYLSTKELNNQSVSLVIPRLTRDRIHNVIYYKANLHTVALRGDTMKQLCKVI 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           IR+LGT ++ S       G VEF+C+LMK+VEIRPTW QL L+L+          +NNKY
Sbjct: 61  IRDLGTLQSTSINRKNVLGGVEFKCILMKLVEIRPTWDQLALLLR-----NPHPSYNNKY 115

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           ++ L+L YLR+QY+YL N                DI A  IK  F  ++ D RK+KS++L
Sbjct: 116 VIALVLTYLRVQYFYLKN---------------DDILAQNIKGAFKEYICDYRKMKSVSL 160

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D WS S    V+I H+DE+VDWL T D IWG+PLG+C W
Sbjct: 161 EMDCWSASQNVTVEIIHMDELVDWLTTKDEIWGIPLGRCQW 201

>ZYRO0B05478g Chr2 complement(435448..436140) [693 bp, 230 aa] {ON}
           similar to uniprot|Q00723 Saccharomyces cerevisiae
           YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
           particle dispensable for spliceosome assembly but
           required for conformational changes which lead to
           catalytic activation of the spliceosome
          Length = 230

 Score =  220 bits (561), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 142/221 (64%), Gaps = 21/221 (9%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           M +EF VES +S KQLNHQS S VIP+I R RIHN+MYY+VNL+ ASLRG+TM  +S+++
Sbjct: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           +R+LG  K+ S       G VEFQCLLMK+VEI+PT+ QL  MLQ D+       FNNKY
Sbjct: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDE------NFNNKY 114

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           IV LIL YLRIQYYYL                  D  A + ++ F  +  D RK+KS+ L
Sbjct: 115 IVGLILTYLRIQYYYL---------------PVDDPWARRCQSFFRQYYNDYRKLKSVQL 159

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D WS S    VDI H DE+VDWL   D IWG+PLGKC W
Sbjct: 160 DQDCWSKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQW 200

>CAGL0K01265g Chr11 (117543..118283) [741 bp, 246 aa] {ON} similar
           to uniprot|Q00723 Saccharomyces cerevisiae YGR075c
           Pre-mRNA splicing factor
          Length = 246

 Score =  216 bits (551), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 151/224 (67%), Gaps = 18/224 (8%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MS EFQ ES IS+KQLN+QS SLVIP+ITR +IHN++YY+ NLHP S+RG+TM +++ ++
Sbjct: 1   MSAEFQYESFISEKQLNNQSVSLVIPRITRDKIHNNIYYRCNLHPVSMRGDTMLNLAPII 60

Query: 61  IRELGTCKN---RSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFN 117
           IR+LG  +N   +   +    G  EF+CLLMK++EIRPTW Q+  ++  +   E    F 
Sbjct: 61  IRDLGKLRNPYQKPLNATLLLGGSEFKCLLMKLIEIRPTWEQIMTLINEEMVEES---FE 117

Query: 118 NKYIVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKS 177
           NKYIV L+LVY RIQYY+L              D   D DA K + LF  +L D RK+K+
Sbjct: 118 NKYIVALVLVYGRIQYYFLTFS-----------DDYYD-DAIKWRRLFKKYLNDYRKLKA 165

Query: 178 INLHDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           ++L+ D WSTS  + V++ H+DEIVDWL T D IWG+PLGKC W
Sbjct: 166 LDLNVDCWSTSQMQNVELIHLDEIVDWLATKDDIWGIPLGKCQW 209

>NCAS0C00360 Chr3 (53393..54076) [684 bp, 227 aa] {ON} Anc_3.138
           YGR075C
          Length = 227

 Score =  213 bits (543), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 147/222 (66%), Gaps = 25/222 (11%)

Query: 3   REFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMIR 62
           R+F VES IS K+LN+QS SLVIP++TR +IHN +YYKVNL   SLRG TM  +SK++IR
Sbjct: 4   RDFFVESHISSKELNNQSVSLVIPRLTRDKIHNVLYYKVNLTSTSLRGNTMLQLSKIIIR 63

Query: 63  ELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGP---FNNK 119
           +LG  K+ +++     G VEF+CLLMK++EIRPT+ Q+ ++L+     +K  P   F NK
Sbjct: 64  DLGQLKDSNSLKNYLVGGVEFKCLLMKLIEIRPTFDQITMLLE-----KKKSPDDTFENK 118

