Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_52393.165ON46446424630.0
SAKL0C07414g3.165ON48248314940.0
ADR315W3.165ON49243114670.0
Kwal_33.141823.165ON46747314490.0
KLTH0F06534g3.165ON46647914380.0
ZYRO0B04840g3.165ON47648514070.0
TDEL0D045803.165ON48249013880.0
Kpol_1045.443.165ON46947513300.0
CAGL0C05203g3.165ON47549313001e-177
NCAS0C035803.165ON49149612951e-175
YOL062C (APM4)3.165ON49149612851e-174
Smik_15.963.165ON49149612791e-173
KLLA0C03894g3.165ON47547512701e-172
Suva_15.1033.165ON49149612671e-171
Skud_15.913.165ON49149612631e-171
NDAI0G029203.165ON48649012591e-170
KNAG0K011503.165ON47447612281e-166
TBLA0F008403.165ON48148612241e-165
TPHA0P006603.165ON47347812211e-165
KAFR0C010203.165ON4284759791e-129
Ecym_83507.127ON4454696111e-73
SAKL0F05346g7.127ON4474726032e-72
Kwal_55.208437.127ON4414725972e-71
KLTH0F12584g7.127ON4414765911e-70
KAFR0L004707.127ON4654865903e-70
ADL017C7.127ON4434755875e-70
Suva_16.457.127ON4784935896e-70
YPL259C (APM1)7.127ON4754895871e-69
NDAI0E036807.127ON4444725771e-68
NCAS0E021407.127ON4814725792e-68
TPHA0C043207.127ON4544755721e-67
KNAG0L009507.127ON4614795712e-67
TDEL0H028907.127ON4424775674e-67
KLLA0D14311g7.127ON4434715675e-67
CAGL0K00539g7.127ON4564795677e-67
ZYRO0C05236g7.127ON4474695667e-67
TBLA0A009507.127ON4694925679e-67
Smik_6.4667.127ON4764925652e-66
Kpol_1062.567.127ON4504755599e-66
Skud_16.197.127ON4764925557e-65
KLTH0D07502g2.555ON5044843089e-30
SAKL0D13090g2.555ON4994862875e-27
Kwal_26.81462.555ON5054642832e-26
Ecym_45912.555ON5015232574e-23
ABR047W2.555ON4984782512e-22
KAFR0A020602.555ON5403462433e-21
KLLA0F25432g2.555ON5074282415e-21
Skud_8.262.555ON5963592363e-20
TDEL0B064302.555ON5255452343e-20
Kpol_1056.132.555ON5415602292e-19
ZYRO0E05874g2.555ON5493312255e-19
TPHA0I023902.555ON5593522169e-18
Suva_8.332.555ON5963602114e-17
YHL019C (APM2)2.555ON6053612088e-17
Smik_8.232.555ON6033612052e-16
NCAS0A126502.555ON5883532034e-16
CAGL0K03223g2.555ON5983691991e-15
TBLA0B067602.555ON6572241921e-14
NDAI0B016102.555ON6722491848e-14
KNAG0C055502.555ON5821391759e-13
KLTH0D06556g2.522ON4564401571e-10
TBLA0I006202.522ON6092001519e-10
KAFR0D035602.522ON4551361428e-09
Kwal_26.79572.522ON4561421392e-08
TDEL0A029702.522ON4963281349e-08
SAKL0A09218g2.522ON4731361303e-07
AGL061W2.522ON4113171204e-06
ZYRO0B01738g2.522ON4923411204e-06
KLLA0E18789g2.522ON4971381196e-06
Kpol_1018.422.522ON5751501161e-05
TPHA0C041302.522ON5331511053e-04
NCAS0A048702.522ON4891911018e-04
NDAI0K019302.522ON612165950.005
KNAG0A069702.522ON505151880.031
Skud_2.4192.522ON484137840.091
YBR288C (APM3)2.522ON483143820.17
CAGL0L02145g2.522ON543235800.33
NDAI0K00130singletonON32242722.3
KLLA0B10890g3.482ON521107723.0
Skud_10.2691.490ON50197714.0
KAFR0A008401.330ON332103695.0
ZYRO0C17974g1.135ON789112697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_5239
         (464 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   953   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   580   0.0  
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   569   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   562   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   558   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   546   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   539   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   516   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   505   e-177
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   503   e-175
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   499   e-174
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   497   e-173
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   493   e-172
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   492   e-171
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   491   e-171
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   489   e-170
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   477   e-166
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   476   e-165
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   474   e-165
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   381   e-129
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   239   1e-73
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   236   2e-72
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   234   2e-71
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   232   1e-70
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   231   3e-70
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   230   5e-70
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   231   6e-70
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   230   1e-69
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   226   1e-68
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   227   2e-68
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   224   1e-67
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   224   2e-67
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   223   4e-67
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   223   5e-67
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   223   7e-67
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   222   7e-67
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   223   9e-67
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   222   2e-66
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   219   9e-66
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   218   7e-65
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   123   9e-30
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   115   5e-27
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   113   2e-26
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   103   4e-23
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   101   2e-22
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    98   3e-21
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    97   5e-21
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    96   3e-20
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    95   3e-20
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    93   2e-19
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    91   5e-19
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    88   9e-18
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    86   4e-17
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    85   8e-17
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    84   2e-16
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    83   4e-16
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    81   1e-15
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    79   1e-14
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    75   8e-14
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    72   9e-13
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    65   1e-10
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    63   9e-10
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    59   8e-09
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    58   2e-08
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    56   9e-08
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    55   3e-07
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    51   4e-06
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    51   4e-06
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    50   6e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    49   1e-05
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    45   3e-04
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    44   8e-04
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    41   0.005
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    39   0.031
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    37   0.091
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    36   0.17 
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    35   0.33 
NDAI0K00130 Chr11 (14830..15798) [969 bp, 322 aa] {ON}                 32   2.3  
KLLA0B10890g Chr2 (954119..955684) [1566 bp, 521 aa] {ON} simila...    32   3.0  
Skud_10.269 Chr10 (487160..488665) [1506 bp, 501 aa] {ON} YJR051...    32   4.0  
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    31   5.0  
ZYRO0C17974g Chr3 (1401551..1403920) [2370 bp, 789 aa] {ON} high...    31   7.5  

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/464 (100%), Positives = 464/464 (100%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120
           GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP
Sbjct: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120

Query: 121 RDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCLWRSE 180
           RDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCLWRSE
Sbjct: 121 RDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCLWRSE 180

Query: 181 GIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSS 240
           GIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSS
Sbjct: 181 GIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSS 240

Query: 241 NTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFE 300
           NTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFE
Sbjct: 241 NTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFE 300

Query: 301 LMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNA 360
           LMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNA
Sbjct: 301 LMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNA 360

Query: 361 KINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQWSRPPISVR 420
           KINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQWSRPPISVR
Sbjct: 361 KINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQWSRPPISVR 420

Query: 421 FEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464
           FEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY
Sbjct: 421 FEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/483 (60%), Positives = 360/483 (74%), Gaps = 20/483 (4%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M++ALF++S +G+L++SKLI+D IK  V+EIFRIQVINNLDVRSP+LTLGSTTFHHIRS+
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60

Query: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120
             LW+V V+R N DSA IWEFLY FN LLE Y +NSE+SL+ +FM CYE+LD+VL+NG+P
Sbjct: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120

Query: 121 RDTELTHIMPYISKKPLS--ENLLGSDDILNTPSWLVKAGARGMSSENLGLTSK------ 172
            DTEL+ +   +S++P+   EN   +D++L + +  V  G R     N G  S       
Sbjct: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSSSVSSP 180

Query: 173 -------DMCL--WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLS 223
                  D C   WRS GI+YKKNE++LDV E I+ILV+KDG+ILKSYVDGSV    HLS
Sbjct: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS 240

Query: 224 GMPVCQFGFNDYLSPSSNTQSSGNDGWAEEE-NGTKAIKNAITGSVILEDCKFHQCVQLD 282
           G P+CQFG ND LS    T S   D  +E E    KAI  A  GSV LEDCKFHQCVQL+
Sbjct: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300

Query: 283 KFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGK-SVEYRITLKSLFPSK 341
           +F+ +R+IRFVPPDG FELM+YHVRDNLNLPFK+TP+ +      +VEYR+ LKSLFPSK
Sbjct: 301 RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK 360

Query: 342 LCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMG 401
           L AKDV L IP PP TV+ KIN S+G+ +F+PEENA++WK  KY GLTEN  SA+ VPM 
Sbjct: 361 LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD 420

Query: 402 NGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYE 461
           N   SLNL+QWSRPP+S+ FEI MFSNSGLVVR+ KV E+D +Y+TVKWVKYIS+SGAYE
Sbjct: 421 N-QSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGAYE 479

Query: 462 VRY 464
           VRY
Sbjct: 480 VRY 482

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/431 (61%), Positives = 335/431 (77%), Gaps = 9/431 (2%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI A F+++PRG LI+SKLI    K  +SE+FR+QVIN L++RSP+LTLGSTTF HIR++
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120
           GGLW+V V RGN DSA IWEFLY+ NKLL+ Y IN+E++L  DFMLCYE+LD+VLD+G+P
Sbjct: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120

Query: 121 RDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCLWRSE 180
           +DTEL+HI+P +S+KP +      DD LN+ + L + G + +S E L   S+D+C WR E
Sbjct: 121 QDTELSHIVPLLSRKPATGESASGDDFLNS-ARLRRTGTKNVSVETLDHFSRDVCPWRGE 179

Query: 181 GIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSS 240
           GI+YKKNEVYLDV E +S+LVN+DG ILK+YVDG+VQC AHLSGMP+C FGFND     S
Sbjct: 180 GIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFND---SQS 236

Query: 241 NTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFE 300
             Q S    +A    GT   +     SV+LEDCKFHQCVQL+KFDQERVIRFVPPDG FE
Sbjct: 237 LRQRSPRRQYAPRVFGTDERE-----SVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFE 291

Query: 301 LMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNA 360
           LMKYH+RD+L  PFKVTP+V+ +  +S+EYRITL+SLFP+KL AKDVELYIPAPP T++A
Sbjct: 292 LMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISA 351

Query: 361 KINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQWSRPPISVR 420
           K+NVS GK KF+PEENAI+WKIHK+HGLTEN  SAV +    G+ +  L+QW RPPIS++
Sbjct: 352 KVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRPPISMK 411

Query: 421 FEISMFSNSGL 431
            EI MFS + L
Sbjct: 412 LEIMMFSTAAL 422

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/473 (58%), Positives = 352/473 (74%), Gaps = 15/473 (3%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M++ALF+YS RG+L+ISK +K +++  +SEIFRIQVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60

Query: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120
             LW+V VSR N DSA IWEFLY  N+LLE +++ SE+ L+  FM+CYE+LDIVL++G+P
Sbjct: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120

Query: 121 RDTELTHIMPYISKKP---------LSENLLGSDDILNTPSWLVKAGARGMSSENLGLTS 171
            DTEL+ +   +S KP          +EN  G  + +   S  ++      + +++   +
Sbjct: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA 180

Query: 172 KDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFG 231
                WR  GI+YKKNEV+L+V E ISILV+KDG+ILKSYVDG+V+   HLSGMPVC+FG
Sbjct: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240

Query: 232 FNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIR 291
            ND LS S+     G+D   +  N  KAI  A  GSV+LEDCKFHQCVQLDKF  ER I 
Sbjct: 241 LNDALSVST---PFGDDDEYQVTN-KKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 296

Query: 292 FVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYI 351
           F+ PDG FELMKYHVR+NLNLPFKVTP+VT ++  S++Y+IT+KSLFPSKL AKDV+L I
Sbjct: 297 FIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLRI 356

Query: 352 PAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQ 411
           P PP+TV+  I+ S+GK KF+PEE+AIVWK  KY GLTEN  SA  VPM +   +LN+EQ
Sbjct: 357 PVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDS--TLNIEQ 414

Query: 412 WSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464
           W RPPIS++FEI MFSNSGLVVR+  V E+D NY  VKW+KY+SKSGAYEVRY
Sbjct: 415 WPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGAYEVRY 467

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 351/479 (73%), Gaps = 28/479 (5%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M+SALF++S RG+L+ISK ++ ++   +SEIFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120
           G LW+V VSR N DSA IWEFLY  + LLE + ++SE+ L+ DFM CYE+LDIVL++G+P
Sbjct: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120

Query: 121 RDTELTHIMPYISKKP----------LSENLLGSDDILNTPSWLVKAGARGMSSENLGLT 170
            DTEL+ +   +S KP          +     G++ IL    +L    AR  SS      
Sbjct: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFL---RARSSSSNLHDSH 177

Query: 171 SK--DMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVC 228
           SK      WR  GI+YKKNEV+L+V E ISILV+KDG+ILKSYVDG+V+   HLSGMPVC
Sbjct: 178 SKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVC 237

Query: 229 QFGFNDYLSPSSNTQSSGNDGWAEEENGT---KAIKNAITGSVILEDCKFHQCVQLDKFD 285
           +FG ND LS S+         + + E+ T   KAI  A  GSV+LEDCKFHQCVQLDKF 
Sbjct: 238 RFGLNDSLSVST--------PFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ 289

Query: 286 QERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAK 345
            ER I F+PPDG FELMKYHVR+NLNLPFK+TP+VT  K  S++YR+T+KSLFPSKL AK
Sbjct: 290 SERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAK 349

Query: 346 DVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGND 405
           DV+L IP PP+TV+  I+ S+G+ KF+PEE+AI+WK  KY GLTEN  SA  VPM +   
Sbjct: 350 DVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDS-- 407

Query: 406 SLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464
           +LN++QWS+PP+S++FEI MFSNSGLVVR+  V E D NY  VKW+KY+SKSGAYEVRY
Sbjct: 408 ALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEVRY 466

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/485 (58%), Positives = 350/485 (72%), Gaps = 30/485 (6%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+A+F+YS RG+LI+SKL  +++K  +S+IFRIQVINNLDVRSPILTLGSTTFHHIRSN
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117
           G   LW+VTVSR N +S  IWEFLY FN +L+ YD+  E+ L+ DFM+CYEILD+V+   
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 118 GIPRDTELTHIMPYISKKPLSE-------------NLLGSD---DILNTPSWLVKAGARG 161
           GIP DTEL  I   IS KP                N  GS+     L+ P +L +   R 
Sbjct: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNN-RS 179

Query: 162 MSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAH 221
           MS ++LG        WR  GI+YKKNEV+L V E I+ILV++DG+ILK+YVDG++    H
Sbjct: 180 MS-QDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTH 238

Query: 222 LSGMPVCQFGFNDYLSPSSNTQSSGNDGW--AEEENGTKAIKNAITGSVILEDCKFHQCV 279
           LSG P+CQFG ND  SPS      G+  W   +E +  KA+  A  GSV+LEDCKFHQCV
Sbjct: 239 LSGTPICQFGLND--SPSVEF---GDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCV 293

Query: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFP 339
            LDKF++ER+I+FVPPDG  ELMKY VRDNLNLPFK+TP+VT   G +VEYRITLKSLFP
Sbjct: 294 SLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC-GSTVEYRITLKSLFP 352

Query: 340 SKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVP 399
           +KL AKDV L+IP PP TV+ KIN+S+GK KF  EENA+VW+ +KYHGLTEN  SAV VP
Sbjct: 353 NKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVP 412

Query: 400 MGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGA 459
             +    L L+QW RPP+S+ FEI MFSNSGLVVRY +V +KD  Y  VKW+KYISKSG+
Sbjct: 413 TSD-TTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGS 471

Query: 460 YEVRY 464
           YEVRY
Sbjct: 472 YEVRY 476

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 351/490 (71%), Gaps = 34/490 (6%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MISA+ ++S RG+LI++K +K ++K  +S+IFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNG 118
           G   LWLV VSR N +S  IWEFLY  N +++VY +  E +L+ +FM CYEILD VL+ G
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 119 -IPRDTELTHIMPYISKKP---LSENLLGSDDIL-----------------NTPSWLVKA 157
            IP DTEL  ++  ++ KP   +S NLL   D+L                 + P +L + 
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180

