Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_52363.162ON86448726440.0
ADR317C3.162ON81949021150.0
KLTH0F06468g3.162ON83751516910.0
Kwal_33.141673.162ON83850316660.0
SAKL0C07348g3.162ON86151616620.0
TDEL0D046003.162ON79550115600.0
ZYRO0B04906g3.162ON84738915510.0
KLLA0C03828g3.162ON79350114720.0
Kpol_1032.103.162ON79144514440.0
NCAS0I020803.162ON77448914240.0
TPHA0M003003.162ON77437514150.0
Suva_4.2213.162ON76543513771e-178
YDL028C (MPS1)3.162ON76443513671e-177
Skud_4.2233.162ON76943913641e-176
Smik_4.2073.162ON76539413581e-175
NDAI0A066203.162ON74743113221e-170
KAFR0F022203.162ON74742413201e-170
CAGL0K01617g3.162ON77441913041e-167
TBLA0F008603.162ON98038012951e-163
KNAG0K017403.162ON76542111421e-143
NCAS0C035603.162ON6414049341e-114
KLTH0E11220g8.482ON3023162703e-25
Smik_8.1805.406ON10733322811e-24
Skud_8.1635.406ON10763162773e-24
CAGL0L11550g5.406ON10723322773e-24
KLTH0D03454g1.271ON14332922766e-24
YHR102W (KIC1)5.406ON10803162731e-23
KLLA0F14190g1.271ON13383282722e-23
Kwal_56.224766.31ON6973062664e-23
TDEL0E021805.406ON9873102675e-23
KLLA0D11990g8.482ON3042962536e-23
NDAI0E021108.676ON9033052666e-23
Kwal_55.215455.406ON8653252657e-23
CAGL0L12474g8.482ON3022572528e-23
KLTH0C10912g6.31ON6973062648e-23
Suva_15.2975.406ON10742862658e-23
NDAI0C017005.406ON10203352659e-23
KNAG0B043205.406ON10273002659e-23
SAKL0H11638g8.482ON3043162529e-23
KAFR0H015308.482ON3062432511e-22
Skud_16.2518.482ON3052422502e-22
KNAG0F002901.52ON11252952632e-22
Suva_2.6871.52ON11283092622e-22
TPHA0I009201.271ON14342972632e-22
Suva_16.2868.482ON3052422492e-22
YDR507C (GIN4)1.52ON11422952622e-22
KAFR0D049505.406ON10082852622e-22
Smik_4.7891.52ON11362952622e-22
YPL031C (PHO85)8.482ON3052422483e-22
TBLA0B016303.177ON12952922613e-22
KLLA0B13607g2.496ON9893012603e-22
NCAS0H019405.406ON10153232604e-22
AFR724C1.24ON4403182534e-22
TDEL0B015408.482ON3042412474e-22
Kpol_1031.105.406ON11272862595e-22
CAGL0K02673g2.496ON9153032577e-22
Ecym_10301.24ON4403182517e-22
TPHA0C017808.482ON3053162458e-22
Kpol_463.81.271ON14472992588e-22
Kwal_26.73551.271ON14462922571e-21
NCAS0C024708.482ON3112432441e-21
Smik_3.1896.371ON7193272532e-21
KNAG0A023108.482ON3022422422e-21
Ecym_25318.482ON3012302412e-21
SAKL0D05522g1.271ON14742932542e-21
YJL095W (BCK1)1.271ON14782912533e-21
KLTH0F16676g5.406ON8783002523e-21
KNAG0B053502.496ON8363022523e-21
ACL104C5.406ON9472842523e-21
Skud_4.7831.52ON11352952523e-21
AGL242C8.482ON3033162403e-21
NDAI0C026806.31ON7503022504e-21
NDAI0A038702.496ON8953022514e-21
NCAS0C049403.92ON11163072514e-21
TBLA0C029401.271ON16433072524e-21
Kpol_1007.178.482ON3072592395e-21
NCAS0A002801.24ON5353272475e-21
NDAI0F045201.24ON4892912465e-21
Kpol_1055.242.496ON9373042496e-21
TPHA0H016305.406ON10362862497e-21
KLLA0C04191g3.177ON7972862487e-21
CAGL0I07513g3.92ON10763132498e-21
NCAS0A094701.271ON15153512499e-21
Kwal_26.78612.496ON9552862489e-21
CAGL0L03520g1.271ON14472932491e-20
ZYRO0F08074g8.482ON3043222361e-20
CAGL0K05709g1.52ON11032942481e-20
Ecym_63441.271ON13972932481e-20
KNAG0A067502.496ON7914052461e-20
SAKL0G01848g5.406ON8852882471e-20
KNAG0B017801.271ON15802912481e-20
Kwal_26.87968.676ON7962842461e-20
Smik_14.3776.371ON8953502461e-20
TBLA0I002802.496ON13163032471e-20
TBLA0A035705.406ON9753002461e-20
KLLA0F11143g8.676ON8133192452e-20
Skud_3.1656.371ON7163272452e-20
KLTH0D06006g2.496ON9542862462e-20
TBLA0A071501.52ON13912962462e-20
NDAI0G054701.271ON15553122462e-20
YNR047W (FPK1)6.371ON8933212452e-20
Sklu_YGOB_Anc_2.4962.496ON6193012432e-20
YCR091W (KIN82)6.371ON7203572432e-20
KAFR0G026906.31ON7132332433e-20
Kwal_56.226933.92ON9843032434e-20
Kpol_1037.63.177ON9773212434e-20
KAFR0D041001.52ON11172942434e-20
ZYRO0A06446g5.406ON9432862424e-20
Skud_14.3796.371ON8973502425e-20
TPHA0C004705.611ON6312842405e-20
TDEL0D014001.271ON14292942435e-20
KLTH0C09548g3.92ON9933012425e-20
SAKL0E01584g6.31ON6953372406e-20
SAKL0H06534g8.676ON8042842416e-20
NDAI0E031708.482ON3232312317e-20
TPHA0G032002.479ON15342472417e-20
TPHA0H023906.371ON7303152407e-20
TDEL0C064901.52ON11532952418e-20
Skud_10.1191.271ON14812912418e-20
KNAG0E008506.31ON7112332398e-20
YDR490C (PKH1)3.92ON7663132398e-20
KLLA0C12485g3.92ON9253112409e-20
NCAS0A050502.496ON8932862391e-19
NCAS0A055706.371ON9183592391e-19
TDEL0A027202.496ON9153022391e-19
Kpol_1028.166.371ON8793302381e-19
Suva_6.1691.271ON14843112391e-19
TDEL0A062208.676ON7942902381e-19
Skud_4.7643.92ON7563182371e-19
Ecym_55055.406ON10033432382e-19
SAKL0C01716g1.52ON12152422382e-19
Smik_10.1471.271ON14783272382e-19
KNAG0K012403.177ON9803112372e-19
SAKL0C00946g1.24ON5642882342e-19
Kwal_23.64586.371ON8683832362e-19
TPHA0H007603.177ON9802842362e-19
TPHA0M020806.371ON8893632362e-19
ZYRO0B01166g2.496ON9633012362e-19
NDAI0A006601.52ON10222432363e-19
TPHA0G032902.496ON9732852363e-19
KAFR0C009303.177ON9363022353e-19
ABL034W2.479ON14252842363e-19
TBLA0H016605.406ON9962842353e-19
TDEL0G043806.31ON7222332343e-19
CAGL0C03509g6.371ON8953242344e-19
ZYRO0A05214g3.177ON9413052344e-19
KAFR0A014201.271ON13983502354e-19
CAGL0J11638g6.31ON7462332334e-19
KAFR0H024308.676ON7843122335e-19
TPHA0E036401.52ON11372432345e-19
Smik_4.7673.92ON7583162335e-19
ZYRO0D17468g6.371ON8603672335e-19
KLTH0D11242g8.676ON7952922335e-19
Suva_2.6663.92ON7643132335e-19
ZYRO0G15290g1.271ON14873282345e-19
AER264C6.341ON14833082345e-19
NDAI0K023906.371ON8863262335e-19
Kpol_1037.523.229ON5123662306e-19
NCAS0B086001.52ON11172952336e-19
AFR696C1.52ON11422922336e-19
TPHA0M015003.338ON4303332286e-19
SAKL0C09174g3.92ON10713022336e-19
Kpol_2002.461.52ON11232952337e-19
ZYRO0C07480g6.31ON7742292317e-19
SAKL0C07722g3.177ON9123082327e-19
Ecym_10581.52ON11642922327e-19
KAFR0E010403.229ON5023082288e-19
Kpol_499.34.184ON3743252248e-19
Kpol_1037.206.31ON7042292309e-19
SAKL0B04488g4.184ON3683202249e-19
YMR001C (CDC5)6.31ON7052332309e-19
Suva_14.4026.371ON9053302319e-19
KAFR0D033902.496ON7982852301e-18
Skud_13.1546.31ON7052332301e-18
NDAI0G042903.92ON11133032311e-18
CAGL0K08514g2.479ON14892432311e-18
NDAI0K021002.496ON9093032301e-18
ACL006W6.31ON7082332291e-18
TBLA0B004906.31ON7872292291e-18
Suva_13.1636.31ON7052332282e-18
KLLA0C01650g1.52ON11122412292e-18
TDEL0A025502.479ON13692412292e-18
Skud_3.391.52ON10172962292e-18
Smik_13.1596.31ON7052332272e-18
Ecym_30356.31ON7402332272e-18
TBLA0B082503.92ON13473182292e-18
CAGL0K03399g2.446ON7033022272e-18
NCAS0D021006.31ON7262292272e-18
Kpol_1072.168.676ON7952892272e-18
KLLA0E21693g5.406ON10162882273e-18
KNAG0K006803.92ON10953152273e-18
NCAS0A043602.446ON6843042263e-18
KAFR0C047806.371ON7863662263e-18
TDEL0D053203.92ON10573182273e-18
TPHA0J004206.31ON7072332254e-18
TBLA0F002406.371ON12483592264e-18
ACR142W8.676ON8372852254e-18
Kpol_1023.266.31ON7392992254e-18
KLLA0C06138g6.31ON7082332244e-18
KAFR0G012001.24ON5072842225e-18
KLTH0C08932g3.229ON5193392225e-18
CAGL0K04169g4.184ON3983342195e-18
ZYRO0A03894g3.229ON4522972215e-18
TDEL0D044603.177ON9133132255e-18
Kwal_26.77882.479ON12672802255e-18
TDEL0A078606.371ON8373372246e-18
AFR092W1.271ON14232942256e-18
TBLA0A016308.482ON3512702176e-18
TDEL0D026504.184ON3663682176e-18
CAGL0G04609g3.92ON9653102246e-18
NDAI0G030303.177ON11192972247e-18
ZYRO0B06512g3.92ON11113202247e-18
NCAS0A053706.341ON15083092247e-18
YOL100W (PKH2)3.92ON10813522247e-18
YKL101W (HSL1)2.479ON15182432247e-18
KLLA0F24618g3.229ON5563372218e-18
Ecym_24996.341ON15413082248e-18
KAFR0A017602.496ON8853012238e-18
CAGL0M02233g8.676ON7672852229e-18
TBLA0B038408.676ON8582822221e-17
TBLA0D022308.141ON11543432231e-17
Ecym_73922.479ON14342842231e-17
KNAG0D002106.371ON8333302211e-17
CAGL0K02167g8.140ON11623382221e-17
Skud_11.1262.479ON15182432221e-17
TDEL0A020102.425ON4852402181e-17
Suva_3.1901.52ON10242892211e-17
KNAG0A065402.479ON14322452221e-17
ZYRO0A12826g4.184ON3662432141e-17
KNAG0B032305.611ON6413362201e-17
KAFR0D030202.446ON6773352201e-17
KAFR0C014403.92ON10952942212e-17
CAGL0K07458g2.446ON7043062192e-17
Kpol_1018.655.611ON6012212192e-17
NCAS0A123502.496ON7463202202e-17
Smik_3.1736.341ON13403072212e-17
Ecym_35863.92ON10773242202e-17
TPHA0F024306.31ON7982352192e-17
TDEL0C067801.24ON4683232162e-17
NCAS0C013708.676ON7992902192e-17
Suva_8.472.496ON9803022202e-17
KLLA0B11946g3.338ON4393202152e-17
Smik_6.3508.676ON8222822192e-17
Kwal_56.227883.229ON5153712172e-17
Ecym_46527.441ON11433652192e-17
Skud_1.723.177ON9742842193e-17
TBLA0D050101.374ON4343292153e-17
Smik_1.793.177ON9742842183e-17
CAGL0M08910g5.611ON6123532163e-17
TPHA0D028405.611ON6342862173e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_5236
         (864 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...  1023   0.0  
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   819   0.0  
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   655   0.0  
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   646   0.0  
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   644   0.0  
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   605   0.0  
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   602   0.0  
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   571   0.0  
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   560   0.0  
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    553   0.0  
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   549   0.0  
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   535   e-178
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   531   e-177
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   530   e-176
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   527   e-175
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   513   e-170
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   513   e-170
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   506   e-167
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   503   e-163
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   444   e-143
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...   364   e-114
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   108   3e-25
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   112   1e-24
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   111   3e-24
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   111   3e-24
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   110   6e-24
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   109   1e-23
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   109   2e-23
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   107   4e-23
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   107   5e-23
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   102   6e-23
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   107   6e-23
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   106   7e-23
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   101   8e-23
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   106   8e-23
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   106   8e-23
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   106   9e-23
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   106   9e-23