Query: 120 YIVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSIN 179
           YIV LIL YLRIQYYYL                    DA  +  LF  ++ D RK+K I+
Sbjct: 119 YIVALILTYLRIQYYYLKLH-----------------DASHLINLFREYINDYRKLKGID 161

Query: 180 LHDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           +  D WS S Q +V+I HIDE+VD L TN++IWG+PLGKC W
Sbjct: 162 MDMDCWSMSQQLKVEIIHIDELVDRLATNNNIWGIPLGKCQW 203

>Kpol_1053.11 s1053 (14305..14991) [687 bp, 228 aa] {ON}
           (14305..14991) [687 nt, 229 aa]
          Length = 228

 Score =  210 bits (535), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 144/221 (65%), Gaps = 18/221 (8%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MS EF VES +S+KQLN+QS SLVIP+ITR +IHNS+YYK NL  +SLRG  M  + +V+
Sbjct: 1   MSNEFLVESHLSNKQLNNQSVSLVIPRITRDKIHNSIYYKANLDNSSLRGLNMLQLIEVI 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           +R+LGT K++S       G VEF+C+LMK++EI PTW QL  ++Q+ D       F+NKY
Sbjct: 61  VRDLGTLKDKSVNQVCFLGGVEFKCILMKLIEICPTWEQLMTIIQMQD--NVIDNFDNKY 118

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           +V L+L Y+RIQYYY                   ++++ K + LF+  + D RK+KS+ +
Sbjct: 119 LVALVLTYIRIQYYY----------------DNDEVNSKKYRELFSKCISDYRKLKSVAM 162

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D WS S    + I H+DE+VDWLC+ D IWG+PLG C W
Sbjct: 163 DTDCWSMSQSIEIKIIHLDELVDWLCSEDEIWGIPLGHCQW 203

>KAFR0C01170 Chr3 complement(234805..235503) [699 bp, 232 aa] {ON}
           Anc_3.138 YGR075C
          Length = 232

 Score =  210 bits (534), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 145/221 (65%), Gaps = 19/221 (8%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MS EF VES +S KQLNHQS SL+IP++TR RIHN++YYKVNL P SLRG+T+  +SKV+
Sbjct: 1   MSSEFHVESFLSAKQLNHQSVSLIIPRLTRDRIHNNIYYKVNLQPTSLRGDTLLELSKVI 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           IR+LGT K+ S       G +EF+CLLMK++EIRPT +QL  ML   + +     F +KY
Sbjct: 61  IRDLGTLKDLSVNKVHVLGGMEFKCLLMKLIEIRPTINQLFAMLNPANANTN---FEDKY 117

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           I  LI+ YLRIQY+YL                T   +  ++K LF   ++D RK+KS++L
Sbjct: 118 ITALIITYLRIQYFYL----------------TDAQECLRMKNLFKKCIKDYRKLKSLSL 161

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D WS S +  V + H+DE+ +WL + + IWG+PLGKC W
Sbjct: 162 QSDCWSPSEELTVAVVHMDELTEWLVSKEQIWGIPLGKCQW 202

>KNAG0K00980 Chr11 (193396..194055) [660 bp, 219 aa] {ON} Anc_3.138
           YGR075C
          Length = 219

 Score =  206 bits (525), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 142/220 (64%), Gaps = 20/220 (9%)

Query: 2   SREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMI 61
           S EFQVES IS KQLNHQS SLVIP++TR ++H+ +YYKVNL   SLRG+TM  +SKV+I
Sbjct: 3   SLEFQVESHISTKQLNHQSVSLVIPRLTRDKVHHVLYYKVNLEVGSLRGDTMLQLSKVLI 62

Query: 62  RELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKYI 121
           R+LGT K  +       G VEF+CLLMK+VEIRPT  QL  +L+  +       F++KYI
Sbjct: 63  RDLGTIKANTLNQTHILGGVEFKCLLMKLVEIRPTREQLVYILETQN-----KTFDDKYI 117

Query: 122 VVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINLH 181
           V LIL Y+RIQY+Y+               T  D  A K + LF  +++D RK+K+++  
Sbjct: 118 VALILTYIRIQYFYV---------------TLHDELARKWRELFKTYMKDFRKLKAVDFE 162