Query: 158 GARGMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217
             R MS ++LG        WR  GI+YKKNEV L+V E ISILV++DG+ILKSYVDG++ 
Sbjct: 181 N-RSMS-QDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTID 238

Query: 218 CVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEEN--GTKAIKNAITGSVILEDCKF 275
              HLSGMP+CQFG ND LS        G+D  +E E+    KAI  A  G V+LEDCKF
Sbjct: 239 LTTHLSGMPICQFGLNDSLS-----VEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKF 293

Query: 276 HQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTL-KGKSVEYRITL 334
           HQCV LDKF+++RVI+FVPPDG  ELMKY VRDNLNLPFKVTP+VT++ +G +++YR+TL
Sbjct: 294 HQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTL 353

Query: 335 KSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFS 394
           KSLFP KL AKDV L IP PP TV+ +INVS+GK KF+PEE+A++WK  KY GLTEN  S
Sbjct: 354 KSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLS 413

Query: 395 AVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYI 454
           AV VP  +    L ++QW RPP+S+ FEI MFSNSGLVVRY KV +KD  Y T KW+KYI
Sbjct: 414 AVTVPSSD-TTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYI 472

Query: 455 SKSGAYEVRY 464
           SKSG+YE+RY
Sbjct: 473 SKSGSYEIRY 482

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/475 (55%), Positives = 342/475 (72%), Gaps = 17/475 (3%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ + +Y+ +G+LI+SK  K N K  +S+IFR+QVINNLDVRSPILTLGSTTFHHIRSN
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  G--GLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117
               LWLV V+R N +S  IWEFLY F+ LL  + +++E +L+ +FM CYE+LD++L+ +
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 118 GIPRDTELTHIMPYISKKPLSE------NLLGSDDILNTPSWLVKAGARGMSSENLGLTS 171
           G+P DTEL+ +   +S KPL        + L +     + S  +    R MS + +  T 
Sbjct: 121 GVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDTMN-TE 179

Query: 172 KDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFG 231
                WR  GI+YKKNE++L++ E ISILV+KD  ILK+YVDG+V   +HLSG P CQFG
Sbjct: 180 PSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTCQFG 239

Query: 232 FNDYLS-PSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVI 290
            ND LS    N  +S ++G+  ++N    I  A  G+V+LEDCKFH+CV LDKF+++R+I
Sbjct: 240 LNDSLSVDEPNYYNSDDNGFRNQQN----IPRATAGTVVLEDCKFHECVSLDKFNRDRII 295

Query: 291 RFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKS-VEYRITLKSLFPSKLCAKDVEL 349
           +FVPPDG  ELMKYHVRDN+NLPFKVTP V   + ++ ++YRITLKSLFPSKL A DV L
Sbjct: 296 KFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSANDVVL 355

Query: 350 YIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNL 409
            IP P  TV+ K+NVS+GK +F+PEE+ I+WK  KY+GLTEN  SAV V   N    L L
Sbjct: 356 KIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVS-SNDTTQLML 414

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464
           +QW+RPPIS+ FEI MFSNSGLVVRYLK+MEKD  Y TVKW+KYIS+SG+YEVRY
Sbjct: 415 QQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSGSYEVRY 469

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  505 bits (1300), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 261/493 (52%), Positives = 341/493 (69%), Gaps = 47/493 (9%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MISA+ ++S RG+LI+SK  K+N+K  +S+IFRIQVINNLDVRSPILTLGSTTF HIRSN
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  ---GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVL-D 116
                LWLV+V+R N +   +WEFLY F+ +LE+Y +N+E+ L+ +FM+CYE+LD++L +
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 117 NGIPRDTELTHIMPYISKKPLSEN---------------------LLGSDDILNTPSWLV 155
           NG P DT+   ++  +S KP  E                      L  +   LN  S   
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQESSNN 180

Query: 156 KAGARGMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGS 215
            +GA  M+ E           WR +GI +KKNE++L V E ISILV+K+G+ILKSYVDG+
Sbjct: 181 SSGAFNMAGE---------LPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGT 231

Query: 216 VQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEEN---GTKAIKNAITGSVILED 272
           +  V HLSG PVCQFG ND LS         ND + +  +     KAI  A  GSV+LED
Sbjct: 232 IDLVTHLSGTPVCQFGLNDSLS-------VKNDDYGDSFDYIKNKKAIPKAAAGSVLLED 284

Query: 273 CKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSVEYR 331
           CKFHQCV L+KFD++R+I+FVPPDG  ELMKYHVR N+NLPFKV+P+VT +  G +VEYR
Sbjct: 285 CKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYR 344

Query: 332 ITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTEN 391
           ITLKSLFPSKL AK+V + IP PP+T++ KI+VS+G  KF PEE A++W  +KY+GLTEN
Sbjct: 345 ITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTEN 404

Query: 392 VFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWV 451
             SAV +   +    LN++QW +PPIS+ FEI MFSNSGLVVRY  + E +  Y TVKW+
Sbjct: 405 TLSAVTITSKDA-PRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWI 462

Query: 452 KYISKSGAYEVRY 464
           +Y+SKSG+YE+RY
Sbjct: 463 RYVSKSGSYEIRY 475

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  503 bits (1295), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 260/496 (52%), Positives = 351/496 (70%), Gaps = 37/496 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+AL +++ RG+L++SKL K ++K  +++IFRIQVINNLDVRSPILTLGSTTFHHI+S 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVL--D 116
            G  LW+V VSR N DSA IWEFLY  + LL+ Y +N E+ L+ +FM+ +E+LD+++   
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 117 NGIPRDTELTHIMPYISKKPLSENLLGSD-------------------DILNTPSWLVKA 157
            GIP  TE + ++  +S KP S+++L +                    D+L +   L++ 
Sbjct: 121 GGIPMLTENSLVISRMSVKP-SKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLRR 179

Query: 158 GARGMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217
            +  +S +   LT      WR +GI +KKNEV L V E I+ILV+KDG++LK+YVDGS+ 
Sbjct: 180 NSASLSQDLSILTDFK---WRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSID 236

Query: 218 CVAHLSGMPVCQFGFNDYLSPS---SNTQSSGNDGWAE-----EENGTKAIKNAITGSVI 269
              HLSG P+CQFG ND LS S   S+   S N          ++   K +  A  GSVI
Sbjct: 237 LETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSVI 296

Query: 270 LEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSV 328
           LEDCKFHQCV LDKFD++R+I+FVPPDG  ELMKYHVRDNLNLPFKV+P+VT T  G ++
Sbjct: 297 LEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGTAL 356

Query: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGL 388
           EYRIT+KSLFP +L AK+V L+IP PP+T++ KINV++G  KFIPEE+A++W+ +K++GL
Sbjct: 357 EYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNGL 416

Query: 389 TENVFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTV 448
           TEN  SAV +P  + N  L+L+QWS+PP+S+ FEI MFSNSGLVVRY  + E+D  Y  V
Sbjct: 417 TENTLSAVTIPTKD-NTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYKAV 475

Query: 449 KWVKYISKSGAYEVRY 464
           KW+KYIS+SG+YE+RY
Sbjct: 476 KWIKYISRSGSYEIRY 491

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  499 bits (1285), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 257/496 (51%), Positives = 339/496 (68%), Gaps = 37/496 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIS + +YS RG+L+++K  K+++K  +S+IFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117
            G  LWLVT++R N +SA IWEFLY  + ++  Y ++ E++L+ +FM+ +E+LDI+L  N
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GIPRDTELTHIMPYISKKPLSE--NLLGSDD----------------ILNTPSWLVKAGA 159
           GIP DTEL  ++  +S KP+     LL S D                 L+ P +L K  +
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKRSS 180

Query: 160 R--GMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217
              G           +   WR +GI +KK+EV+L V E I+ILV++DG+ILKSYVDG++ 
Sbjct: 181 SFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTID 240

Query: 218 CVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEEN-------GTKA-IKNAITGSVI 269
              HLSG P+C+FG ND L      QS     W  ++        G K  I  A  GSV+
Sbjct: 241 ITTHLSGTPICRFGLNDSLG----MQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSVL 296

Query: 270 LEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSV 328
           LEDCKFH+CV LDKF++  +I FVPPDG  ELMKYHVRDN+NLPFKVTP+VT + +   +
Sbjct: 297 LEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEI 356

Query: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGL 388
           +YRITLKSLFP KL AKDV L+IP PP TV+ KI+VS+G  KF+PEENA++W+ +KY+GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGL 416

Query: 389 TENVFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTV 448
           TEN  SAV V   +    LNL+QW+RPPIS+ FE+ MFSNSGLVVRY  +  KD  +  V
Sbjct: 417 TENTLSAVTVSTSD-TTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 449 KWVKYISKSGAYEVRY 464
           KW+KYISK+G+YEVRY
Sbjct: 476 KWIKYISKAGSYEVRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  497 bits (1279), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 253/496 (51%), Positives = 343/496 (69%), Gaps = 37/496 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIS + +YS RG+L+++K  K+++K  +S+IFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117
            G  LWLVT++R N +SA IWEFLY  + ++  Y ++ E++L+ +FM+ +E+LDI+L  N
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GIPRDTELTHIMPYISKKPL--SENLLGSDD----------------ILNTPSWLVKAGA 159
           GIP DTEL  ++  +S KP+  +  LL S D                 L+ P +L K+ +
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKKSSS 180

Query: 160 R--GMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217
              G           +   WR +GI +KK+EV+L V E ++ILV++DG+ILKSYVDG++ 
Sbjct: 181 SFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 218 CVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGW-AEEENGTKA-------IKNAITGSVI 269
              HLSG P+C+FG ND L      QS     W A++++ ++        I  A  GSV+
Sbjct: 241 ITTHLSGTPICRFGLNDSLG----MQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVL 296

Query: 270 LEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSV 328
           LEDCKFH+CV LDKF++   I FVPPDG  ELMKYHVRDN+NLPFK+TP+VT + +   +
Sbjct: 297 LEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEI 356

Query: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGL 388
           +YRITLKSLFP KL AKDV L+IP PP TV+ KI+VS+G  KF+PEENA++W+ +KY+GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGL 416

Query: 389 TENVFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTV 448
           TEN  SAV V   +    LNL+QW+RPP+S+ FE+ MFSNSGLVVRY  +  KD  +  V
Sbjct: 417 TENTLSAVTVSTSD-TTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAV 475

Query: 449 KWVKYISKSGAYEVRY 464
           KW+KYIS+SG+YEVRY
Sbjct: 476 KWIKYISRSGSYEVRY 491

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  493 bits (1270), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 251/475 (52%), Positives = 328/475 (69%), Gaps = 11/475 (2%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHI--- 57
           M+SA+F+Y+ +GDL+ISKLIKD++K  ++++FR QVIN+  VRSPILTLGSTTF H+   
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 58  -RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD 116
              N  +WLV VSR N DS+ IWE+L+   +L+E + IN ED L+ +FML YEIL++ L+
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 117 NGIPRDTELTHIMPYISKKPLSENLLGS----DDILNTPSWLVKAGARGMSSENLGLTSK 172
           NGIP+ T+L  I+P +S+KP+  N +      DD L+  + L        SS ++ L+S 
Sbjct: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIALSSL 180

Query: 173 DMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGF 232
             C WR  G++YKKNEVYLD+ E I+ILV KDG+I+KS+VDGSV CV+HLSGMP+CQ G 
Sbjct: 181 SECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGL 240

Query: 233 NDYLSPSSNTQSSGNDGWAEEE---NGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERV 289
           ND  S   N +S  +      E      KAI NA  GSVILEDCKFHQCVQL+K++   V
Sbjct: 241 NDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQLNKYEANHV 300

Query: 290 IRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVEL 349
           I+FVPPDG F+LM+Y V DN+N+PF V P V  +K  ++ Y++TL+SLFPS + AKDV +
Sbjct: 301 IQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTV 360

Query: 350 YIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNL 409
            IP PP T+    NVS GK K+   E  +VWK +KY G TEN  S  +      +D  +L
Sbjct: 361 KIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLSDL 420

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464
            +WSRPPIS+ FEI MFSNSGLVVR+LK  E  LNY  VKW+KYIS SGAYE+RY
Sbjct: 421 LRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGAYEIRY 475

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  492 bits (1267), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 252/496 (50%), Positives = 340/496 (68%), Gaps = 37/496 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIS + +YS RG+LI++K  K+++K  +S+IFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117
            G  LWLVT++R N +SA IWEFLY  + ++  Y ++ E++L+ +FM+ +E+LDI+L  N
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GIPRDTELTHIMPYISKKPLSE--NLLGSDDI----------------LNTPSWLVKAGA 159
           GIP DTEL  ++  +S KP+     LL S D                 L+ P +L K  +
Sbjct: 121 GIPIDTELNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFLKKRSS 180

Query: 160 R--GMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217
              G    +   +  +   WR +GI +KK+EV+L V E ++ILV++DG+ILKSYVDG++ 
Sbjct: 181 SFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 218 CVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEE-----NG---TKAIKNAITGSVI 269
              HLSG PVC+FG ND L      QS   + W  ++     NG         A  GSV+
Sbjct: 241 ITTHLSGTPVCRFGLNDSLG----MQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSVL 296

Query: 270 LEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSV 328
           LEDCKFH+CV +DKF++  +I FVPPDG  ELMKYHVRDN+NLPFK+TP+V  + +   V
Sbjct: 297 LEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEV 356

Query: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGL 388
           +YRITLKSLFP KL AKDV L+IP PP TV+ KI+VS+G  KF+PEENA++W+ +K++GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGL 416

Query: 389 TENVFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTV 448
           TEN  SAV V   +    L+L+QW+RPP+S+ FE+ MFSNSGLVVRY  +  +D  +  V
Sbjct: 417 TENTLSAVTVSTSD-TTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAV 475

Query: 449 KWVKYISKSGAYEVRY 464
           KW+KYISKSG+YEVRY
Sbjct: 476 KWIKYISKSGSYEVRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  491 bits (1263), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 252/496 (50%), Positives = 345/496 (69%), Gaps = 37/496 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIS + +YS RG+LI++K  K+++K  +S+IFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117
            G  LWLVT++R N +SA IWEFLY  + ++  Y ++ E++L+ +FM+ +E+LDI+L  N
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GIPRDTELTHIMPYISKKPLSEN---LLGSD--DILNTPSWLVKAGA--------RGMSS 164
           GIP DTEL  ++  +S KP+      L G+D  DIL++ S    AG         +  SS
Sbjct: 121 GIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLKKSSS 180

Query: 165 ENLG-------LTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQ 217
             LG           +   WR+ GI +KK+EV+L V E ++ILV++DG+ILKSYVDG++ 
Sbjct: 181 SFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 218 CVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGW-AEEENGTKA-------IKNAITGSVI 269
            V HL+G PVC+FG ND L      QS     W A++   +++       +  A  GSV+
Sbjct: 241 IVTHLNGTPVCRFGLNDSLG----MQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVL 296

Query: 270 LEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSV 328
           LEDCKFH+CV ++KF++  +I F+PPDG  ELMKYHVRDN+NLPFK+TP+V+ + +   +
Sbjct: 297 LEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEI 356

Query: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGL 388
           +YRITLKSLFP KL AKDV L+IP PP TV+ KI+VS+G  KF+PEENA++W+ +KY+GL
Sbjct: 357 DYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGL 416

Query: 389 TENVFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTV 448
           TEN  SA  V   +    L+ +QW+RPP+S+ FE+ MFSNSGLVVRY  +  KD  +  V
Sbjct: 417 TENTLSAATVSTSD-TTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 449 KWVKYISKSGAYEVRY 464
           KW+KYISKSG+YEVRY
Sbjct: 476 KWIKYISKSGSYEVRY 491