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   101   9e-23
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   101   1e-22
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   100   2e-22
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   105   2e-22
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   105   2e-22
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   105   2e-22
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   100   2e-22
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   105   2e-22
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   105   2e-22
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   105   2e-22
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   100   3e-22
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   105   3e-22
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   104   3e-22
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   104   4e-22
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   102   4e-22
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   100   4e-22
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   104   5e-22
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   103   7e-22
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   101   7e-22
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    99   8e-22
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   103   8e-22
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   103   1e-21
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    99   1e-21
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   102   2e-21
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    98   2e-21
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    97   2e-21
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   102   2e-21
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   102   3e-21
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   101   3e-21
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   101   3e-21
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   101   3e-21
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...   101   3e-21
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    97   3e-21
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   100   4e-21
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    101   4e-21
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   101   4e-21
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   101   4e-21
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    97   5e-21
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24       100   5e-21
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    99   5e-21
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   100   6e-21
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   100   7e-21
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   100   7e-21
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   100   8e-21
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   100   9e-21
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   100   9e-21
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   100   1e-20
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    96   1e-20
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   100   1e-20
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   100   1e-20
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    99   1e-20
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   100   1e-20
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   100   1e-20
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    99   1e-20
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    99   1e-20
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   100   1e-20
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    99   1e-20
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    99   2e-20
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    99   2e-20
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    99   2e-20
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    99   2e-20
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    99   2e-20
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    99   2e-20
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    98   2e-20
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    98   2e-20
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    98   3e-20
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    98   4e-20
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    98   4e-20
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    98   4e-20
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    98   4e-20
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    98   5e-20
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    97   5e-20
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    98   5e-20
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    98   5e-20
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    97   6e-20
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    97   6e-20
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    94   7e-20
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    97   7e-20
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    97   7e-20
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    97   8e-20
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    97   8e-20
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    97   8e-20
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    97   8e-20
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    97   9e-20
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    97   1e-19
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    97   1e-19
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    97   1e-19
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    96   1e-19
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    97   1e-19
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    96   1e-19
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    96   1e-19
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    96   2e-19
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    96   2e-19
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    96   2e-19
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    96   2e-19
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    95   2e-19
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    96   2e-19
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    96   2e-19
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    96   2e-19
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    96   2e-19
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     96   3e-19
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    96   3e-19
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    95   3e-19
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    96   3e-19
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    95   3e-19
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    95   3e-19
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    95   4e-19
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    95   4e-19
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    95   4e-19
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    94   4e-19
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    94   5e-19
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    95   5e-19
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    94   5e-19
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    94   5e-19
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    94   5e-19
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    94   5e-19
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    95   5e-19
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    95   5e-19
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    94   5e-19
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    93   6e-19
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    94   6e-19
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    94   6e-19
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    92   6e-19
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    94   6e-19
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    94   7e-19
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    94   7e-19
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    94   7e-19
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    94   7e-19
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    92   8e-19
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    91   8e-19
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    93   9e-19
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    91   9e-19
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    93   9e-19
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    94   9e-19
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    93   1e-18
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    93   1e-18
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    94   1e-18
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    94   1e-18
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    93   1e-18
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    93   1e-18
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    93   1e-18
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    92   2e-18
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    93   2e-18
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    93   2e-18
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    93   2e-18
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    92   2e-18
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    92   2e-18
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    93   2e-18
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    92   2e-18
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      92   2e-18
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    92   2e-18
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    92   3e-18
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    92   3e-18
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     92   3e-18
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    92   3e-18
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    92   3e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    91   4e-18
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    92   4e-18
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    91   4e-18
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    91   4e-18
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    91   4e-18
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    90   5e-18
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    90   5e-18