Query: 182 DDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
            D WS S +  V + H+DE++DWL T   IWG+PLG C W
Sbjct: 163 QDCWSQSQKINVKVTHLDELIDWLVTETQIWGIPLGMCQW 202

>KLLA0D03795g Chr4 complement(322289..322993) [705 bp, 234 aa] {ON}
           similar to uniprot|Q00723 Saccharomyces cerevisiae
           YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
           particle dispensable for spliceosome assembly but
           required for conformational changes which lead to
           catalytic activation of the spliceosome
          Length = 234

 Score =  203 bits (517), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 135/221 (61%), Gaps = 16/221 (7%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           M  EF VE  +S KQLNHQS SLV+P+I R ++ + MYYK NL PASLRG+T+  +  V+
Sbjct: 1   MPNEFYVEENLSGKQLNHQSASLVVPQIFRNKVSSCMYYKFNLTPASLRGDTIVELIPVI 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
           +R+ GT   R T   T  G +EF+CLLMK++ +RP W QL ++L      E   P NNKY
Sbjct: 61  VRDFGTMDERKTPHVTVLGGIEFKCLLMKLINLRPPWEQLKVLL------EPHEPLNNKY 114

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           I  L+L Y+RI YY+L      E           DI    +  L   ++ D RK+KS +L
Sbjct: 115 IAALVLCYMRISYYFLTESNPSE----------QDISFNLLHDLMKKYILDHRKLKSYSL 164

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D WS+SI+K + + H DE++DWLC  + IWG+PLGKC W
Sbjct: 165 DMDCWSSSIKKEIKLIHFDELIDWLCDRNEIWGIPLGKCNW 205

>TPHA0M00510 Chr13 complement(93362..94057) [696 bp, 231 aa] {ON}
           Anc_3.138 YGR075C
          Length = 231

 Score =  203 bits (516), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 107/224 (47%), Positives = 141/224 (62%), Gaps = 18/224 (8%)

Query: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60
           MS EF VE+ +S KQLN+QS SLVIP++TR +IHNSMYYKVNL   SLRG T+  +SKV+
Sbjct: 1   MSHEFAVEAYLSSKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLTDNSLRGNTVLQLSKVI 60

Query: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLD---DCSEKAGPFN 117
           +R+LGT  N S+      G VEF+C+LMK+VE+RPTW QL  +L +D   +     G F+
Sbjct: 61  VRDLGTLLNGSSQQLNVIGGVEFKCILMKLVEMRPTWEQLLSLLNIDNDFNSVGTVGEFD 120

Query: 118 NKYIVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKS 177
           NKYI  L+L Y+RIQY++ +N   +                 K K LF  ++ D RK+KS
Sbjct: 121 NKYITALVLTYIRIQYHF-INSDHQLFN--------------KCKKLFKLYMNDYRKLKS 165

Query: 178 INLHDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           I    + WS S    V I HIDE+V+WL T + IWG+PL  C W
Sbjct: 166 IAFGTNCWSMSQAIDVGIGHIDELVEWLATKNDIWGLPLAMCSW 209

>Skud_7.371 Chr7 complement(623406..624116) [711 bp, 236 aa] {ON}
           YGR075C (REAL)
          Length = 236

 Score =  188 bits (477), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 102/222 (45%), Positives = 142/222 (63%), Gaps = 15/222 (6%)

Query: 2   SREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMI 61
           + EFQVES IS KQLN+QS SL+IP++TR +IHNSMYYKVNL   SLRG TM  + KV+I
Sbjct: 3   THEFQVESHISSKQLNNQSVSLIIPRLTRDKIHNSMYYKVNLSNESLRGNTMLELLKVII 62

Query: 62  RELGTCKNRST-VSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
             LGT + +   ++    G VEF+C+LMK+VEIRP   QL  +L + +  +    FN+KY
Sbjct: 63  DALGTLRGQDGHLNMAVLGGVEFKCILMKLVEIRPNLKQLAFLLDVKNVKD----FNSKY 118

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKI-KTLFAHFLRDCRKIKSIN 179
           I+ L+LVY R+QYYYL ++         N + + + D  ++ K     + +   K+KS  
Sbjct: 119 IIALVLVYARLQYYYLNDQ---------NKNNSYENDLIQLFKVQLYKYSQQFFKLKSFP 169

Query: 180 LHDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           L  D ++ S  + + I H+DE+VDWL T D IWG+PLGKC W
Sbjct: 170 LQVDCFAHSQNEGLCIVHVDELVDWLVTQDHIWGIPLGKCQW 211