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  489 bits (1259), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 254/490 (51%), Positives = 337/490 (68%), Gaps = 30/490 (6%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ + +YSPRG+LI+SKL K  +K  +++IFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  ---GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDN 117
                LWLV  +R N +SA IWEFLY  + +L  Y +N E+ L+ +FM+ +E+LD++L +
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 118 -GIPRDTELTHIMPYISKKP----------LSENLLGS--DDILNTPSWLVKAGARGMSS 164
            GIP +TE + ++  +S KP          L +  LGS  ++ ++ P +L +  +     
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHD 180

Query: 165 ENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSG 224
            N          WR + I++KKNEV L V E I+ILV KDG+ILK+YVDGS+     LSG
Sbjct: 181 SNFSFNDFS---WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSG 237

Query: 225 MPVCQFGFNDYLSPSSN-TQSSGNDGWAEEENGT--------KAIKNAITGSVILEDCKF 275
            PVCQFG ND L+  SN ++ S  +G       +        K +  A  G+VILEDCKF
Sbjct: 238 TPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKF 297

Query: 276 HQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSVEYRITL 334
           HQCV LDKFD+ER+I+FVPPDG  ELMKYH+R+NLNLPFK+TP+VT ++ G +++YRI L
Sbjct: 298 HQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIAL 357

Query: 335 KSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFS 394
           KSLFP +L AK V L+IP PP  ++  I+VS+G  KF+P ENA+VWK +KY+GLTEN  S
Sbjct: 358 KSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLS 417

Query: 395 AVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYI 454
           AV VP    N +  L+QW+RPP+S+ FEI MFSNSGLVVRY  + E   NY  VKW+KY+
Sbjct: 418 AVTVPSKEVNQT-TLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYV 476

Query: 455 SKSGAYEVRY 464
           SKSG+YEVR+
Sbjct: 477 SKSGSYEVRF 486

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  477 bits (1228), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 244/476 (51%), Positives = 328/476 (68%), Gaps = 14/476 (2%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+A+ +YS RG+LI+SK+ K  +K  V +IFR+QVIN+LDVRSPILTLGSTTFH++R+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 61  G-GLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-NG 118
           G GLW+V+VSR N +SA  WEFLY F  +L  Y ++SE+ L+ +FML +E+LD +++  G
Sbjct: 61  GEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGGG 120

Query: 119 IPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD----- 173
           IP +T+   I+  +S KP    +    D     +     GA G +   L   + +     
Sbjct: 121 IPSETDPHRIISAMSVKPAMSPVDVRADARQQQT-TTSTGAFGHAFPQLLHRASNPGGIS 179

Query: 174 -MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGF 232
            +     +G + K+NE+ + V E ISILV+KDG+ILK+YVDG +     L G  VCQFG 
Sbjct: 180 ILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVCQFGL 239

Query: 233 NDYLSPSSNTQSSGNDGWAEEENGTK-AIKNAITGSVILEDCKFHQCVQLDKFDQERVIR 291
           ND LS  +++ S  +   ++E  GT   +KNA  G+V+L DCKFHQCV L++FD++R+IR
Sbjct: 240 NDSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFDRDRIIR 299

Query: 292 FVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYI 351
           F PP+G  ELMKYHVRDNLNLPFKVT MV        +YR+T+KSLFP KL AK+V + I
Sbjct: 300 FTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKLSAKNVTMRI 359

Query: 352 PAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQ 411
           P PP T++ KINVS+G  KF+PEENA+VWK HKY+GLTEN  SA+ VP  +    L L+Q
Sbjct: 360 PVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSAITVPTRD-TTQLALQQ 418

Query: 412 WSRPPISVRFEISMFSNSGLVVRYLKVMEKDLN---YNTVKWVKYISKSGAYEVRY 464
           WSRPPIS+ FEI M+SN+GLVVRY  V++K  N   + TVKW+KY+S SG+YEVRY
Sbjct: 419 WSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSGSYEVRY 474

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  476 bits (1224), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 240/486 (49%), Positives = 330/486 (67%), Gaps = 27/486 (5%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+A+ +++PRG+L++ K+ K ++K  +S+IFR+QVINN ++RSPILTLGSTTFH IR+ 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117
            G  LWLV V+R N DS  IWE+LY  N L+EVY +  ED L+ +F++C+E+LDI L  N
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 118 GIPRDTELTHIMPYISKKPLSENLLGSD--DILNT--------------PSWLVKAGARG 161
           G+P DTEL+ ++  ++ KP       +D  DIL +              P +L +   R 
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNSNRS 180

Query: 162 MSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAH 221
           ++ E     S     WRS  I+YKKNE+ ++V E I++LV KD  IL++YVDG++   AH
Sbjct: 181 VTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTIDITAH 240

Query: 222 LSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTK--AIKNAITGSVILEDCKFHQCV 279
           LSGMP+CQ G ND     S  Q   N  W  E+  +   A+ +     VILE  KFHQCV
Sbjct: 241 LSGMPMCQIGMNDL----STIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFHQCV 296

Query: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSVEYRITLKSLF 338
            LDK++++ VI F+PPDG FELMKYHV +NLNLPF++TP VT T  G ++ Y I LKSLF
Sbjct: 297 ALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLKSLF 356

Query: 339 PSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIV 398
           P KL A++V L IP PP T++ KIN S GK KFIPEEN +VW  H+++G TEN  +A  V
Sbjct: 357 PRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQTV 416

Query: 399 PMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG 458
           P      S +++QW+RPP+S+ F++ MFSN+GL+VRYLKV EK+++YNT+KW+KYIS +G
Sbjct: 417 PT-QSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISAAG 475

Query: 459 AYEVRY 464
           +YEVRY
Sbjct: 476 SYEVRY 481

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  474 bits (1221), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 246/478 (51%), Positives = 333/478 (69%), Gaps = 19/478 (3%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ + +YS RGDLI+  L+K ++K  +S+IF+IQVIN+L+++SPILTLGSTTFHHIRS+
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  G--GLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVL-DN 117
               LW+V ++R N +S  IWEFLY  + +L  YD+N+E+ L   FM+ YE++D++L  N
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 118 GIPRDTELTHIMPYISKK--------PLSENLLGSDDILNTPSWLVKAGARGMSSENLGL 169
            +P +TEL+ I   IS +        P +E    +++ L+ P +L +  +R MS E   +
Sbjct: 121 AMPINTELSSIASKISYRLPKTISNSPTNEK--NNNNGLSIPKFLTR-NSRSMSQEFSNI 177

Query: 170 TSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQ 229
           T  D+  WR  GI+YKKNEV+L V E I+ILV+KD  ILK+YVDGS+  V+HLSG P+CQ
Sbjct: 178 TQSDIP-WRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQ 236

Query: 230 FGFNDYLSPSSNTQSSGNDGWAEE--ENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQE 287
           FG NDYLS + N  S+  D +  +  ++   +   + + SV +EDC FHQCV LDKF+ E
Sbjct: 237 FGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFNDE 296

Query: 288 RVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGK-SVEYRITLKSLFPSKLCAKD 346
           R+I FVPPDG FELM+YHVRD+LN+PFKVTP V+    + S+ Y+I LKSLFP+ L A D
Sbjct: 297 RLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSAAD 356

Query: 347 VELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDS 406
             L IP PP TV+ KIN SSGK  F   +N  +WK +KY GLTEN      VP  +  D 
Sbjct: 357 AMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETVP-SSSTDI 415

Query: 407 LNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYEVRY 464
           L+L+QW+RPP+S+ FEI MFSNSGLVV+YLKVME+   Y  VKW+KY+SKSG+YE+RY
Sbjct: 416 LSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSGSYEIRY 473

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  381 bits (979), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/475 (44%), Positives = 303/475 (63%), Gaps = 58/475 (12%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MISA+ +Y+PRG+LI+SKL ++NIK  +SEIFRIQVINN +VRSPILTLGSTTFHHIRS 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  GG------LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILD-I 113
                   LWLV V+R N +SA IWEFL   N +L+ Y I SE  L+ +FM  +EILD +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 114 VLDNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSS--ENLGLTS 171
           +L  GI ++T+L  I+  +S KP+S     +++  +T +  +K     +++   N  L  
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISR----TNETTSTQTGFLKRRNTILTTPGANFSLIP 176

Query: 172 KDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFG 231
            +    R +   +KKNE++  V E +++LV+KDG+ILK+YVDG ++  +HL+G P CQF 
Sbjct: 177 TN----RHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFE 230

Query: 232 FNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIR 291
             D                    + TK           + D KF QC++     Q R +R
Sbjct: 231 LVD--------------------DQTK-----------ITDFKFDQCIEK---VQSRTVR 256

Query: 292 FVPPDGLFELMKYHVRDN-LNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELY 350
               DG  E++ YHVRD+ +N+PFK+TP+V+T+K  +V+YRI+LKSLFP  L A DV L 
Sbjct: 257 VAATDGELEIVNYHVRDDKINIPFKITPIVSTVKD-TVDYRISLKSLFPKNLSATDVVLT 315

Query: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLE 410
           IP PP+T++ KINVS+G  KF  E+NA++W  +K++G TEN  SA+ +   +G   +NLE
Sbjct: 316 IPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITI--ADGRQIMNLE 373

Query: 411 QWSRPPISVRFEISMFSNSGLVVRYLKVMEKD-LNYNTVKWVKYISKSGAYEVRY 464
            W+RP I + FEI+M+S SGL++R L + +KD   Y   +W+KYIS++G+YE+R+
Sbjct: 374 SWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAGSYEMRF 428

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  239 bits (611), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/469 (32%), Positives = 251/469 (53%), Gaps = 42/469 (8%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVI---NNLDVRSPILTLGSTTFHHI 57
           M S ++    +G L++S+  KD+I +   E F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           + N  L+++T++R    + A ++ FL+    +L+ Y  +  E+S++ +F++ YE+LD V+
Sbjct: 61  QHND-LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119

Query: 116 DNGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD 173
           D+GIP+ T+   +  YI++K   L  +     +++  PS L  A +              
Sbjct: 120 DSGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVS-------------- 165

Query: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233
              WR EGI+YKKNE +LDV E I++++ + G +L+S + G V+  + LSGMP  + G N
Sbjct: 166 ---WRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222

Query: 234 DYLSPSSNTQSSGNDGWAEEENGTKAIKNAIT---GSVILEDCKFHQCVQLDKFDQERVI 290
           D       TQS+      EEE    + + +IT    ++ LED KFHQCV+L KF+ E++I
Sbjct: 223 D---KGIFTQSN------EEEEDEPSSQPSITRKKSNIELEDLKFHQCVRLSKFENEKII 273

Query: 291 RFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELY 350
            F+PPDG FELM Y +   +         +       VE     K+   +K  A +VE+ 
Sbjct: 274 TFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEIL 333

Query: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNL 409
           IP P D  + K   S G  K++PE+NAI+WKI  + G  +   +A + +P  N     N 
Sbjct: 334 IPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNF 393

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG 458
           ++    P+ ++F+I  F+ SG+ VRYLK+ E  L YN+  WV+YI++SG
Sbjct: 394 KR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSG 438

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  236 bits (603), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 157/472 (33%), Positives = 253/472 (53%), Gaps = 36/472 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS---PILTLGSTTFHHI 57
           M S ++    +G  I+S+  KD+I     + F + ++      S   P L      +  +
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           + N  L+++T++R  +T+ A ++ FLY   ++L  Y  +  E+S++ +F++ YE+LD ++
Sbjct: 61  QHND-LYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMM 119

Query: 116 DNGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD 173
           D GIP+ TE   +  YI++K   L ++   S +++  P  L  + +              
Sbjct: 120 DYGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVS-------------- 165

Query: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233
              WR EGI YKKNE +LDV E I++L+ + G +L+S + G V+  +HLSGMP  + G N
Sbjct: 166 ---WRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLN 222

Query: 234 DYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293
           D     SN  S G +  A++ + T   K     ++ LED KFHQCV+L KF+ E++I F+
Sbjct: 223 DK-GIFSNHVSGGVEDEADDLSATGKKK----ANIELEDLKFHQCVRLSKFENEKIITFI 277

Query: 294 PPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKS-VEYRITLKSLFPSKLCAKDVELYIP 352
           PPDG FELM Y +   +  P     +   +  KS +E     K+    K  A +VE+ IP
Sbjct: 278 PPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIP 336

Query: 353 APPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQW 412
            P D  + K   S G  K+ PE+NAI+WKI  + G  E   +A    +G  + S   E  
Sbjct: 337 VPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAA---QLGLPSVSDFEEPV 393

Query: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
            + P+ V+F+I  F+ SG+ VRYLK+ E  + Y +  WV+YI++SG  Y +R
Sbjct: 394 MKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIR 445

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  234 bits (597), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/472 (32%), Positives = 252/472 (53%), Gaps = 42/472 (8%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M S ++     G +I+S+  +D++     E F    ++      V  P LT     +  I
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           + N  ++++T+SR  + + A ++ FLY   ++L  Y     E+S++ +F++ YE+LD +L
Sbjct: 61  QHND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119

Query: 116 DNGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD 173
           D GIP+ TE   +  YI++K   L +++  S +++  P+ L K+ +              
Sbjct: 120 DYGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVS-------------- 165

Query: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233
              WR EGI YKKNE +LDV E I++L+   G +L+S + G V+  + LSGMP  + G N
Sbjct: 166 ---WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222

Query: 234 DYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293
           D       ++  GN+  AE  +G K+       ++ LED +FHQCV+L KF+ E++I F+
Sbjct: 223 D--KGIFTSEEGGNN--AEGGSGKKS-------NIELEDLQFHQCVRLSKFENEKIISFI 271

Query: 294 PPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPA 353
           PPDG F+LM Y +   +         +       +E     K+    K  A +VE+ IP 
Sbjct: 272 PPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPV 331

Query: 354 PPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNLEQW 412
           P D  + K   S G  K++PE++AI+W+I  ++G  E  F+A + +P       + + + 
Sbjct: 332 PEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLP---SMTDVEVPKA 388

Query: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
            R PI V+F+I  F+ SG+ VRYLKV E  L Y +  WV+YI++SG  Y +R
Sbjct: 389 KR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  232 bits (591), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/476 (32%), Positives = 246/476 (51%), Gaps = 50/476 (10%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M S ++    +G +I+S+  +D++     E F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           + N  ++++T+SR  + + A ++ FLY   ++L  Y     E+S++ +F++ YE+LD +L
Sbjct: 61  QHND-IYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEML 119

Query: 116 DNGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD 173
           D GIP+ TE   +  YI++K   L ++   S +++  PS L K+ +              
Sbjct: 120 DYGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVS-------------- 165

Query: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233
              WR EGI YKKNE +LDV E I++L+   G +L+S + G V   + LSGMP  + G N
Sbjct: 166 ---WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLN 222

Query: 234 D---YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVI 290
           D   + S  S + S   +G                 ++ LED KFHQCV+L KF+ E++I
Sbjct: 223 DKGIFTSVESASSSEATEGKK--------------SNIELEDLKFHQCVRLSKFENEKII 268

Query: 291 RFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELY 350
            F+PPDG FELM Y +   +         +       +E     K+    K  A +VE+ 
Sbjct: 269 TFIPPDGDFELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEIL 328

Query: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLE 410
           IP P D  + K   S G  K++PE++AI+WKI  ++G  E  F+A +     G  S+   
Sbjct: 329 IPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQL-----GLPSMTDA 383

Query: 411 QWSRP--PISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
           +  R   PI V+F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 384 EVPRAKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  231 bits (590), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 151/486 (31%), Positives = 254/486 (52%), Gaps = 45/486 (9%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA++    +G  ++S+  +D+I L   + F   ++++ +  S    P ++     +  
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           I+ N        +    + + I+ FL+    +L+ Y     E+S++ +F++ YE+LD ++
Sbjct: 60  IQHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D G+P+ TE   +  YI+ K                  L KA  +  ++        +  
Sbjct: 120 DYGLPQITETKMLKKYITTKSFK---------------LEKAHKKKRNAARPPTELTNSV 164