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    89   5e-18
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    90   5e-18
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    91   5e-18
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    91   5e-18
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    91   6e-18
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    91   6e-18
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    88   6e-18
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    88   6e-18
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    91   6e-18
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              91   7e-18
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    91   7e-18
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    91   7e-18
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    91   7e-18
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    91   7e-18
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    90   8e-18
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    91   8e-18
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    91   8e-18
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    90   9e-18
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    90   1e-17
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    91   1e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    91   1e-17
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    90   1e-17
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    90   1e-17
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    90   1e-17
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    89   1e-17
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    90   1e-17
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    90   1e-17
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    87   1e-17
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    89   1e-17
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    89   1e-17
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    90   2e-17
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    89   2e-17
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    89   2e-17
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    89   2e-17
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    90   2e-17
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    89   2e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    89   2e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    88   2e-17
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    89   2e-17
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    89   2e-17
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    87   2e-17
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    89   2e-17
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    88   2e-17
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    89   2e-17
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    89   3e-17
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    87   3e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    89   3e-17
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    88   3e-17
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               88   3e-17
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    89   3e-17
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    88   3e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    87   4e-17
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    89   4e-17
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    88   4e-17
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    87   4e-17
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    88   4e-17
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    87   5e-17
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    89   5e-17
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    87   5e-17
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    88   5e-17
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    88   5e-17
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    88   5e-17
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    88   5e-17
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    88   5e-17
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    88   6e-17
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    88   6e-17
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    88   6e-17
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    88   6e-17
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    87   6e-17
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    87   6e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    86   7e-17
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    88   7e-17
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    88   7e-17
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    83   7e-17
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    86   7e-17
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    87   7e-17
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    87   8e-17
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    87   8e-17
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     85   8e-17
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    87   8e-17
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    85   9e-17
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    86   9e-17
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    86   9e-17
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    85   1e-16
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    87   1e-16
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    87   1e-16
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    87   1e-16
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    87   1e-16
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    87   1e-16
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               87   1e-16
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    87   1e-16
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    86   1e-16
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    86   1e-16
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    86   1e-16
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    87   1e-16
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    86   1e-16
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    87   1e-16
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    86   1e-16
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    86   1e-16
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    85   1e-16
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    84   1e-16
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    85   1e-16
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    86   1e-16
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    86   2e-16
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    86   2e-16
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    87   2e-16
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    86   2e-16
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    86   2e-16
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    84   2e-16
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    86   2e-16
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              86   2e-16
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    86   2e-16
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    84   2e-16
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    86   2e-16
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    86   2e-16
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    86   2e-16
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    85   2e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    85   2e-16
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    84   3e-16
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    85   3e-16
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    86   3e-16
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    85   3e-16
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    84   3e-16
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    86   3e-16
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    84   3e-16
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    86   3e-16
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    84   3e-16
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             85   3e-16
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    85   3e-16
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    83   3e-16
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    85   4e-16
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    83   4e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    84   4e-16
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    85   4e-16
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    85   4e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    85   4e-16
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    85   4e-16
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    84   4e-16
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    85   4e-16
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    83   5e-16
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    85   5e-16
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    84   5e-16
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    83   5e-16
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    84   5e-16
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    83   5e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    84   6e-16
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    85   6e-16
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    83   6e-16
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    84   6e-16
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    84   7e-16
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    83   7e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    85   7e-16
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    84   7e-16
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    85   7e-16
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    84   7e-16
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    82   7e-16
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    82   7e-16
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    84   8e-16
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      85   8e-16
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               84   8e-16
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    84   8e-16
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    84   8e-16