>Smik_6.157 Chr6 complement(262091..262807) [717 bp, 238 aa] {ON}
           YGR075C (REAL)
          Length = 238

 Score =  187 bits (476), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 138/219 (63%), Gaps = 13/219 (5%)

Query: 4   EFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMIRE 63
           EFQVES IS KQLN+QS SL++P++TR +IHNSMYYKVNL   SLRG TM  + KV++  
Sbjct: 5   EFQVESHISSKQLNNQSVSLIVPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVIVGT 64

Query: 64  LGTCKNRST-VSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKYIV 122
           LGT + +   +     G VEF+C+LMK++EIRP + QL+ +L + +    A  FN+KYI+
Sbjct: 65  LGTSRGQDGHLHMVVLGGVEFKCILMKLIEIRPNFEQLNFLLNVKN----ANNFNSKYII 120

Query: 123 VLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINLHD 182
            LILVY R+QYYYL +K   +    + +           K     + +   K+KS  L  
Sbjct: 121 ALILVYARLQYYYLNDKNNNDNDEDNLIKL--------FKVQLYKYSQQYFKLKSFPLQK 172

Query: 183 DPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           D ++ S  + + I H+DE+VDWL T D IWG+PLGKC W
Sbjct: 173 DCFAHSYNQELCIIHVDELVDWLVTQDHIWGMPLGKCQW 211

>Suva_7.357 Chr7 complement(612532..613260) [729 bp, 242 aa] {ON}
           YGR075C (REAL)
          Length = 242

 Score =  187 bits (474), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/221 (47%), Positives = 140/221 (63%), Gaps = 13/221 (5%)

Query: 2   SREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMI 61
           ++EFQVES IS KQLN+QS SL+IP++TR +IHNSMYYKVNL   SLRG TM  + KV++
Sbjct: 3   TKEFQVESHISLKQLNNQSVSLIIPRLTRDKIHNSMYYKVNLSSESLRGNTMVELLKVIV 62

Query: 62  RELGTCKNRST-VSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120
            +LG  KN+   ++ T  G VEF+C+LMK+VEIRPT  QL  +L + D S     F++KY
Sbjct: 63  GKLGALKNQDGHLNMTVLGGVEFKCILMKLVEIRPTLQQLTFLLNVTDPS----TFSSKY 118

Query: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
           I  LILVY R+QYYYL +K   +    + +           K     + +   K+KS  L
Sbjct: 119 ITALILVYARLQYYYLNDKNNNDTNDDNLIKL--------FKVQLYKYSQQFSKLKSFPL 170

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
             D ++ S  + + I  IDE+VDWL T D IWG+PLGKC W
Sbjct: 171 QVDCFAHSNNEELCIIRIDELVDWLVTEDHIWGIPLGKCQW 211

>YGR075C Chr7 complement(636147..636875) [729 bp, 242 aa] {ON}
           PRP38Unique component of the U4/U6.U5 tri-snRNP
           particle, required for conformational changes which
           result in the catalytic activation of the spliceosome;
           dispensible for spliceosome assembly
          Length = 242

 Score =  184 bits (468), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 134/219 (61%), Gaps = 13/219 (5%)

Query: 4   EFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMIRE 63
           EFQVES IS KQLN+QS SLVIP++TR +IHNSMYYKVNL   SLRG TM  + KVMI  
Sbjct: 5   EFQVESNISPKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVMIGA 64

Query: 64  LGTCKNRST-VSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKYIV 122
            GT K ++  +     G +EF+C+LMK++EIRP + QL+ +L + +       F++KYI+
Sbjct: 65  FGTIKGQNGHLHMMVLGGIEFKCILMKLIEIRPNFQQLNFLLNVKN----ENGFDSKYII 120

Query: 123 VLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINLHD 182
            L+LVY R+QYYYL      +      +           K     + +   K+KS  L  
Sbjct: 121 ALLLVYARLQYYYLNGNNKNDDDENDLIKL--------FKVQLYKYSQHYFKLKSFPLQV 172

Query: 183 DPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           D ++ S  + + I HIDE+VDWL T D IWG+PLGKC W
Sbjct: 173 DCFAHSYNEELCIIHIDELVDWLATQDHIWGIPLGKCQW 211