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234
            WR EGI+YKKNE +LD+ E I++L+ + G +L+S + G+V+  + LSGMP  + G ND 
Sbjct: 165 SWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDR 224

Query: 235 -----YLSPSS-NTQSSGNDGWAEEENGTKAI----KNAITGSVILEDCKFHQCVQLDKF 284
                YL  ++     +G+D  A++ N   +I     N    ++ LED KFHQCV+L KF
Sbjct: 225 GIFTKYLEGNNIGIAKNGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKF 284

Query: 285 DQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMV---TTLKGKSVEYRITLKSLFPSK 341
           + E++I F+PPDG F+LM Y       L   + P++    +++   +E     K+    K
Sbjct: 285 ENEKIISFIPPDGEFDLMNYR------LSTSIKPLIWCDVSIQTYRIEIHCKAKAQIKKK 338

Query: 342 LCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPM 400
             A +VE+ IP P D  +     S GK K++PE+N ++WKI  + G  E   +A + +P 
Sbjct: 339 SIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPS 398

Query: 401 GNGNDSLN--LEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG 458
            +G D LN  +   S+ P+ V+F+I  F+ SG+ VRYLKV E  L Y T  WV+YI++SG
Sbjct: 399 ISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSG 458

Query: 459 -AYEVR 463
             Y +R
Sbjct: 459 DDYTIR 464

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  230 bits (587), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 153/475 (32%), Positives = 250/475 (52%), Gaps = 45/475 (9%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M S ++    +G L++S+  KD+I     E F    I+      V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           + N  L+++T+++  + + A ++ +L+   ++LE Y  +  E+S++ +F++ YE+LD ++
Sbjct: 61  QHND-LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D+GIP+ T+   +  YI++K                  L+++  +  +      T  +  
Sbjct: 120 DHGIPQITDTKMLRQYITQKSFK---------------LIRSAKKKKNVVRPPATLTNSV 164

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
            WR EGI YKKNE +LDV E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 165 SWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLND- 223

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPP 295
                  Q   +D       GTK   N     + LED KFHQCV+L KF+ E++I F+PP
Sbjct: 224 --KGIFAQGDDDDDEEGASGGTKKKSN-----IELEDLKFHQCVRLTKFENEKIITFIPP 276

Query: 296 DGLFELMKYHVRDNLNLPFKVTPMV---TTLKGKS---VEYRITLKSLFPSKLCAKDVEL 349
           DG FELM Y     L+ P K  P++     L+  S   +E     K+    K  A +VE+
Sbjct: 277 DGDFELMSYR----LSTPIK--PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEI 330

Query: 350 YIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNL 409
            IP P D  + K   S G  K++P +NAI+WKI  + G  +   +A    MG  + S N 
Sbjct: 331 LIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA---EMGLPSVSDNS 387

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
           +   + P+ ++F+I  F+ SG+ VRYLK+ E  + YN+  WV+YI++SG  Y +R
Sbjct: 388 DHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIR 442

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  231 bits (589), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 155/493 (31%), Positives = 255/493 (51%), Gaps = 47/493 (9%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA++     G  ++S+  +D+I L   + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIV 114
           I+ N  L+LV ++   + ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD V
Sbjct: 60  IQHND-LYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LDNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDM 174
           +D GIP+ TE   +  YI++K                  LVK+  +  ++    +   + 
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFK---------------LVKSAKKKRNATRPPVALTNS 163

Query: 175 CLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND 234
             WR EGI +KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND
Sbjct: 164 VSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIND 223

Query: 235 ------YLSPSSNTQSSGNDGWAEEENGTKAIKN-AITGS---------VILEDCKFHQC 278
                 YL  SSN   + +   ++ +      K  +IT S         + LED KFHQC
Sbjct: 224 KGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQC 283

Query: 279 VQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLF 338
           V+L KF+ E++I F+PPDG F+LM Y +   +         V       +E     K+  
Sbjct: 284 VRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQI 343

Query: 339 PSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI- 397
             K  A +VE+ IP P D        S G  K++PE++AI+WK+  + G  E   SA + 
Sbjct: 344 KRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELG 403

Query: 398 VP-MGNGNDS-----LNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWV 451
           +P + NGND       N  +  + P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV
Sbjct: 404 LPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWV 463

Query: 452 KYISKSG-AYEVR 463
           +YI++SG  Y +R
Sbjct: 464 RYITQSGDDYTIR 476

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  230 bits (587), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 150/489 (30%), Positives = 253/489 (51%), Gaps = 42/489 (8%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA++     G  ++S+  +D+I L   + F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           I+ N    +  V+  + ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD V+
Sbjct: 60  IQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D GIP+ TE   +  YI++K                  LVK+  +  ++    +   +  
Sbjct: 120 DYGIPQITETKMLKQYITQKSFK---------------LVKSAKKKRNATRPPVALTNSV 164

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234
            WR EGI +KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 165 SWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224

Query: 235 -----YLS-----PSSNTQSSGNDGWAEEENG--TKAIKNAITGSVILEDCKFHQCVQLD 282
                YL      PS++  +S N+   +++    + +  N    ++ LED KFHQCV+L 
Sbjct: 225 GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLS 284

Query: 283 KFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKL 342
           KF+ E++I F+PPDG F+LM Y +   +         V       +E     K+    K 
Sbjct: 285 KFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKS 344

Query: 343 CAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMG 401
            A +VE+ IP P D        S G  K++PE++AI+WKI  + G  E   SA + +P  
Sbjct: 345 TATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSI 404

Query: 402 NGNDSLNL------EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYIS 455
           + N+  N        +  + P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI+
Sbjct: 405 SNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 464

Query: 456 KSG-AYEVR 463
           +SG  Y +R
Sbjct: 465 QSGDDYTIR 473

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  226 bits (577), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/472 (31%), Positives = 247/472 (52%), Gaps = 39/472 (8%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA++    +G  ++S+  +D+I L   + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IRSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIV 114
           I+ +  ++LV ++    T+ A ++ FLY    +L  Y     E+S++ ++++ YE+LD +
Sbjct: 60  IQ-HSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDEL 118

Query: 115 LDNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDM 174
           +D GIP+ TE   +  YI++K                  LVKA  +  ++        D 
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFK---------------LVKAAKKKQNAARPPSALTDS 163

Query: 175 CLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND 234
             WRSEGI+YKKNE +LD+ E I++L+ + G IL+S + G V+  + LSGMP  + G ND
Sbjct: 164 VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGIND 223

Query: 235 --YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRF 292
               S       + N+  ++++N            + LED KFHQCV+L KF+ E++I F
Sbjct: 224 KGIFSKQLTEDDTNNNATSKKQN-----------KIELEDLKFHQCVRLSKFETEKIITF 272

Query: 293 VPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIP 352
           +PPDG FELM Y +  ++         V       +E     K+    K  A +VE+ IP
Sbjct: 273 IPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIP 332

Query: 353 APPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQW 412
            P D        S G  K++PE++AI+WKI  + G  E   +A +      + S  ++  
Sbjct: 333 VPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQ-- 390

Query: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
           ++ P+ V+F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 391 NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  227 bits (579), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 150/472 (31%), Positives = 245/472 (51%), Gaps = 33/472 (6%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA++    +G  ++++  +D+I +   E F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           I+ N    +   +  + ++A I+ FLY    +L  Y     E+S++ +F++ YE+LD  +
Sbjct: 91  IQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETM 150

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D GIP+ TE   +  YI++K                  LVKA  +  ++        +  
Sbjct: 151 DYGIPQITETKMLKQYITQKSFK---------------LVKAAKKKRNAARPPEALTNSV 195

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234
            WRS  I+YKKNE +LD+ E I++L+ + G IL+S + G V+  + LSGMP  + G ND 
Sbjct: 196 SWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDK 255

Query: 235 -YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293
              S   +  S  N+G +   + T   KN I     LED KFHQCV+L KF+ E++I F+
Sbjct: 256 GIFSKHMDDDSLNNEGASVASSTTDKKKNNIE----LEDLKFHQCVRLSKFETEKIITFI 311

Query: 294 PPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKS-VEYRITLKSLFPSKLCAKDVELYIP 352
           PPDG FELM Y +  ++  P     M   +  +S +E     K+    K  A +V++ IP
Sbjct: 312 PPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIP 370

Query: 353 APPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQW 412
            P D    +   S G  K++PE+N I+WKI  + G  E   SA +     GN     E  
Sbjct: 371 VPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIE---EHK 427

Query: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
           ++ P+ ++F+I  F+ SG+ V+YLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 428 AKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIR 479

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  224 bits (572), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 154/475 (32%), Positives = 250/475 (52%), Gaps = 36/475 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M+S ++     G  I+++  +D+I +   + F    +Q+     V  P +      +  I
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVLD 116
           + +    +   +   T+ A I+ FL+   ++LE Y  I  E+S++ +F++ YE+LD ++D
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 117 NGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCL 176
            GIP+ TE   +  YI++K        S  ++ T +   K  A    +E     S     
Sbjct: 121 FGIPQITETKMLKKYITQK--------SFKLIKTSTSKKKKNAARPPAELTNSVS----- 167

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYL 236
           WR EGI YKKNE +LD+ E I++LV + G +L+S + G+V+  + LSGMP  + G ND  
Sbjct: 168 WRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRG 227

Query: 237 SPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPD 296
             S+  + +  DG +      + +++     + LED KFHQCV+L KF+ E++I F+PPD
Sbjct: 228 IFSNYLEENNVDGSSSSTPIPEGVEDK-KPQIELEDLKFHQCVRLSKFENEKIITFIPPD 286

Query: 297 GLFELMKYHVRDNLNLPFKVTPMV-----TTLKGKS-VEYRITLKSLFPSKLCAKDVELY 350
           G F+LM Y     L  P K  P++       +  KS +E     K+    K  A +VE+ 
Sbjct: 287 GEFDLMNYR----LTTPIK--PLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEIL 340

Query: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNL 409
           IP P D    +   S G  K++PE+NAI+WK+  + G  E   SA + +P  +G +   +
Sbjct: 341 IPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKV 400

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGA-YEVR 463
               R P+ V+F+I  F+ SG+ VRYLKV E  L Y +  WV+YI++SG  Y +R
Sbjct: 401 ----RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  224 bits (571), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/479 (31%), Positives = 252/479 (52%), Gaps = 36/479 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLD---VRSPILTLGSTTFHHI 57
           M SA++    +G  ++S+  KD++ L   + F   + +  D   V  P +      +  I
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  RSNGGLWLVTVSRGNT-DSAGIWEFLYNFNKLL-EVYDINSEDSLQGDFMLCYEILDIVL 115
           + N  L++V ++   T + A ++ FL+    +L E      E+S++ +F++ YE++D ++
Sbjct: 61  QHND-LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D GIP+ TE   +  YI++K            L       +  AR  S  N  ++     
Sbjct: 120 DYGIPQITEPRMLKKYITQKSFK---------LEKAHKKKRNAARPPSELNNSVS----- 165

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
            WR+EGI+YKKNE +LD+ E I++L+ + G +L+S + G+V+  + LSGMP  + G ND 
Sbjct: 166 -WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDR 224

Query: 236 --LSPSSNTQSSGNDGWAEEENGTKAIKNAITG-------SVILEDCKFHQCVQLDKFDQ 286
              +      + G +    +E+G+   +++IT        ++ LED KFHQCV+L KF+ 
Sbjct: 225 GIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFEN 284

Query: 287 ERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKS-VEYRITLKSLFPSKLCAK 345
           E++I F+PPDG F+LM Y +  ++  P     +   +  KS +E R   K+    K  A 
Sbjct: 285 EKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAA 343

Query: 346 DVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGND 405
           +V++ IP P D        S G  K++PE++AI+WKI  + G  E    A+   MG  + 
Sbjct: 344 NVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKE---YAMFAEMGLPSM 400

Query: 406 SLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
               E   + P+ V+FEI  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 401 DSYEEPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 459

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  223 bits (567), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 253/477 (53%), Gaps = 51/477 (10%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M+S ++    +G  I+S+  +D+I L   + F   ++ +L+  S    P L      +  
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 57  IRSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIV 114
           I  +  L++V +S    T++A ++ FL+   + L  Y     E+S++ +F++ YE+LD +
Sbjct: 60  I-EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEM 118

Query: 115 LDNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDM 174
           +D GIP+ TE   +  YI++K            L      VKA AR  +    GLT+   
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFK---------LIKAVKKVKATARPPT----GLTNS-- 163

Query: 175 CLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND 234
             WR++GI YKKNE +LD+ E I++++N+ G +L+S + G V   + LSGMP  + G ND
Sbjct: 164 VSWRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGIND 223

Query: 235 YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVP 294
               + + ++    G ++   G K        S  LED KFHQCV+L KF+ E++I F+P
Sbjct: 224 KGIFTRDPET----GESQVTAGKKK------SSAELEDLKFHQCVRLSKFENEKIITFIP 273

Query: 295 PDGLFELMKYHVRDNLNLPFKVTPMV-----TTLKGKS-VEYRITLKSLFPSKLCAKDVE 348
           PDG FELM Y     L  P K  P++       +  KS +E     K+    K  A +VE
Sbjct: 274 PDGEFELMSYR----LTTPVK--PLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVE 327

Query: 349 LYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSL 407
           + IP P D        S G  K++PE+NAI+WKI  ++G  E   +A + +P  NG +  
Sbjct: 328 ILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEKP 387

Query: 408 NLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
             ++    P+ V+F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI+++G  Y +R
Sbjct: 388 KFKR----PVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIR 440

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  223 bits (567), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 137/471 (29%), Positives = 237/471 (50%), Gaps = 37/471 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M S +     +G  ++S+  +D++     E F+   ++      V  P        + ++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDIN-SEDSLQGDFMLCYEILDIVLD 116
           + N    L      + ++  ++ F+Y    ++E Y     E+S++ ++++ YE+LD ++D
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 117 NGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDM 174
            G+P+ TE   +  YI++K   L+ +     ++   P+ L  + +               
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVS--------------- 165

Query: 175 CLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND 234
             WR EGI+YKKNE +LDV E I++L+ + G +L+S + G+V+  + LSGMP  + G ND
Sbjct: 166 --WRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLND 223

Query: 235 YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVP 294
               ++N Q    +     +     I+        LED KFHQCV+L KF+ E++I F+P
Sbjct: 224 KGIFTTNDQEDSPEPVVSSKKKNSNIE--------LEDLKFHQCVRLSKFENEKIITFIP 275

Query: 295 PDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAP 354
           PDG F+LM Y +   +         V    G  +E     K+    K  A +VE+ IP P
Sbjct: 276 PDGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIP 335

Query: 355 PDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNLEQWS 413
            D  +     S G  K++PE+NAI+WK   + G  E   +A + +P  +  +   L++  
Sbjct: 336 EDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKR-- 393

Query: 414 RPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
             P+ ++F+I  F+ SG+ VRYLK+ E  L YN+  WV+YI++SG  Y +R
Sbjct: 394 --PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIR 442

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  223 bits (567), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 153/479 (31%), Positives = 247/479 (51%), Gaps = 41/479 (8%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVIN---NLDVRSPILTLGSTTFHHI 57
           M SA++    +G  ++S+  +D+I     + F I + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           + N  L+LV ++   + ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD ++
Sbjct: 61  QHND-LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDIL--NTPSWLVKAGARGMSSENLGLTSKD 173
           D GIP+ TE   +  YI++K                 P+ L  + +              
Sbjct: 120 DYGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVS-------------- 165

Query: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233
              WR EGI++KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G N
Sbjct: 166 ---WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222

Query: 234 D------YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQE 287
           D      YL    N      D  + +E+  K  +   + ++ LED KFHQCV+L KF+ E
Sbjct: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKR---SNNMELEDLKFHQCVRLSKFENE 279