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    83   9e-16
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    84   9e-16
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    82   9e-16
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    84   9e-16
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    83   1e-15
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    84   1e-15
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    84   1e-15
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    82   1e-15
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    84   1e-15
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    84   1e-15
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    84   1e-15
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    81   1e-15
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    83   1e-15
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    82   1e-15
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    84   1e-15
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    82   1e-15
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    83   2e-15
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    83   2e-15
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    81   2e-15
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    83   2e-15
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    83   2e-15
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    83   2e-15
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    82   2e-15
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    83   2e-15
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               82   2e-15
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             83   2e-15
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    82   2e-15
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    81   2e-15
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    82   2e-15
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    82   2e-15
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    83   2e-15
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    83   2e-15
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    83   2e-15
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    82   2e-15
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    83   2e-15
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    81   2e-15
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    81   3e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    81   3e-15
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    82   3e-15
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    81   3e-15
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    82   3e-15
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    80   3e-15
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    82   3e-15
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    81   3e-15
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    81   3e-15
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    82   3e-15
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    82   3e-15
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    82   3e-15
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    81   3e-15
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    81   3e-15
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    82   3e-15
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    81   3e-15
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    82   3e-15
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    80   4e-15
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    81   4e-15
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    80   4e-15
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    81   4e-15
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    80   4e-15
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    82   4e-15
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    81   4e-15
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    81   4e-15
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    80   5e-15
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    81   5e-15
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     82   5e-15
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    79   5e-15
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    82   5e-15
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    80   5e-15
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    80   5e-15
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    81   5e-15
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    82   5e-15
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    82   5e-15
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    81   6e-15
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    81   6e-15
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    80   6e-15
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    81   6e-15
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    79   6e-15
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    82   6e-15
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    82   6e-15
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    81   6e-15
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    81   6e-15
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    79   6e-15
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    82   6e-15
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    80   6e-15
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    80   6e-15
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    81   6e-15
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    81   6e-15
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    82   6e-15
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    81   7e-15
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    79   7e-15
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    80   7e-15
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    81   7e-15
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    81   7e-15
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    79   7e-15
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    81   7e-15
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    79   7e-15
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    80   7e-15
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    80   7e-15
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    81   7e-15
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    80   8e-15
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    81   8e-15
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    79   8e-15
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    81   8e-15
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    81   8e-15
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    79   8e-15
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    80   9e-15
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    79   9e-15
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    79   9e-15
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    81   9e-15
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    80   9e-15
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    81   1e-14
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    81   1e-14
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    79   1e-14
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    80   1e-14
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    80   1e-14
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    79   1e-14
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    77   1e-14
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    80   1e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    80   1e-14
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    80   1e-14
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    81   1e-14
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    80   1e-14
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    80   1e-14
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    79   1e-14
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    80   1e-14
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    80   1e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    80   1e-14
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    80   1e-14
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    78   1e-14
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    80   2e-14
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    80   2e-14
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    79   2e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    80   2e-14
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    78   2e-14
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    80   2e-14
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    78   2e-14
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    79   2e-14
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    79   2e-14
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    79   2e-14
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    80   2e-14
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    80   2e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    80   2e-14
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    78   2e-14
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    77   2e-14
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    79   2e-14
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    78   2e-14
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    80   2e-14
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    77   2e-14
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    78   2e-14
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    79   2e-14
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    78   2e-14
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    78   2e-14
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    79   2e-14
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    78   2e-14
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    76   2e-14
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    79   3e-14
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    79   3e-14
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    77   3e-14
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    78   3e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    79   3e-14
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    79   3e-14
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    79   3e-14
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    79   3e-14
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    78   3e-14