>NDAI0A06800 Chr1 complement(1549698..1550417) [720 bp, 239 aa] {ON}
           Anc_3.138 YGR075C
          Length = 239

 Score =  177 bits (450), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 140/231 (60%), Gaps = 30/231 (12%)

Query: 2   SREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMI 61
           S EF VES IS+KQLN+ S SLVIP+ITR +IHNS+YYKVNL   SLRG TM  + +V++
Sbjct: 4   SNEFFVESFISNKQLNNSSVSLVIPRITRDKIHNSIYYKVNLTSQSLRGNTMVQLIQVIV 63

Query: 62  RELGTCKNRS--------TVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKA 113
           R+ G  K++S         V     G  EF+CLLMK++E++PT  Q+ ++L+  D +E  
Sbjct: 64  RDFGKLKSQSHSHSSDTMVVRNHLVGGTEFKCLLMKIIELKPTIEQIWILLEDHDDTE-- 121

Query: 114 GPFNNKYIVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCR 173
             F+NKYI VLI+ Y+RIQY+++                  D  A K + +F   L +  
Sbjct: 122 --FDNKYITVLIITYIRIQYFFI---------------GKNDSLARKFQDIFQKCLNNYT 164

Query: 174 KIKSINLHDDPW---STSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221
           K+K   L  D W    +  ++ V I ++DE+VDWL T D+IWG+PLGKC W
Sbjct: 165 KLKCFQLDADCWSPSLSLSEESVRIIYMDEVVDWLLTKDNIWGIPLGKCQW 215

>Kpol_348.7 s348 (13865..15847) [1983 bp, 660 aa] {ON}
           (13865..15847) [1983 nt, 661 aa]
          Length = 660

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 11/97 (11%)

Query: 115 PFNNKYIVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRK 174
           P +    +  + V  ++ Y+ L+NK  +E+ P+    T GD  A      ++H     RK
Sbjct: 144 PLSKNDFMTSMRVQNKVLYFALINKHIKELVPIIYTPTEGDAIAA-----YSHRF---RK 195

Query: 175 IKSINLH-DDPWSTSIQKRVDIYHIDEIVDWLCTNDS 210
            + I L   DP   SI +R+ +Y  D+ VD++   DS
Sbjct: 196 PEGIFLDITDP--DSIDRRLSVYGNDKDVDYIVVTDS 230

>NCAS0A04810 Chr1 complement(961785..963764) [1980 bp, 659 aa] {ON}
           Anc_2.529 YKL029C
          Length = 659

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 13/89 (14%)

Query: 126 LVYLRIQ----YYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINLH 181
           +  LR+Q    Y+ LV K  +E+ P+    T GD  A      ++H  R    +      
Sbjct: 151 MTNLRVQNKVLYFALVKKHIKELVPIIYTPTEGDAIAA-----YSHRFRKPEGV----FL 201

Query: 182 DDPWSTSIQKRVDIYHIDEIVDWLCTNDS 210
           D     S+++R+ +Y  D+ VD++  +DS
Sbjct: 202 DITEPDSVERRLAVYGKDKDVDYIVVSDS 230

>NDAI0K01870 Chr11 complement(423325..425403) [2079 bp, 692 aa] {ON}
           Anc_2.529 YKL029C
          Length = 692

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 125 ILVYLRIQ----YYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
            +  LR+Q    Y+ LV K   E+ P+    T GD  A      ++H  R    +     
Sbjct: 156 FMTNLRVQNKVLYFALVKKHINELVPIIYTPTEGDAIAA-----YSHRFRKPEGV----F 206

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDS 210
            D     S+++R+ +Y  D+ VD++  +DS
Sbjct: 207 LDITEPDSVEERLSVYGKDKDVDYIVVSDS 236

>Smik_11.224 Chr11 complement(369746..371758) [2013 bp, 670 aa] {ON}
           YKL029C (REAL)
          Length = 670

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 125 ILVYLRIQ----YYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
            +  LR+Q    Y+ L+ K  +E+ P+    T GD  A      ++H  R    +     
Sbjct: 160 FMTSLRVQNKVLYFALIRKHIKELVPIIYTPTEGDAIAA-----YSHRFRKPEGV----F 210

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDS 210
            D     SI++R+  Y  D+ VD++  +DS
Sbjct: 211 LDITEPDSIERRLATYGGDKDVDYIVVSDS 240