Query: 288 RVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDV 347
           + I F+PPDG FELM Y +   +         + T     +E     K+    K  A +V
Sbjct: 280 KQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNV 339

Query: 348 ELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGN-GND 405
           E+ IP P D        S G  K++PE+NAI+WKI  + G  E   +A + +P  N G +
Sbjct: 340 EILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE 399

Query: 406 SLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
           S  L++    P+ V+F+I  F+ SG+ VRYLK+ EK+L Y +  WV+YI+KSG  Y +R
Sbjct: 400 SEKLKR----PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  222 bits (566), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 142/469 (30%), Positives = 239/469 (50%), Gaps = 42/469 (8%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M+SA++    +G  I+S+  +D+I +   + F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDIN-SEDSLQGDFMLCYEILDIVLD 116
           + N    +   +   T+ A ++ FL+   ++LE Y  +  E+S++ +F++ YE+LD ++D
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 117 NGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCL 176
            GIP+ TE   +  YI++K                  L+KA  +  ++        +   
Sbjct: 121 YGIPQITETKMLKQYITQKSFK---------------LMKAVKKSKAAPRPPTEVTNSVS 165

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYL 236
           WR+  I +KKNE +LD+ E I++L+N+ G +L+S + G ++  + LSGMP  + G ND  
Sbjct: 166 WRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKG 225

Query: 237 SPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPD 296
             S   +   +        G K        ++ LED KFHQCV+L KF+ E++I F+PPD
Sbjct: 226 IFSKYVEGDSDPVTTAVTEGKKK------TNIELEDLKFHQCVRLSKFENEKIITFIPPD 279

Query: 297 GLFELMKYHVRDNLNLPFKVTPM------VTTLKGKSVEYRITLKSLFPSKLCAKDVELY 350
           G FELM Y     L++P K  P+      V       +E     ++    +  A  VE+ 
Sbjct: 280 GAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEIL 333

Query: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNL 409
           IP P D        + G  K++P++NAI+WKI  + G  E   SA + +P  N  D   +
Sbjct: 334 IPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKV 393

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG 458
           ++    P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG
Sbjct: 394 KR----PVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSG 438

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  223 bits (567), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 155/492 (31%), Positives = 253/492 (51%), Gaps = 55/492 (11%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M+S++     +G  ++S+  +D+I L   + F    +++     V  P LT     +  I
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY--DINSEDSLQGDFMLCYEILDIVL 115
           + N    +   +  +T+++ ++ FL+   +++  Y  D+  E+S++ +F++ YE+LD ++
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVE-EESIRDNFVIIYELLDEMM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D GIP+ TE   +  YI++K                  LVKA  +  ++        +  
Sbjct: 120 DYGIPQITETKMLKQYITQKSFK---------------LVKAAKKKRNAARPPQALTNSV 164

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234
            WR EGI+YKKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 165 SWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDK 224

Query: 235 -----YLSPSSNTQ----------SSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCV 279
                YL  +S+            +S      +   G     +  T +V LED KFHQCV
Sbjct: 225 GIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCV 284

Query: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMV-----TTLKGKS-VEYRIT 333
           +L KF+ E++I F+PPDG FELM Y     L  P K  P++       +  KS VE    
Sbjct: 285 RLSKFENEKIITFIPPDGNFELMSYR----LTTPIK--PLIWCDVNIHVHSKSRVEIHCR 338

Query: 334 LKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVF 393
            K+    K  A +VE+ IP P D        S G  K++PE+NAI+WKI  + G  E   
Sbjct: 339 AKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSM 398

Query: 394 SAVI-VPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVK 452
           +A + +P  + N+   L++    P+ ++F+I  F+ SG+ VRYLKV E  L Y +  WV+
Sbjct: 399 AAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVR 454

Query: 453 YISKSG-AYEVR 463
           YI++SG  Y +R
Sbjct: 455 YITQSGDDYTIR 466

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  222 bits (565), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 148/492 (30%), Positives = 246/492 (50%), Gaps = 47/492 (9%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA++     G  ++S+  +D++ L   + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           I+ N    +  V+    ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD V+
Sbjct: 60  IQHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D GIP+ TE   +  YI++K                  LVK+  +  ++    +   +  
Sbjct: 120 DYGIPQITETKMLKQYITQKSFK---------------LVKSAKKKRNATRPPVALTNSV 164

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234
            WR EGI +KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 165 SWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224

Query: 235 -----YLSPSSNTQSSGNDGWAEEENGTKAIKNAITG----------SVILEDCKFHQCV 279
                YL   SN  S+     A  +N T   K               ++ LED KFHQCV
Sbjct: 225 GIFSKYLDNDSNIPSAV--SAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCV 282

Query: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFP 339
           +L KF+ E++I F+PPDG F+LM Y +   +         V       +E     K+   
Sbjct: 283 RLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIK 342

Query: 340 SKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSA---- 395
            K  A +VE+ IP P D        S G  K++PE++AI+WK+  + G  E   SA    
Sbjct: 343 RKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGL 402

Query: 396 -VIVPMGNGNDSL--NLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVK 452
             I    +G+ ++  +  +  + P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+
Sbjct: 403 PSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVR 462

Query: 453 YISKSG-AYEVR 463
           YI++SG  Y +R
Sbjct: 463 YITQSGDDYTIR 474

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  219 bits (559), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 148/475 (31%), Positives = 246/475 (51%), Gaps = 37/475 (7%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLD---VRSPILTLGSTTFHHI 57
           M+S ++     G  I+S+  +D+I L   + F   ++ + +   V  P L      +  I
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDIN-SEDSLQGDFMLCYEILDIVLD 116
           + +    +   +   T+ A I+ FL+    +L  Y  +  E+S++ +F++ YE+LD ++D
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 117 NGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCL 176
            GIP+ TE   +  YI++K                  L+KA  +  ++    +   +   
Sbjct: 121 YGIPQITETKMLKQYITQKSFK---------------LIKAAKKKRNAARPPVALTNSVS 165

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYL 236
           WR EGI+YKKNE YLD+ E I++L+N+ G +L+S + G V+  + LSGMP  + G ND  
Sbjct: 166 WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKG 225

Query: 237 SPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPD 296
             S   ++  +     +     +  N    ++ LED KFHQCV+L KF+ E++I F+PPD
Sbjct: 226 IFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPD 285

Query: 297 GLFELMKYHVRDNLNLPFKVTPMV-----TTLKGKS-VEYRITLKSLFPSKLCAKDVELY 350
           G FELM Y     L  P K  P++       +  KS +E     K+    K  A +VE+ 
Sbjct: 286 GEFELMNYR----LTTPIK--PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEIL 339

Query: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNL 409
           IP P D        S G  K++PE+NAI+WK+  + G  E   +A + +P  +G +   +
Sbjct: 340 IPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKV 399

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463
           ++    P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 400 KR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  218 bits (555), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 148/492 (30%), Positives = 242/492 (49%), Gaps = 47/492 (9%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M SA++     G  ++S+  +D+I L   + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115
           I+ N    +  V+    ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD V+
Sbjct: 60  IQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119

Query: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           D GIP+  E   +  YI++K                  LVK+  +  ++    +   +  
Sbjct: 120 DYGIPQICETKMLKQYITQKSFK---------------LVKSAKKKRNATRPPVALTNSV 164

Query: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234
            WR EGI +KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 165 SWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224

Query: 235 -----YLSPSSNTQSSGNDGWAEEENGTKAIKNAITG----------SVILEDCKFHQCV 279
                YL   SNT    +   A  +N T   K               ++ LED KFHQCV
Sbjct: 225 GIFSKYLDDDSNTPPPTS--AATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCV 282

Query: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFP 339
           +L KF+ E++I F+PPDG F+LM Y +   +         V       +E     K+   
Sbjct: 283 RLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIK 342

Query: 340 SKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVP 399
            K  A +VE+ IP P D        S G  K++PE++AI+WK+  + G  E   SA +  
Sbjct: 343 RKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGL 402

Query: 400 MGNGND-------SLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVK 452
               ND         +  +  + P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+
Sbjct: 403 PSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVR 462

Query: 453 YISKSG-AYEVR 463
           YI++SG  Y +R
Sbjct: 463 YITQSGDDYTIR 474

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  123 bits (308), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 122/484 (25%), Positives = 204/484 (42%), Gaps = 105/484 (21%)

Query: 43  RSPILTLGSTTFHHIRSNGGLWLVTVSRGNT--DSAGIWEFLYNFNKLLEVY-DINSED- 98
           R P++      + +I  +G L+ V+VS G    +  GI  +L +F+ LL  Y  +N  D 
Sbjct: 41  RGPVIYSKGIIYIYILRDG-LYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDR 99

Query: 99  -SLQGDFMLCYEILDIVLDNGIPRDTELTHIMPYIS-----KKPLSENLLGSDD-----I 147
             +  +F L YE+ D  LD GIP+ T+   I   I       K  S +   SD+     I
Sbjct: 100 TGIIDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEI 159

Query: 148 LNTPSWLVKAGARGMSSENLGL------TSKDMCLWRSEGIRYKKNEVYLDVFEHISILV 201
           L +     KA   G   +   +      T+     WR +GI Y KNE+++D+ E  S L+
Sbjct: 160 LQSKENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLM 219

Query: 202 N-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAI 260
           + K+  + +++V G + C ++LSGMP+ +   N  L                        
Sbjct: 220 DFKNSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLKD---------------------- 257

Query: 261 KNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMV 320
           K+   GS      KFHQCV L+    +  I F+PPDG F+L +Y ++ ++N     +P++
Sbjct: 258 KDLFLGS-----SKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHIN----DSPII 308

Query: 321 TTL--------KGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSS------ 366
             +        K   +   +T++  F ++  A  ++++IP      N KI+++       
Sbjct: 309 KLIDYKINERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKC 368

Query: 367 --GKGKFIPEENAIVWK---IHKYHGLTENVFSAVIVPMGNGNDSLNLEQWSR---PP-- 416
             G   F   +  ++W    I   HG T                +  LEQ  +   PP  
Sbjct: 369 DHGSVFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPL 428

Query: 417 ---------------------------ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVK 449
                                      I+  FE+  +++SGL V YLK+ E++L Y +  
Sbjct: 429 REGAHLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFS 488

Query: 450 WVKY 453
           WV+Y
Sbjct: 489 WVRY 492

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  115 bits (287), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 126/486 (25%), Positives = 193/486 (39%), Gaps = 119/486 (24%)

Query: 45  PILTLGSTTFHHIRSNGGLWLVTVS--------RGNTDSAGIWEFLYNFNKLLEVYDINS 96
           P+       F +IR +G  ++  V         + + +   I  +L NF  LL+ Y  NS
Sbjct: 44  PVFHYKGIHFVYIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRY-FNS 102

Query: 97  EDS----LQGDFMLCYEILDIVLDNGIPRDTELTHIMPYI------------SKKPLS-- 138
           +      +  +F L YE+LD  LD G+P+ T+   I  YI            S K +S  
Sbjct: 103 QKLNRWLIVDNFHLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKK 162

Query: 139 ENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHIS 198
           E+L G +D     S++    AR         T+     WR +GI Y KNE +LDV E I 
Sbjct: 163 EDLHGFED---DESYMNSFIAR---------TTTSAISWRPKGIHYTKNEFFLDVIEEIE 210

Query: 199 ILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLS--PSSNTQSSGNDGWAEEEN 255
             ++     I K++V G ++C ++LSGMP  + G +   S  P    Q            
Sbjct: 211 YCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITSSLPKEREQ------------ 258

Query: 256 GTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKY----HVRD--- 308
                         + + KFHQCV L+   Q+ ++ F+PPDG F+L +Y    HVRD   
Sbjct: 259 -------------FMNNAKFHQCVSLEDL-QKNIVSFIPPDGEFQLCEYKLKRHVRDPPV 304

Query: 309 -----------NLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPP-- 355
                          P  +  +  T   KS      L    P      + ++ +  PP  
Sbjct: 305 IKLVKFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRF 364

Query: 356 --DTVNAKIN---------VSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGN 404
             D  N   N         V S KG     E+++  +   Y    E  +   +  + N  
Sbjct: 365 KCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFRLY---DEEEYKKQLEELKNSM 421

Query: 405 DSLNLEQWSRPP-----------------ISVRFEISMFSNSGLVVRYLKVMEKDLNYNT 447
           D   L Q  +                   +S+ FEI  ++ SGL V+YLK+ E  L Y++
Sbjct: 422 DPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHS 481

Query: 448 VKWVKY 453
             WV+Y
Sbjct: 482 FPWVRY 487

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 111/464 (23%), Positives = 192/464 (41%), Gaps = 101/464 (21%)

Query: 62  GLWLVTVSRGNTDSAGIWEFLY--NFNKLLEVY-DINSEDSLQ--GDFMLCYEILDIVLD 116
           GL+ V++S G+  S+ +   +Y  +F+ LL+ Y  +N+ D  +   +F L YE+LD  LD
Sbjct: 59  GLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDESLD 118

Query: 117 NGIPRDTELT------HIMPYISKKPL-----SENLLGSDDILNTPSWLVKAGARGMSSE 165
            GIP+ T+         I P I   P      S++     +  N      K+   G   +
Sbjct: 119 FGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGFQDD 178

Query: 166 NLGL------TSKDMCLWRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQC 218
              +      T+     WR +GI Y KNE+++DV E  + +++ K   + K+++ G + C
Sbjct: 179 EEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGRIIC 238

Query: 219 VAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQC 278
            ++LSGMPV +   N  L       SS                            KFHQC
Sbjct: 239 RSYLSGMPVVKICINKMLKDRDQFLSSA---------------------------KFHQC 271

Query: 279 VQLDKFDQERVIRFVPPDGLFELMKY----HVRDNLNLPFKVTPMVTTLKGKSVEYRITL 334
           V L+    +  I F+PPDG F+L +Y    H+ D+  +      +V   K   ++  + +
Sbjct: 272 VSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVVEKPKKHKLQISMKI 331

Query: 335 KSLFPSKLCAKDVELYIPAPPDTVNAKINVSS--------GKGKFIPEENAIVWKIH--- 383
           +  F ++  A  +++ +P        KI+++         G   F   +  ++WK +   
Sbjct: 332 QPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMK 391

Query: 384 -----KYHGLTENVFSAVIVPMGNGNDSLNLEQWSRPP---------------------- 416
                 YH +    F  +     +  ++  L+    PP                      
Sbjct: 392 GGHGETYHSMQVEFF--LFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQI 449

Query: 417 -------ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
                  I+  FE+  F++SGL V YLK+ E+ L Y +  WV+Y
Sbjct: 450 NNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  103 bits (257), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 131/523 (25%), Positives = 208/523 (39%), Gaps = 104/523 (19%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIS LF+      L+  +L+K    L    +  ++       +SPIL      +  I+ +
Sbjct: 1   MISCLFILDEELQLLTVRLLKPVPSL----LEPLEWFIRHPKKSPILQNMDYDYIFIQRD 56

Query: 61  GGLWL-VTVSRGNTDSAGIWEFLYNFNKLLEVY---DINSEDSLQGDFMLCYEILDIVLD 116
           G  +L ++    N     ++ +L   + L + Y   ++N +  + G+F L +E++D  + 
Sbjct: 57  GLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLN-KVLITGNFHLIHELIDESIF 115

Query: 117 NGIPRDTELTHIMPYI-------SKKPLS-ENLLGSDDILNTPSWLVKAGARGMSSEN-- 166
            G P+ T+   I  YI       S +P + E  + +           K      + EN  
Sbjct: 116 MGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTEATDENYM 175

Query: 167 ---LGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKS-YVDGSVQCVAHL 222
              +  T+     WR +GI Y KNE YLDV EH+  LV+     +KS  V G +QC ++L
Sbjct: 176 NSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCRSYL 235

Query: 223 SGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLD 282
           SGMP+   G N          +S N+ +    N                   FHQCV LD
Sbjct: 236 SGMPMLTIGLNKL--------NSENEYFMRRAN-------------------FHQCVNLD 268