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    79   3e-14
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    79   3e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    78   3e-14
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    79   3e-14
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    79   3e-14
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     78   3e-14
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    79   3e-14
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    79   3e-14
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    79   3e-14
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    79   3e-14
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    78   3e-14
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    77   4e-14
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    77   4e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    78   4e-14
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    77   4e-14
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    77   4e-14
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    78   4e-14
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    78   4e-14
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    79   4e-14
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    78   4e-14
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    78   4e-14
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    77   4e-14
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    77   4e-14
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    77   4e-14
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    78   5e-14
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    77   5e-14
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    77   5e-14
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    78   5e-14
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    75   5e-14
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    77   5e-14
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    79   5e-14
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    79   5e-14
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    77   5e-14
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    77   5e-14
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    77   5e-14
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    77   5e-14
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    76   5e-14
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    76   5e-14
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    76   6e-14
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              78   6e-14
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    77   6e-14
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               77   6e-14
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     76   6e-14
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    77   6e-14
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    75   6e-14
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    77   6e-14
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    78   6e-14
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    78   6e-14
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    78   6e-14
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    78   6e-14
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    78   6e-14
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    77   7e-14
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    77   7e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     78   7e-14
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    78   7e-14
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    78   7e-14
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    75   7e-14
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    78   7e-14
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    77   7e-14
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    76   7e-14
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    77   7e-14
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    77   7e-14
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    76   7e-14
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    78   7e-14
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    77   7e-14
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    78   8e-14
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    77   8e-14
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    77   8e-14
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    76   8e-14
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     76   8e-14
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    76   9e-14
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    76   9e-14
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    75   9e-14
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    76   9e-14
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    75   9e-14
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    75   9e-14
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    78   9e-14
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    76   9e-14
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    77   9e-14
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    75   9e-14
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    77   1e-13
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    76   1e-13
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    76   1e-13
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    75   1e-13
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    77   1e-13
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    75   1e-13
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    75   1e-13
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    77   1e-13
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    77   1e-13
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    77   1e-13
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    77   1e-13
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    74   1e-13
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    76   1e-13
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    77   1e-13
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    75   1e-13
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    75   1e-13
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    77   1e-13
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    75   1e-13
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    74   1e-13
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    76   1e-13
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    75   1e-13
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    77   1e-13
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               77   1e-13
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    75   1e-13
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    77   2e-13
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    76   2e-13
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    75   2e-13
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    76   2e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    75   2e-13
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     76   2e-13
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    77   2e-13
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    75   2e-13
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    77   2e-13
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    76   2e-13
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    77   2e-13
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    76   2e-13
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    77   2e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   2e-13
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    76   2e-13
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    75   2e-13
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    76   2e-13
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    76   2e-13
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    76   2e-13
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    76   2e-13
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    76   2e-13
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    74   2e-13
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     76   2e-13
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    76   2e-13
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    76   2e-13
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    74   2e-13
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    75   2e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    75   2e-13
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    74   3e-13
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    75   3e-13
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    75   3e-13
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    74   3e-13
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    74   3e-13
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    75   3e-13
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    75   3e-13
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    75   3e-13
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    75   3e-13
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    76   3e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    76   3e-13
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    76   3e-13
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    73   3e-13
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    75   3e-13
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    76   3e-13
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    76   3e-13
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    75   3e-13
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    76   3e-13
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    74   3e-13
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    75   3e-13
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    76   3e-13
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    75   3e-13
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    75   3e-13
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    74   4e-13
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    74   4e-13
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    75   4e-13
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    75   4e-13
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    75   4e-13
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    74   4e-13
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    75   4e-13