>Suva_11.195 Chr11 complement(364534..366546) [2013 bp, 670 aa] {ON}
           YKL029C (REAL)
          Length = 670

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 125 ILVYLRIQ----YYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
            +  LR+Q    Y+ L+ K  +E+ P+    T GD  A      ++H  R    +     
Sbjct: 160 FMTSLRVQNKVLYFALIRKHIKELVPIIYTPTEGDAIAA-----YSHRFRKPEGV----F 210

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDS 210
            D     SI++R+  Y  D+ VD++  +DS
Sbjct: 211 LDITEPDSIERRLATYGGDKDVDYIVVSDS 240

>CAGL0L02035g Chr12 complement(240413..242389) [1977 bp, 658 aa]
           {ON} highly similar to uniprot|P36013 Saccharomyces
           cerevisiae YKL029c MAE1 malic enzyme
          Length = 658

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 77/192 (40%), Gaps = 36/192 (18%)

Query: 50  GETMKHVSKVMIREL---GTCKN-RSTVSGT-ACGTVEFQCLLMKMVEIRPTWSQ----- 99
           GE  K   K   R+L   GT K+ R TV G   C    FQ L   +      ++Q     
Sbjct: 53  GEAAKEYLKQKKRKLQEKGTPKSTRLTVEGVIECPLESFQLLNSPLFNKGSAFTQEEREA 112

Query: 100 --LHLMLQ-----LDDCSEKA--------GPFNNKYIVVLILVYLRIQYYYLVNKGTEEI 144
             L  +L      LD+  E+A         P      +  + V  ++ Y+ LV K   E+
Sbjct: 113 FNLEALLPPQVNTLDEQLERAYKQLCYLKTPLAKNDFMTSLRVQNKVLYFALVRKHIREL 172

Query: 145 KPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINLHDDPWSTSIQKRVDIYHIDEIVDW 204
            P+    T GD          A +    RK + + L D     S++KR+ +Y   + VD+
Sbjct: 173 VPIIYTPTEGDA--------IASYSHRFRKPEGVFL-DITEPNSVEKRLAVYGEAKDVDY 223

Query: 205 LCTNDS--IWGV 214
           +  +DS  I G+
Sbjct: 224 IVVSDSEGILGI 235

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 11/84 (13%)

Query: 25  IPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVMIRELGTCKNRSTVSGTACGTVE-- 82
           +PKI R+R  N +Y K        R   ++ +SK++   +GT  +RS +S     T E  
Sbjct: 256 LPKINRIRKQNMIYQK---DSKIRRVNIVEKISKIIGEIIGTIPSRSILSNGLLSTYEKL 312

Query: 83  FQCLLMKMVEIRPTWSQLHLMLQL 106
           +Q L++      P    + L++QL
Sbjct: 313 YQFLIL------PIMQNVKLIIQL 330

>Skud_11.198 Chr11 complement(361569..363581) [2013 bp, 670 aa] {ON}
           YKL029C (REAL)
          Length = 670

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 125 ILVYLRIQ----YYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180
            +  LR+Q    Y+ L+ K  +E+ P+    T GD  A      ++H  R    +     
Sbjct: 160 FMTSLRVQNKVLYFALIRKHIKELVPIIYTPTEGDAIAA-----YSHRFRKPEGV----F 210

Query: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDS 210
            D     S+++R+  Y  D+ VD++  +DS
Sbjct: 211 LDITEPDSVERRLATYGGDKDVDYIVVSDS 240

>Ecym_2402 Chr2 (782551..784569) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR136C
          Length = 672

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 29/67 (43%)

Query: 151 DTTGDIDAGKIKTLFAHFLRDCRKIKSINLHDDPWSTSIQKRVDIYHIDEIVDWLCTNDS 210
           D  GD       T      R+ R +         W+T + KR+++Y ++ +V  L  ++S
Sbjct: 419 DENGDYSEAAYYTAVMKIPRNLRTMYVHAYQSYVWNTIVSKRIELYGLNVVVGDLVLDNS 478

Query: 211 IWGVPLG 217
           +   PL 
Sbjct: 479 VQETPLA 485

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,312,572
Number of extensions: 944280
Number of successful extensions: 2212
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2210
Number of HSP's successfully gapped: 30
Length of query: 241
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 135
Effective length of database: 41,326,803
Effective search space: 5579118405
Effective search space used: 5579118405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)