Query: 283 KFDQERVIRFVPPDGLFELMKYHVRDNLNLP---------FKVTPMVTTLKGKSVEYRIT 333
           +   +++I F PPDG F+L  Y +  N++ P          K+ P  T      +   +T
Sbjct: 269 QLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLILAVT 328

Query: 334 LKSLFPSKLCAKDVELYIPAPPDTV----------NAKINVSSGKGKFIPEENAIVWKIH 383
           + + F  KL      L I  P   V            +     GK  F   ++ ++W++ 
Sbjct: 329 ISTYF--KLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVG 386

Query: 384 KYHG--------------LTENVFSAVI----------VPMGNGNDSLNLEQWSRP---P 416
           K  G              L      A I           P+  G     L Q +     P
Sbjct: 387 KVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSP 446

Query: 417 IS------VRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
            S      V FEI  ++ SGL V +LK+ EK L + +  WV+Y
Sbjct: 447 TSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 109/478 (22%), Positives = 193/478 (40%), Gaps = 93/478 (19%)

Query: 43  RSPILTLGSTTFHHIRSNGGLWLVTVSRG--NTDSAGIWEFLYNFNKLLEVY--DINSED 98
           R P+L+     + +I+ +G L+ +++S G        ++ +L    +L + Y  +  +  
Sbjct: 39  RLPVLSHRGYDYIYIQRDG-LYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQ 97

Query: 99  SLQGDFMLCYEILDIVLDNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAG 158
            +  +F L YE++D  +D GIP+ T+   I  Y+  + +     G        +   KAG
Sbjct: 98  LIMDNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAG 157

Query: 159 AR------GMSSEN-----LGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAI 207
                   G + E+     +  T+     WR  GI Y KNE +LDV E +  L++ + A 
Sbjct: 158 KEEEEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQ 217

Query: 208 LK-SYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITG 266
           ++ + V G++ C ++LSGMP    G N  +              A++ + T  +      
Sbjct: 218 VRLNQVHGAINCRSYLSGMPQLTVGLNKMV--------------AQDRDFTSQVH----- 258

Query: 267 SVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLN-LPF--------KVT 317
                   FHQCV L++   +R I FVPPDG F+L  Y +    N  P          V 
Sbjct: 259 --------FHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVK 310

Query: 318 PMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVS--------SGKG 369
           P         +   +++ + F  +     +++ +P        K+++S        +G  
Sbjct: 311 PRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCV 370

Query: 370 KFIPEENAIVWKIHK---------------YHGLTENVFSAVIVPMGNGNDSL------- 407
            F   ++ ++W I K               +H   E  +S     +    D L       
Sbjct: 371 MFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQ 430

Query: 408 -----NLEQWSRPP-----ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYIS 455
                N    S P      + V FE+   + SGL V +LK++E  L Y +  W++Y S
Sbjct: 431 LEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRYKS 488

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 138/346 (39%), Gaps = 90/346 (26%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI+Y KNE +LDV E +   ++  +  I K+ + G + C + LSGMP  +   N  
Sbjct: 225 WRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLNKI 284

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPP 295
           +       SS                           CKFHQCV  D  D+ +V+ FVPP
Sbjct: 285 IYQDKQFLSS---------------------------CKFHQCVMPDSVDEGKVLEFVPP 317

Query: 296 DGLFELMKYHVRDNLN-LP------FKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVE 348
           DG F L KY ++ ++N LP      ++V P +   K K     +T++S F        + 
Sbjct: 318 DGDFVLCKYELKRHVNDLPLLKLISYEVKPKLDKYKLKLF---VTIESTFKKTNSTTKLN 374

Query: 349 LYIPAP--------PDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPM 400
           + IP            + N K     GK  F   ++ ++W+I    G    +       +
Sbjct: 375 IKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFAL 434

Query: 401 GNGNDSLNLEQWSR----PP-------------------------------------ISV 419
            N  + L  ++  +    PP                                     I +
Sbjct: 435 FNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKM 494

Query: 420 RFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY--ISKSG-AYEV 462
            FEI   ++SGL V YLK+ E +L Y    WV+Y  IS  G AY V
Sbjct: 495 DFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYAYAV 540

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 104/428 (24%), Positives = 176/428 (41%), Gaps = 110/428 (25%)

Query: 99  SLQGDFMLCYEILDIVLDNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPS--WLVK 156
           +++ +F L +E+++   D GI + T    I  +I      E +   DD  NT S    + 
Sbjct: 103 NVRDNFHLIFEVIEESSDYGIIQVTNYNIIHDFIK----VEVIKPDDDSENTASEKHELP 158

Query: 157 AGARGMSSEN--LGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVD 213
            G +  +  N  +  T      WR +GI Y KNE +LDV E +  +++ ++G +  + ++
Sbjct: 159 PGDQDETFINSYILRTMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVIN 218

Query: 214 GSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDC 273
           G++ C ++LSGMP    G N  +  + +                            ++  
Sbjct: 219 GTIICRSYLSGMPQLSIGLNKLMQKNVH---------------------------FMKRL 251

Query: 274 KFHQCVQLDKFDQER--VIRFVPPDGLFELMKYHVRDNLNLPFKVTPMV---------TT 322
           KFH+CV L    +E   VI+F+PPDG FEL  Y     LN P    P++           
Sbjct: 252 KFHECVDLHTLIKEESPVIKFIPPDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKP 307

Query: 323 LKGKSVEYRITLKSLFPSKLCAKDV--ELYIPAPPDTVNAKINVSSGKGKFIPEE----- 375
            K +  + ++ LK+   +   A+D   EL I  P  +V  K N+   K      +     
Sbjct: 308 RKNQETQDKLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVV 367

Query: 376 -----NAIVWKI--------HKYHGLT-------ENVFSAVIVPM--------------- 400
                 +I+WKI        +K +GL          +  A+ V +               
Sbjct: 368 FDITAGSIIWKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKL 427

Query: 401 ---------------GNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNY 445
                          GN N   ++++++   I++ FEI  ++ SGL V Y K+ E  LNY
Sbjct: 428 ERIWDQYHGKTTEYDGNENQKEDVDKFAL--IAMSFEIPYYAVSGLKVEYFKIEEPQLNY 485

Query: 446 NTVKWVKY 453
            +  WV+Y
Sbjct: 486 QSFPWVRY 493

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 139/359 (38%), Gaps = 111/359 (30%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +  L++ + G I K+ + G + C ++LSGMP  +   N  
Sbjct: 255 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISINKI 314

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFD-----QE--- 287
           L+      S+ N                           FHQCV LD  +     QE   
Sbjct: 315 LNRDPQFMSNSN---------------------------FHQCVSLDSINTIEKGQEKEQ 347

Query: 288 -----------RVIRFVPPDGLFELMKY----HVRDNLNLPFKVTPMVTTLKGKSVEYRI 332
                      R I FVPPDG F L +Y    HV+D   +  K   +   LK   ++   
Sbjct: 348 NTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILT 407

Query: 333 TLKSLFPSKLCAKDVELYIPAPPDTVNAKINVS--------SGKGKFIPEENAIVWKIHK 384
            +++ F        + + IP      + KI++S        +GK  F   ++ ++W+I  
Sbjct: 408 KIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQT 467

Query: 385 YHGLTENVFSAVIVPMGNGNDS-----------LNLEQWSR----------PP------- 416
             G  E   +A   P  +G+ S            N E++ R          PP       
Sbjct: 468 MKGHRER--NASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPK 525

Query: 417 ----------------------ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
                                 +S+ FEI   + SGL V YLKV E  L Y +  WV+Y
Sbjct: 526 LEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 130/545 (23%), Positives = 218/545 (40%), Gaps = 124/545 (22%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKL-GVSEIFRIQVINNLDVRSPILTLGSTTFHHIRS 59
           M S +F+     + +ISK IK    L G+  +F+           P+++  S  F HI+ 
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPE---SQPVISASSFHFVHIKR 57

Query: 60  NGGLWLVTVSRGNTDSAG---IWEFLYNFNKLLEVYDINS---EDSLQGDFMLCYEILDI 113
           +  L+ V+V      SA    I  FL  F+ LL+ Y   S   ++ +  + +L  E++D 
Sbjct: 58  SSLLY-VSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELIDE 116

Query: 114 VLDNGIPRDTELTHIMPYI-------SKKPLSENLLGSDDI--------------LNTPS 152
            +D G+ + T+ + +  YI         K + +  LG  D                N   
Sbjct: 117 SIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPNLYK 176

Query: 153 WLVKAGARGMSSENLGLTSKDMCL-----------------WRSEGIRYKKNEVYLDVFE 195
           +L  A      +E+    +K+  +                 WR++GI Y +NE +LDV E
Sbjct: 177 FLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDVVE 236

Query: 196 HISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEE 254
            +  L++   G I K+ + G + C ++LSGMP  +  FN                     
Sbjct: 237 QVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN--------------------- 275

Query: 255 NGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFELMKY----HVRDNL 310
                 K +      +   KFHQCV       E+ I F+PPDG F L +Y    HV+D  
Sbjct: 276 ------KLSQKDEQFISHSKFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQP 328

Query: 311 NLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVS----- 365
            L      +   LK   ++   T+++ F ++     + L IP        +I++      
Sbjct: 329 MLKLVSFGVKPKLKKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARF 388

Query: 366 ---SGKGKFIPEENAIVWKIHKY---HGLTENVFSAVIV--------------------- 398
              SGK  F   ++ ++W I      HG T+   +A                        
Sbjct: 389 KSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPP 448

Query: 399 PMGNGN------DSLNLE----QWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTV 448
           P+ +G       D ++ E    + +   +S++FEI   + SGL V YLK+ E+ L Y + 
Sbjct: 449 PLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSF 508

Query: 449 KWVKY 453
            WV+Y
Sbjct: 509 PWVRY 513

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 127/560 (22%), Positives = 216/560 (38%), Gaps = 138/560 (24%)

Query: 1   MISALFLYSPRGDLIISKLIKDNIKL-GVSEIFRIQVINNLDVRSPILTLGSTTFHHIRS 59
           M S LF+     + +ISK +K    L G+ E F++    N     P+ T+    +  I+ 
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKLNYKEN---GPPVFTVLEWHYVFIKR 57

Query: 60  NGGLWLVTVSRGNTDS----AGIWEFLYNFNKLLEVYDINS---EDSLQGDFMLCYEILD 112
           +  LW +T      D       +  +L     LL+ Y   S    + +  + +L  E++D
Sbjct: 58  DS-LWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELID 116

Query: 113 IVLDNGIPRDTELTHIMPYI---------------------SKKPLSENLLGSDDILN-- 149
             +D GI + T+ + I  YI                       K LS  + G  DI+   
Sbjct: 117 ESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKLW 176

Query: 150 --TPSWLVKAGARG-------MSSEN-----LGLTSKDMCLWRSEGIRYKKNEVYLDVFE 195
              P+     G             EN     +  T+     WR++GI Y KNE +LDV E
Sbjct: 177 KGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVIE 236

Query: 196 HISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEE 254
            +  L++   G I K+ + G ++C  +LSGMP  +   N                     
Sbjct: 237 KVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN--------------------- 275

Query: 255 NGTKAIKNAITGSVILEDCKFHQCVQLDKFDQE------------RVIRFVPPDGLFELM 302
              K IKN       + + KFHQCV ++   +E            + I F+PPDG F L 
Sbjct: 276 ---KLIKN---DEQFISNSKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLC 329

Query: 303 KY----HVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTV 358
           KY    HVRD   +      +   LK   ++  +T+++ F  +     + + IP      
Sbjct: 330 KYELKRHVRDVPVIKLSNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFS 389

Query: 359 NAKINVSS--------GKGKFIPEENAIVWKI-----------------------HKYHG 387
             KI+++         G+  F   ++ ++W++                        +Y  
Sbjct: 390 QYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDR 449

Query: 388 LTENVFSAVIVP--------------MGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVV 433
           L E + +++  P                +  D  +    S+  ++++FE+   + SGL V
Sbjct: 450 LQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKV 509

Query: 434 RYLKVMEKDLNYNTVKWVKY 453
            YLK+ E  +NY +  WV+Y
Sbjct: 510 EYLKIEENQVNYQSFPWVRY 529

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 141/331 (42%), Gaps = 85/331 (25%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +  L + K+  + K+ + G + C ++LSGMP  +   N  
Sbjct: 238 WRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALNKL 297

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPP 295
           L   +   S                             KFHQCV L+  + E+ + F+PP
Sbjct: 298 LQRDAQFMSHS---------------------------KFHQCVALETLN-EKELEFIPP 329

Query: 296 DGLFELMKYHVRDNLN-------LPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVE 348
           DG F L +Y ++ ++N         F++ P +   K + +   +T+++ F ++     + 
Sbjct: 330 DGEFILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRIL---LTIETHFKTRNSTSILN 386

Query: 349 LYIPAPPDTVNAKINVS--------SGKGKFIPEENAIVWKIHKYH-GLTENVFSAVIV- 398
           + IP      +  I++S        +G+  F   ++ ++W+I +   G  E  FS V   
Sbjct: 387 VKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEF 446

Query: 399 ----------------------PMGNGN--DSLNLEQWSR--PPISVR----------FE 422
                                 P+  G   + L  +  S+  P + V+          FE
Sbjct: 447 SLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFE 506

Query: 423 ISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
           I   + SGL V YLK+ E+ L Y +  WV+Y
Sbjct: 507 IPYTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 87.8 bits (216), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 136/352 (38%), Gaps = 106/352 (30%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +  L+N KD  I ++ + G ++C ++LSGMP  +   N  
Sbjct: 227 WRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALNKI 286

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDK------------ 283
           L                                 L   KFHQCV L+             
Sbjct: 287 LQDDKQ---------------------------FLGHAKFHQCVSLNSINIKDLEKDLEG 319

Query: 284 --------FDQERVIRFVPPDGLFELMKYHVRDNLNLP-------FKVTPMVTTLKGKSV 328
                   F  ++ I F+PPDG F L +Y +R ++  P       F + P     K   V
Sbjct: 320 PNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKP---NFKKFRV 376

Query: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSS--------GKGKFIPEENAIVW 380
           +  + +++ F  +     + + IP      + KI++S         GK  F   E+ ++W
Sbjct: 377 QISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIW 436

Query: 381 KIHKY---HGLTENVFSAVIVPMGNGNDSLNLEQWSR-----PPIS-------------- 418
           +I      HG  E    A    + N  +   L++ ++     PP+               
Sbjct: 437 EIDALKGGHGENEKGMVAEFF-LFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHE 495

Query: 419 -----------------VRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
                            ++FEI   + SGL V YLK+ E  L Y +  WV+Y
Sbjct: 496 NEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRY 547

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 88/360 (24%), Positives = 134/360 (37%), Gaps = 112/360 (31%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +  L++ + G I K+ + G + C  +LSGMP  +   N  
Sbjct: 254 WRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISINKL 313

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFD---------- 285
           L+      S+                            KFHQCV LD  +          
Sbjct: 314 LNRDPQFMSNS---------------------------KFHQCVSLDSINIIEEEGRDTD 346

Query: 286 --------QERVIRFVPPDGLFELMKY----HVRDNLNLPFKVTPMVTTLKGKSVEYRIT 333
                     + I F+PPDG F L +Y    HV+D   +  +   +   LK   ++    
Sbjct: 347 DAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLKKFKIQIITK 406

Query: 334 LKSLFPSKLCAKDVELYIPAPPDTVNAKINVSS--------GKGKFIPEENAIVWKIHKY 385
           +++ F        + + IP      + KI++S         GK  F   ++ ++W+I   
Sbjct: 407 IQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGTM 466

Query: 386 HGLTENVFSAVIVPMGNGNDSL----------NLEQWSR----------PP--------- 416
            G  E   +   VP  +   +L          N E++ R          PP         
Sbjct: 467 KGHRER--NTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLE 524