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    73   4e-13
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    73   4e-13
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    75   4e-13
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    74   4e-13
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    75   4e-13
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    73   5e-13
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    73   5e-13
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    74   5e-13
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    75   5e-13
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    75   5e-13
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    74   6e-13
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    75   6e-13
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    75   6e-13
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     73   6e-13
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    74   6e-13
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    75   7e-13
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    74   7e-13
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    75   7e-13
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    74   7e-13
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     74   7e-13
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    70   8e-13
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    74   8e-13
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    74   8e-13
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     74   8e-13
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    74   8e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    74   8e-13
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    74   8e-13
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    74   8e-13
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    74   8e-13
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    72   8e-13
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       74   8e-13
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    74   8e-13
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    74   8e-13
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    74   8e-13
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    74   8e-13
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    74   8e-13
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    74   8e-13
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    74   9e-13
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    74   9e-13
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    73   9e-13
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       73   9e-13
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    72   9e-13
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    72   9e-13
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    74   9e-13
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     74   9e-13
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    74   1e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    74   1e-12
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    74   1e-12
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    74   1e-12
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    74   1e-12
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    74   1e-12
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    74   1e-12
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    74   1e-12
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    74   1e-12
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    74   1e-12
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    74   1e-12
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    74   1e-12
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    74   1e-12
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    71   1e-12
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    74   1e-12
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    74   1e-12
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    74   1e-12
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    74   1e-12
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    73   1e-12
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    74   1e-12
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    73   1e-12
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    74   1e-12
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    74   1e-12
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    73   1e-12
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    74   1e-12
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    74   1e-12
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    73   1e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    74   1e-12
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    71   1e-12
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    74   1e-12
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    74   2e-12
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    74   2e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    72   2e-12
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    73   2e-12
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    73   2e-12
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    72   2e-12
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    72   2e-12
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    73   2e-12
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    72   2e-12
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    73   2e-12
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    72   2e-12
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              71   2e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    73   2e-12
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    73   2e-12
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    72   2e-12
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    73   2e-12
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    72   2e-12
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    73   2e-12
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    73   2e-12
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    73   2e-12
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    72   2e-12
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    70   2e-12
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    71   2e-12
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    73   2e-12
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    73   2e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    71   2e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    73   2e-12
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    73   2e-12
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    72   2e-12
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    72   2e-12
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    72   2e-12
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              72   2e-12
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    72   2e-12
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    73   2e-12
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    72   3e-12
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    73   3e-12
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 72   3e-12
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    72   3e-12
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    72   3e-12
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    72   3e-12
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    72   3e-12
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     72   3e-12
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    70   3e-12
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               72   3e-12
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    71   3e-12
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    72   3e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    73   3e-12
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    71   3e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    72   3e-12
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    72   3e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    73   3e-12
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    72   3e-12
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    71   3e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    72   3e-12
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    72   3e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    72   4e-12
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    72   4e-12
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    71   4e-12
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    72   4e-12
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    71   4e-12
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    72   4e-12
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    70   4e-12
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    71   4e-12
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    72   4e-12
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    72   4e-12
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    72   4e-12
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    72   5e-12
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    72   5e-12
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    71   5e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    72   5e-12
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    72   5e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    72   5e-12
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               72   5e-12
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    71   5e-12
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    71   5e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    71   5e-12
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    72   5e-12
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    71   5e-12
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    72   5e-12
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    72   5e-12
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    72   5e-12
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    71   5e-12
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    72   6e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    70   6e-12
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    72   6e-12
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    70   6e-12
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    70   6e-12
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    71   6e-12
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    72   6e-12
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    71   6e-12
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    71   6e-12
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    69   6e-12
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    71   6e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    71   7e-12
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    70   7e-12
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    69   7e-12
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    71   7e-12
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    71   7e-12
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    71   7e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    70   7e-12
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    70   7e-12
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    71   8e-12
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    71   8e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    70   9e-12
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    70   9e-12
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    71   9e-12
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    69   1e-11
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    69   1e-11
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    70   1e-11
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    70   1e-11
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    71   1e-11
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    70   1e-11
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               69   1e-11
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    70   1e-11
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    70   1e-11
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    70   1e-11
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    70   1e-11
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    70   1e-11
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    70   1e-11
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    69   1e-11
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    69   1e-11
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    70   1e-11
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    70   1e-11
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    70   1e-11
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    69   1e-11
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    69   1e-11
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    69   1e-11
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    69   1e-11
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    70   1e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    70   1e-11
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    70   1e-11
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    70   2e-11
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    70   2e-11
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    70   2e-11
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    69   2e-11
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    69   2e-11
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    70   2e-11
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    69   2e-11
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    70   2e-11
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    70   2e-11
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    70   2e-11
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    69   2e-11
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    70   2e-11
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               70   2e-11
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    70   2e-11
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    70   2e-11
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    69   2e-11
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    70   2e-11
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    70   2e-11
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    69   2e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    69   2e-11
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    70   2e-11
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    69   2e-11
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    70   2e-11
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    69   2e-11
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    69   2e-11
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    69   2e-11
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    70   2e-11
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    69   2e-11
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    69   2e-11
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    69   3e-11
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    69   3e-11
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    68   3e-11
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              69   3e-11
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    69   3e-11
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    69   3e-11
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    69   3e-11
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    69   3e-11
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    69   3e-11
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    69   3e-11
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    69   3e-11
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    69   3e-11
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    69   3e-11
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    69   3e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    69   3e-11
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    68   3e-11
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    69   3e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    69   3e-11
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    69   3e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    68   3e-11
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    69   3e-11
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    69   4e-11
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    69   4e-11
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    69   4e-11
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    68   4e-11
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    69   4e-11
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    69   4e-11
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               69   4e-11
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    67   4e-11
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    69   4e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    69   4e-11
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    69   4e-11
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    68   4e-11
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    69   4e-11
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    69   5e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     69   5e-11
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    69   5e-11
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    68   5e-11
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    69   5e-11
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    68   5e-11
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    67   5e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    68   5e-11
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    68   5e-11
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    68   6e-11
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    68   6e-11
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    67   6e-11
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     67   6e-11
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    68   6e-11
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    68   7e-11
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    68   7e-11
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    68   7e-11
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    67   7e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    68   8e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    68   8e-11
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    67   8e-11
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    68   8e-11
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    68   8e-11
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    67   8e-11
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    66   8e-11
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    67   8e-11
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    68   9e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    68   9e-11
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    67   9e-11
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    68   9e-11
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    67   9e-11
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    68   9e-11
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    67   9e-11
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    67   1e-10
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    67   1e-10
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    67   1e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    68   1e-10
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    67   1e-10
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    67   1e-10
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    67   1e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    67   1e-10
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    67   1e-10
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    67   1e-10
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    67   1e-10
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    67   1e-10
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    66   1e-10
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      67   1e-10
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              67   1e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       67   1e-10
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    67   1e-10
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    67   1e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    67   1e-10
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    66   1e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    67   1e-10
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    66   1e-10
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    67   1e-10
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    66   1e-10