Query: 417 -----------------------ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
                                  +SV FEI   + SGL V YLKV E  L Y +  WV+Y
Sbjct: 525 ELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 137/361 (37%), Gaps = 111/361 (30%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +  L++ + G I K+ + G + C  +LSGMP  +   N  
Sbjct: 260 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISINKI 319

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKF-----DQE--- 287
           L+      S+ +                           FHQCV LD       D+E   
Sbjct: 320 LNRDPQFMSNSS---------------------------FHQCVSLDSINTIEKDEEKNS 352

Query: 288 ------------RVIRFVPPDGLFELMKY----HVRDNLNLPFKVTPMVTTLKGKSVEYR 331
                       R I F+PPDG F L +Y    HV+D   +  K   +   LK   ++  
Sbjct: 353 DDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIV 412

Query: 332 ITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSS--------GKGKFIPEENAIVWKIH 383
             +++ F        + + IP        KI++S         GK  F   ++ ++W+I 
Sbjct: 413 TKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQ 472

Query: 384 KYHGLTE----------------NVFSAVIV--PMGNGNDSLNLEQWSR----PP----- 416
              G  E                N  ++++   P+ N  +   L++  +    PP     
Sbjct: 473 TMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTG 532

Query: 417 ------------------------ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVK 452
                                   +++ FEI   + SGL V YLKV E  L Y +  WV+
Sbjct: 533 PRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVR 592

Query: 453 Y 453
           Y
Sbjct: 593 Y 593

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/361 (23%), Positives = 139/361 (38%), Gaps = 107/361 (29%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +  L++ + G I K+ + G + C  +LSGMP  +   N  
Sbjct: 262 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISINKI 321

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLD----------KFD 285
           L+  +                             L +  FHQCV LD          K D
Sbjct: 322 LNRDAQ---------------------------FLSNSSFHQCVSLDSIKTIEKREEKED 354

Query: 286 QE---------RVIRFVPPDGLFELMKY----HVRDNLNLPFKVTPMVTTLKGKSVEYRI 332
            +         + + FVPPDG F L +Y    HV+D   +  K   +   LK   ++   
Sbjct: 355 DDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIET 414

Query: 333 TLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSS--------GKGKFIPEENAIVWKIHK 384
            +++ F        + + IP        +I++S         GK  F   ++ ++W+I  
Sbjct: 415 KIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQA 474

Query: 385 YHGLTE-------------NVFSAVIV--PMGNGNDSLNLEQWSR----PP--------- 416
             G  E             +  ++++   P+ N  +   L++  +    PP         
Sbjct: 475 MKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLE 534

Query: 417 --------------------ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISK 456
                               +++ FEI   + SGL + YLKV E  L Y +  WV+Y + 
Sbjct: 535 ELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTT 594

Query: 457 S 457
           S
Sbjct: 595 S 595

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 82/353 (23%), Positives = 140/353 (39%), Gaps = 104/353 (29%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +   ++ K G I K+ + G + C ++LSGMP  +   N  
Sbjct: 252 WRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN-- 309

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLD------------- 282
                                 K +K  +     L + KFHQCV LD             
Sbjct: 310 ----------------------KILKQDVQ---FLSNVKFHQCVSLDSIRARSNPPAVEE 344

Query: 283 ---KFDQER-------VIRFVPPDGLFELMKY----HVRDNLNLPFKVTPMVTTLKGKSV 328
              K ++E         I F+PPDG F L KY    HV+D   +  +   ++  L    +
Sbjct: 345 DGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLHKFKI 404

Query: 329 EYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAI---------V 379
           +  + +++ F +      + L IP      + +I++S  + KF  E+  +         +
Sbjct: 405 KIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSK-QPKFKCEQGTVLFNLSDKFLL 463

Query: 380 WKIHKYH-GLTENVFSAVIV-----------------------PMGNG------------ 403
           W++   + G  EN  S +                         P+  G            
Sbjct: 464 WEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHE 523

Query: 404 ---NDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
              +D ++  + +   +++ FE+   + SGL + YLK+ E  L Y +  WV+Y
Sbjct: 524 EGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRY 576

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 91/369 (24%), Positives = 137/369 (37%), Gaps = 125/369 (33%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +  LV+ + G + +S + G + C ++LSGMP  +   N  
Sbjct: 251 WRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLNKL 310

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQ--------- 286
           L          ND                     +   +FHQCV LD  ++         
Sbjct: 311 LQ---------ND------------------KQFISQVQFHQCVSLDSIEKVIKYAEEHS 343

Query: 287 -------------ERVIRFVPPDGLFELMKYHVRDNLNLP-------FKVTPMVTTLKGK 326
                        E  I F+PPDG F L  Y ++ ++  P       F++TP     K K
Sbjct: 344 DELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLK 403

Query: 327 ---SVEYRI-------TLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEEN 376
              +VE           L    P     KD ++ +  P      K   S+G+  +   ++
Sbjct: 404 ISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKP-----IKFKTSNGRVVYNISDD 458

Query: 377 AIVWKI-----HKYHGLTENV--FSAVIV---------------------------PMGN 402
            ++W+I      K HG  E++  F  V                             P+  
Sbjct: 459 FLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRT 518

Query: 403 G-------------NDSLNLEQWSRPP-----ISVRFEISMFSNSGLVVRYLKVMEKDLN 444
           G             ND  N     +P      +S+ FEI   + SGL V YLK+ E  L 
Sbjct: 519 GPKLEDIYKETHEENDGYN-SVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQ 577

Query: 445 YNTVKWVKY 453
           Y +  WV+Y
Sbjct: 578 YQSFPWVRY 586

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 95/224 (42%), Gaps = 41/224 (18%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E    +++ K+  I K+ + G + C   LSGMP  +   N  
Sbjct: 289 WRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALNKL 348

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPP 295
           L                                 L   +FHQCV L+   Q + I F+PP
Sbjct: 349 LQKDQQ---------------------------FLSQLRFHQCVSLETI-QNKEIEFIPP 380

Query: 296 DGLFELMKY----HVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYI 351
           DG F L +Y    HV+D  N+      +   LK   ++  +++ + F  +     + L I
Sbjct: 381 DGEFILCEYELKRHVKDPPNIKLISFEIKPKLKKFKIQINLSITTFFKVQNSTSILNLKI 440

Query: 352 PAPPDTVNAKINVSS--------GKGKFIPEENAIVWKIHKYHG 387
           P      + KI++          G+ KF   ++ ++W+I    G
Sbjct: 441 PLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKG 484

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 417 ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
           ++V FEI  ++ SGL V YLK+ E+ L Y +  WV+Y
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 100/249 (40%), Gaps = 65/249 (26%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +LDV E +   ++ + G I K+ + G + C  +LSGMP  +   N  
Sbjct: 297 WRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISINKI 356

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKF----------- 284
           L          ND                  S  L +  FHQCV LD             
Sbjct: 357 LQ---------ND------------------SQFLSNAHFHQCVSLDSLHLQSAEDDDGD 389

Query: 285 --------------DQERVIRFVPPDGLFELMKY----HVRDNLNLPFKVTPMVTTLKGK 326
                         D+++ I F+PPDG F L KY    HV+D   +  K+  +   L   
Sbjct: 390 DNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKLSKY 449

Query: 327 SVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVS--------SGKGKFIPEENAI 378
            ++  + +++ F +      + L IP        +I++S         GK  F   +N +
Sbjct: 450 KLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFL 509

Query: 379 VWKIHKYHG 387
           +W+I    G
Sbjct: 510 IWEIGSMKG 518

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 408 NLEQWSRPP--ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKY 453
           +L + +R P  + + FEI  ++ SGL + YLK+ E  L Y +  WV+Y
Sbjct: 613 DLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRY 660

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 77/163 (47%), Gaps = 28/163 (17%)

Query: 1   MISALFLYSPRGDLIISKLIKD-----NIKLGVSEIFRIQ---VINNLDVRS-PILT--- 48
           M S +F+     + I++K I+       + L   EI+R Q   + NN D +  PIL    
Sbjct: 1   MSSCIFILDENLEPILNKNIRSIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLPILNTND 60

Query: 49  --LGSTT----------FHHIRSNGGLWLVTVSRGNTDSAGI-WEFLYNFNKLLEVY-DI 94
             + ++T          F HI+ +  +++  +   + +S  I + +L  F KLL+ Y ++
Sbjct: 61  YGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNV 120

Query: 95  NSEDS--LQGDFMLCYEILDIVLDNGIPRDTELTHIMPYISKK 135
              D   L  +F+L  E+LD  LD GI + T+ + I  YI  K
Sbjct: 121 TKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 62/139 (44%), Gaps = 34/139 (24%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVN-KDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235
           WR++GI Y KNE +L+V E +   ++     I K+ + G ++C   LSGMP  +   N  
Sbjct: 255 WRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSINKI 314

Query: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQ--ERVIRFV 293
           ++                                L +CKFHQCV L   +    + + FV
Sbjct: 315 VNEDKQ---------------------------FLANCKFHQCVSLASLESSDHKDVEFV 347

Query: 294 PPDGLFELMKY----HVRD 308
           PPDG F L +Y    HVRD
Sbjct: 348 PPDGEFTLCRYELKRHVRD 366

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%)

Query: 417 ISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGA 459
           +++ FE+   ++SGL V YLK+ E  L Y +  WV+Y + S A
Sbjct: 533 LTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 112/440 (25%), Positives = 184/440 (41%), Gaps = 94/440 (21%)

Query: 64  WLVTVSRGNTDSAGIWEFLYNF-NKLLEVYDINSEDSLQGDFMLCYE-----ILDIVLDN 117
           W +   + N     +  FL  F N LL+ +D   +D L    M+  +     +L+ ++D 
Sbjct: 71  WCLATHQSNPLEPAV--FLEGFDNTLLQYFD---KDQLTISKMVNNQDRIALLLNCMVDA 125

Query: 118 GIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSE--NLGLTSK--- 172
             P  T+  H+   +   P  E+L  S  I +T S L    ++  +S+  N+G  +K   
Sbjct: 126 NEPAVTDFNHLRDMV---PSREDL--SKVINSTASSLSNRISQRNTSQVLNIGDPAKGPA 180

Query: 173 ---DMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAI-----LKSYVDGSVQCVAHLSG 224
               +  WRS G++Y  NE+Y+DV E + +++ K+        ++  +DG V   +HLSG
Sbjct: 181 AKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSG 240

Query: 225 MPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKF 284
            PV             N +  G+D       G  A+               HQC  LD +
Sbjct: 241 NPVIAL----------NLRLRGHDL------GMPAL---------------HQCC-LDSY 268

Query: 285 D-QERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSL---FPS 340
             +   +RFVPPDG F+LM Y +  +L+     + + + +   S +YR  L  L   F  
Sbjct: 269 QGRPDQLRFVPPDGKFQLMHYSI--DLDSLQSKSKLFSNIGLVSPDYRTELGDLGDEFEV 326

Query: 341 KL---------CAKDVELYIPAPPDTVNAKINV-SSGKGKFIPEENAIVWKIHKYHGLTE 390
            L            D+ + +   P     KI V  S  G F   EN     I K+    E
Sbjct: 327 NLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHF---ENCASNNIGKWVFDKE 383

Query: 391 NVFSAVIVPMGNGNDSLNLEQWSRPPI-SVRFEISMFSNSGLVVRYLKVMEKDL------ 443
                + V  G       LE  +R  + +++  +S ++N G +   +KV   D+      
Sbjct: 384 TPTGTLPVLRG------CLENATREQVRALQLSVS-YTNRGELPSGIKVDSVDILSGLSK 436

Query: 444 NYNTVKWVKYISKSGAYEVR 463
           N    K VKYI+K+G + +R
Sbjct: 437 NIKPFKGVKYIAKTGDFHLR 456

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 88/200 (44%), Gaps = 43/200 (21%)

Query: 133 SKKPLSENLLGSDDILNTPSWLVKAGARGMSSE----NLGLTSKDMCLWRSEGIRYKKNE 188
           S + ++ NLL   +  NT +  +     G +S     N G  +  +  WRS  ++Y  NE
Sbjct: 212 STRSITSNLLSGSN--NTSNVSISGNGMGNNSSSGFGNSGTINNKVVPWRSGNVKYTNNE 269

Query: 189 VYLDVFEHISILVNKDGA------------------ILKSYVDGSVQCVAHLSGMPVCQF 230
           +Y+DV E I ++  +  +                  ++++ + G +   ++LS  P+ + 
Sbjct: 270 IYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGELNVRSYLSDNPMVEV 329

Query: 231 GFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLD---KFDQE 287
              D         S    GW+E         N +   + L    FH CV++D     +Q+
Sbjct: 330 TLVD------RNYSDQKTGWSE---------NDLFKQLNLGLPMFHDCVEIDYEKGINQD 374

Query: 288 -RVIRFVPPDGLFELMKYHV 306
            R I+F+PPDG F LMKY++
Sbjct: 375 FRHIKFIPPDGKFSLMKYNI 394

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 65/136 (47%), Gaps = 39/136 (28%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDG------AILKSYVDGSVQCVAHLSGMPVCQF 230
           WRS+ I+  +NE+Y+DV E + + + K         +L  Y++GSV   + + G+P+ + 
Sbjct: 175 WRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLEV 234

Query: 231 GFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKF--DQER 288
            F                       G    K+ I         KFH CV++++F  +   
Sbjct: 235 SF-----------------------GGCDFKDIIP--------KFHDCVEVNEFLTNDGN 263

Query: 289 VIRFVPPDGLFELMKY 304
           +I+F+PPDG F+LM+Y
Sbjct: 264 IIKFIPPDGKFQLMEY 279

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 62/142 (43%), Gaps = 36/142 (25%)

Query: 170 TSKDMCLWRSEGIRYKKNEVYLDVFEHISILVN---KDGAI--LKSYVDGSVQCVAHLSG 224
           T   +  WR+ G++Y  NE+Y+DV E I +++    K G +  ++  +DG V   +HL+G
Sbjct: 181 TKDKLVPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTG 240

Query: 225 MPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKF 284
            PV     N +          G+D       G  A+               H C Q    
Sbjct: 241 NPVVALKLNLH----------GHD------LGVPAL---------------HPCCQAQYT 269

Query: 285 DQERVIRFVPPDGLFELMKYHV 306
                ++FVPPDG F LM+Y +
Sbjct: 270 GSPENLQFVPPDGKFRLMQYTI 291

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 74/328 (22%), Positives = 129/328 (39%), Gaps = 78/328 (23%)

Query: 173 DMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGA----------ILKSYVDGSVQCVAHL 222
           D+  WR+ G++Y  NE+Y+D+ E I ++  K G           ++   ++G      +L
Sbjct: 209 DVVPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYL 268

Query: 223 SGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLD 282
           SG P      +           +GND                     L    FH+CV+LD
Sbjct: 269 SGNPTVDLQLD----------LAGND---------------------LGVPAFHECVELD 297

Query: 283 KFDQERV--IRFVPPDGLFELMKYHV-----------RDNLNLPFKVTPMVTTLKGKSVE 329
                    +RF+PPDG F LM+Y +           R N  +          L  K+ E
Sbjct: 298 NHQNPSNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDE 357

Query: 330 YRITLKSLFPSKLCAK------DVELYIPAPPDT-VNAKINV-SSGKGKF----IPEENA 377
           + IT+ ++  S+  A       DV+L      D+  + KI V  +  G+F    +P + +
Sbjct: 358 FEITV-NISNSREVANIEDLRIDVQLQSNTDEDSETDFKIKVLRNTHGRFDNSVVPGQGS 416

Query: 378 IVWKIHKYHGLTENVFSAVIVPMGNGN-DSLNLEQWSRPPISVRFEISMFSNSGLVVRYL 436
            ++      G          +P+  G  +S          ++  + +S    SG+ V+ +
Sbjct: 417 WIFDKDTPTG---------TLPVLRGCVESTEPRLLRVQRVTASYSLSGQLASGIRVKAI 467

Query: 437 KVMEKDLNYNT-VKWVKYISKSGAYEVR 463
            + +     N   K VKY +K+G +E+R
Sbjct: 468 NIGQLTTKSNRPFKGVKYATKTGDFEIR 495

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 62/136 (45%), Gaps = 37/136 (27%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDG-----AILKSYVDGSVQCVAHLSGMPVCQFG 231
           WRS G++Y  NE+Y+D+ E ++I++ K         +   +DG V    +LS  P+ +  
Sbjct: 206 WRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVELD 265

Query: 232 FNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFD-QERVI 290
            N          ++G+D                     L    FH+CV+ +  D     +
Sbjct: 266 LN----------TNGHD---------------------LGIPAFHRCVRTEGSDFHPGTL 294

Query: 291 RFVPPDGLFELMKYHV 306
           RF+PPDG F LM+Y++
Sbjct: 295 RFIPPDGDFCLMEYNI 310

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/317 (21%), Positives = 118/317 (37%), Gaps = 78/317 (24%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGA---ILKSYVDGSVQCVAHLSGMPVCQFGFN 233
           WR+   RY  NE+Y+D+ E ++  + + G+   ++   + G +    +LSG P  Q    
Sbjct: 142 WRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL- 200

Query: 234 DYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293
                    ++SG+                      L++   H+CV+L +      + FV
Sbjct: 201 ---------RTSGHP---------------------LDNSALHRCVELGEAGVA-TMNFV 229

Query: 294 PPDGLFELMKYHV---------RDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCA 344
           PPDG F L +Y +         R   NL      + + L     E+ I +     +++ A
Sbjct: 230 PPDGRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAA 289

Query: 345 KD---VELYIPAPPDTVNAKI----------NVSSGKGKFIPEENAIVWKIHKYHGLTEN 391
            +   + +Y P   D    KI          ++S  +G +  ++   V  +    G  EN
Sbjct: 290 IEDLRITVYFPDISDAAKIKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRGCVEN 349

Query: 392 VFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSN-----SGLVVRYLKVMEKDLNYN 446
             S    P               PP+        +S+     SG+ V  + + +      
Sbjct: 350 PES---TPHA-------------PPVFPSHLAVSYSHVGQLPSGIRVDTIALSDLPPGSK 393

Query: 447 TVKWVKYISKSGAYEVR 463
             K VKY S++G Y VR
Sbjct: 394 PFKGVKYTSRAGDYIVR 410

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/341 (20%), Positives = 136/341 (39%), Gaps = 81/341 (23%)

Query: 169 LTSKDMCLWRSEGIRYKKNEVYLDVFEHISILV-----NKDGAILKSYVDGSVQCVAHLS 223
           L S+++  WRS  ++Y  +E+Y+D+ E + ++      N    ++   ++G V   ++LS
Sbjct: 186 LESEEVVPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLS 245

Query: 224 GMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDK 283
           G P  +   +           +GN+ +A                        HQCV++ +
Sbjct: 246 GNPTVEMDMD----------LAGNEMYAPS---------------------MHQCVEMPQ 274

Query: 284 FDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMV----------TTLKGKSVEYRIT 333
                +  F+PPDG   L+ Y +  ++N   KVT  V            L     E  + 
Sbjct: 275 GSPSSLC-FIPPDGNCNLLNYTIDLDMNPKVKVTSPVGLVSVIYKDGLGLNRDEFEVHVN 333

Query: 334 LKSLFPSKLCAKDVELYIPAPPDTV-----------NAKINVSSGKGKFIPEENAIVWKI 382
           + S  PS    +D++L I   P              +A+++  + K +   E+  I   +
Sbjct: 334 I-SNSPSVPHIQDLKLQIELQPRIQELEEQEEEAQRDAEMDTEAKKERSQLEDGKIKV-L 391

Query: 383 HKYHGLTEN---------VFSAVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLV- 432
              HG  +N         +F +   P+G+        + S+ P+ ++     ++N G++ 
Sbjct: 392 RNTHGRFDNSVHPGRGTWIFDSE-TPVGSLPVLRGCVEDSKHPVRIQRVGVSYANEGMLP 450

Query: 433 ----VRYLKV------MEKDLNYNTVKWVKYISKSGAYEVR 463
               +R + V       E +      K VKY+ ++G YE+R
Sbjct: 451 SGIGLRRINVRSTTNLRENNRGKRLFKGVKYVCRTGDYEIR 491

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 56/138 (40%), Gaps = 42/138 (30%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQ--FGFND 234
           WR  GI Y  NE+++D+ E I+ +V K G +L  ++ G +    HLSG P+ +   G  D
Sbjct: 212 WRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKLGLLD 270

Query: 235 YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFD--------Q 286
           +     NT                                FH+C+  DK +        +
Sbjct: 271 HKLSHLNT-------------------------------TFHRCILEDKANSINDLIAGK 299

Query: 287 ERVIRFVPPDGLFELMKY 304
              + FVPPDG   L +Y
Sbjct: 300 FTKLTFVPPDGRTRLCQY 317

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 51/150 (34%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILVNKD--------------GAILKSYVDGSVQCVAHL 222
           WRS+ +++  NE+Y+D+ E + ++                    I+  Y+ G+    + L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 223 SGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLD 282
           +G P+ +             + SGND                     +    FH+CV +D
Sbjct: 263 NGNPLVELQL----------ELSGND---------------------IGHPSFHECVDID 291

Query: 283 KF----DQERV--IRFVPPDGLFELMKYHV 306
           ++    D   +  ++F+PPDG F LM Y +
Sbjct: 292 EYLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 64/151 (42%), Gaps = 49/151 (32%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISILV----------NKDGAILKSYVDGSVQCVAHLSGMP 226
           WR   + +  NE+YLD+ E I +++          N    I+   + G     + L+G P
Sbjct: 204 WRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLNGNP 263

Query: 227 VCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQ---LDK 283
           + +   +           +GND                     LE    H+CV+   +DK
Sbjct: 264 IVEMKID----------MAGND---------------------LESIFLHECVKSKDVDK 292

Query: 284 ---FDQERVIRFVPPDGLFELMKYHVRDNLN 311
              F+  ++I+F+PPDG F+L  Y++  NLN
Sbjct: 293 DQEFENTKLIKFLPPDGSFKLFDYNI--NLN 321

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 76/191 (39%), Gaps = 67/191 (35%)

Query: 147 ILNTPSWLVKAGARGM----SSENLGLTSKDMCL-WRSEGIRYKKNEVYLDVFEHISILV 201
           I+N  S  +++   G+    SS + G   +DM + WR  GI+  K E+Y+D+ E + +  
Sbjct: 159 IMNQSSGAMRSAGSGVAFNASSSSRG---EDMVVPWRRNGIKDAKEELYVDLKEEVYVTY 215

Query: 202 NK-------DG--------AILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSG 246
            K       DG         ++  ++ G++    +L+G P     F+          + G
Sbjct: 216 RKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRCYLNGNPTVSLMFD----------TMG 265

Query: 247 NDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLD-------------KFDQERVIRFV 293
           ND                     L    FH CV+ +              F  +R++RF+
Sbjct: 266 ND---------------------LGIPSFHACVEQEDQVQEQKQEQEPESFQGKRLLRFL 304

Query: 294 PPDGLFELMKY 304
           PPDG F L +Y
Sbjct: 305 PPDGKFRLAQY 315

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 68/165 (41%), Gaps = 61/165 (36%)

Query: 177 WRSEGIRYKKNEVYLDVFEHISI-----LVNKDG-------------------AILKSYV 212
           WR+  I+  KNE+Y+D+ E I +     + N+ G                    ++  Y+
Sbjct: 261 WRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNGYI 320

Query: 213 DGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILED 272
            G +   ++L+G P+ +   N          + GND       GT ++            
Sbjct: 321 TGVIDVRSYLNGNPIVEMKLN----------TCGNDM------GTPSL------------ 352

Query: 273 CKFHQCVQLD---KFDQERV---IRFVPPDGLFELMKYHVRDNLN 311
              H CV+L+     D ++V   ++F+PPDG F L +Y V  N N
Sbjct: 353 ---HPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKN 394

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 60/151 (39%), Gaps = 47/151 (31%)

Query: 172 KDMCLWRSEGIRYKKNEVYLDVF----------EHISILVNKDG--AILKSYVDGSVQCV 219
           +++  WRS  +  ++NE Y+DV            H S          ++   + G V C 
Sbjct: 203 EEIVPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCR 262

Query: 220 AHLSGMPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCV 279
            +LS  P+ +  FN++          G D       GT A+               H CV
Sbjct: 263 CYLSRDPIVEVTFNNH----------GCD------LGTPAL---------------HDCV 291

Query: 280 QLDKFDQ----ERVIRFVPPDGLFELMKYHV 306
           +LD   +       ++F+PPDG F LM+Y V
Sbjct: 292 ELDGVPEGPADHTTLKFIPPDGKFRLMEYSV 322

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 39/137 (28%)

Query: 177 WR-SEGIRYKKNEVYLDVFEHISILVNKDGAILK---SYVDGSVQCVAHLSGMPVCQFGF 232
           WR S+  +++ NE+Y+D+ E   ++     + L+     + G+V   ++L+  P+     
Sbjct: 201 WRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSVKL 260

Query: 233 NDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERV--- 289
           N          + GND                 G   L     H+CV++ K D E +   
Sbjct: 261 N----------TMGND----------------IGVPTL-----HECVEI-KDDGEFLPSN 288

Query: 290 IRFVPPDGLFELMKYHV 306
           I F+PPDG F L++Y V
Sbjct: 289 ITFIPPDGKFRLLEYSV 305

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 59/143 (41%), Gaps = 36/143 (25%)

Query: 169 LTSKDMCLWR-SEGIRYKKNEVYLDVFEHISILVNKDGA---ILKSYVDGSVQCVAHLSG 224
           + ++++  WR S   +++ NE+Y+D+ E   ++  K  +   +L   + G V   ++L+ 
Sbjct: 193 IENEEIVPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLND 252

Query: 225 MPVCQFGFNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQL-DK 283
            P+     N          + GND                     +     H CV++ D 
Sbjct: 253 NPLVAVKLN----------TMGND---------------------IGIPSLHDCVEINDG 281

Query: 284 FDQERVIRFVPPDGLFELMKYHV 306
                 I F+PPDG F L++Y V
Sbjct: 282 VFSPSNITFIPPDGKFRLLEYSV 304

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 89/235 (37%), Gaps = 52/235 (22%)

Query: 275 FHQCV-QLDKFDQERV--IRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYR 331
           FH CV +     QE++  + F+PPDG F LM+Y    N+NL       V  +     ++ 
Sbjct: 314 FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQY----NINLDQGKRHSVGLVHADIEDHL 369

Query: 332 ITLKSLF------PSKLCAKDVE-----LYIPAPPDTVNAKINVSSGKGKFIPEENAIVW 380
            TL   F       S    K +E     LY            ++SS + +F  E+  I  
Sbjct: 370 GTLGDEFEVTLNISSSTSVKHIEDMEVMLYFGLSHGNRKKDTHLSSDEEEFSVEQFRI-K 428

Query: 381 KIHKYHGLTENVFSAV---------------IVPM----------------GNGNDSLNL 409
            +   HG  EN+ S V                +P+                  G+DS   
Sbjct: 429 PLQITHGRLENMSSGVHKRSKWVFDKEVSTGTMPVLRGCVERQRSDEDVKDSKGSDSTAQ 488

Query: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKV-MEKDLNYNTVKWVKYISKSGAYEVR 463
                  I++ ++ +  SN GL +  + V    DL  N  K VKY + +  Y+VR
Sbjct: 489 RMLVLQSINISYKHTGSSN-GLQIESINVDTSADLQRNLFKGVKYHTIAKDYQVR 542

>NDAI0K00130 Chr11 (14830..15798) [969 bp, 322 aa] {ON} 
          Length = 322

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%)

Query: 232 FNDYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDC 273
           F++  +PS+NT S   + W  +E  T A+ N ++ S I ++C
Sbjct: 32  FSNSSTPSTNTYSVKQESWILDEPTTFALDNRVSSSWIFKEC 73

>KLLA0B10890g Chr2 (954119..955684) [1566 bp, 521 aa] {ON} similar
           to uniprot|Q06512 Saccharomyces cerevisiae YPR144C NOC4
           Nucleolar protein forms a complex with Nop14p that
           mediates maturation and nuclear export of 40S ribosomal
           subunits
          Length = 521

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 14/107 (13%)

Query: 275 FHQCVQL-----DKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFK----VTPMVTTLKG 325
           FHQ  +L     D ++Q  ++  +  +GLFELMK +  +  N   K    +TP V  +K 
Sbjct: 282 FHQPTKLMDFLTDSYNQGGIVSILSLNGLFELMKKYNLEYPNFYSKLYQLLTPEVMHVKY 341

Query: 326 KSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFI 372
           +S  +R+    L  + L A+ V  +I        A+++VS+  G  +
Sbjct: 342 RSRFFRLVDTFLSSTHLSAQLVASFIKRL-----ARLSVSAPPGAIV 383

>Skud_10.269 Chr10 (487160..488665) [1506 bp, 501 aa] {ON} YJR051W
           (REAL)
          Length = 501

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 14/97 (14%)

Query: 79  WEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIPRDTELTHIMPYISKKPLS 138
           +E +   +K L+  DI+S++S     ML  E++DI LDN    D  +T ++       L 
Sbjct: 165 FEIVQALSKRLK--DISSQNSKLMKIMLNSEVVDIELDN----DGHITGVL------YLD 212

Query: 139 ENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175
           EN  GS  IL + + +  +G  G S E LG  S ++ 
Sbjct: 213 EN--GSRQILKSRNVVFCSGGFGFSKEMLGEYSPNLV 247

>KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON}
           Anc_1.330
          Length = 332

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 14/103 (13%)

Query: 29  SEIFRIQVINNLDVRSPILTLGSTTFHHIRSNGGLWLVTVSRGNTDSAGIWEFL-YNFNK 87
           SE+F+ Q+IN + V +  L++   T   + SN     +T+           EFL YN ++
Sbjct: 82  SEVFQRQLINEIKVLNH-LSVNKFTVQMLSSNVSKKSITM-----------EFLPYNLHR 129

Query: 88  LLEVYDINSEDSLQGDFMLCYEILDIVLDNG-IPRDTELTHIM 129
           +L ++   +++  Q  F+   E ++ +  NG + RD +L +IM
Sbjct: 130 VLNLHATPTKEERQCYFIQICEAVEFLHGNGVVHRDLKLENIM 172

>ZYRO0C17974g Chr3 (1401551..1403920) [2370 bp, 789 aa] {ON} highly
           similar to uniprot|P39533 Saccharomyces cerevisiae
           YJL200C Hypothetical ORF
          Length = 789

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 46/112 (41%), Gaps = 10/112 (8%)

Query: 195 EHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSSNTQS---SGNDGWA 251
           E I   + +DG ++K++ D     +A+  G  + Q+   D    S  T S   S N  + 
Sbjct: 420 EQIRATLERDG-LIKTFTDNGATVLANACGPCIGQWDRQDVPKTSKETNSIFSSFNRNFR 478

Query: 252 EEENGTKAIKNAITGSVIL------EDCKFHQCVQLDKFDQERVIRFVPPDG 297
              +G +   N +T   I+       + +F+      K D  +  +F PP G
Sbjct: 479 ARNDGNRNTMNFLTSPEIVTAMIYSSNAQFNPVTDSIKLDNGKTFKFNPPVG 530

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,939,794
Number of extensions: 2543883
Number of successful extensions: 6610
Number of sequences better than 10.0: 86
Number of HSP's gapped: 6539
Number of HSP's successfully gapped: 113
Length of query: 464
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 351
Effective length of database: 40,524,141
Effective search space: 14223973491
Effective search space used: 14223973491
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)