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    66   1e-10
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    66   1e-10
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    67   1e-10
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    67   1e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    67   2e-10
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    67   2e-10
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    66   2e-10
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    67   2e-10
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    65   2e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    66   2e-10
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    67   2e-10
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    67   2e-10
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    66   2e-10
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    66   2e-10
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    67   2e-10
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    66   2e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     66   2e-10
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    67   2e-10
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    66   2e-10
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    67   2e-10
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    67   2e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    66   2e-10
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    66   2e-10
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    65   2e-10
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    66   2e-10
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    66   2e-10
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    66   2e-10
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    66   2e-10
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    65   2e-10
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    66   2e-10
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    66   3e-10
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    66   3e-10
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    65   3e-10
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    65   3e-10
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    65   3e-10
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    65   3e-10
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    66   3e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    66   3e-10
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    66   3e-10
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    65   3e-10
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    66   3e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    65   3e-10
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    66   3e-10
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    66   3e-10
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    66   3e-10
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    65   3e-10
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    65   3e-10
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    65   4e-10
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    65   4e-10
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    65   4e-10
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    65   4e-10
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    65   4e-10
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    65   4e-10
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    65   4e-10
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    65   4e-10
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    65   4e-10
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    64   4e-10
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    65   4e-10
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    66   4e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   4e-10
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               65   4e-10
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    65   4e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    65   4e-10
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    65   4e-10
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    65   4e-10
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    65   5e-10
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    65   5e-10
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    65   5e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    65   5e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    65   5e-10
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    65   5e-10
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    65   5e-10
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    65   5e-10
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    65   5e-10
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    64   5e-10
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    65   5e-10
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    65   5e-10
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    64   5e-10
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      65   5e-10
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    65   6e-10
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    65   6e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    65   6e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    65   6e-10
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    64   6e-10
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    64   6e-10
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    63   6e-10
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    64   6e-10
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    64   6e-10
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    65   6e-10
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    64   6e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    65   6e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   7e-10
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    65   7e-10
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    65   7e-10
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    65   7e-10
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    65   7e-10
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    65   7e-10
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    65   7e-10
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    65   7e-10
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    65   7e-10
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    65   7e-10
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    65   7e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    64   8e-10
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    64   8e-10
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    64   8e-10
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    64   8e-10
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    63   8e-10
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    65   8e-10
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    64   8e-10
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    64   8e-10
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    64   8e-10
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    64   9e-10
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    64   9e-10
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    64   9e-10
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    64   9e-10
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    64   9e-10
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    64   9e-10
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    63   9e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    64   9e-10
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    64   9e-10
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    64   9e-10
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    64   1e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     64   1e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    64   1e-09
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    64   1e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    64   1e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    64   1e-09
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    62   1e-09
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    63   1e-09
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    63   1e-09
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    64   1e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    64   1e-09
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    64   1e-09
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    64   1e-09
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    64   1e-09
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    64   1e-09
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    62   1e-09
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    64   1e-09
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    63   1e-09
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    64   1e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    63   1e-09
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    64   1e-09
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    64   1e-09
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    64   1e-09
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    64   1e-09
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    62   1e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    63   1e-09
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    64   1e-09
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    64   1e-09
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               63   1e-09
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    64   1e-09
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    64   1e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    63   1e-09
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    63   1e-09
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    62   1e-09
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    63   1e-09
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    64   1e-09
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    64   1e-09
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    64   1e-09
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    64   2e-09
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    64   2e-09
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    64   2e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    63   2e-09
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    64   2e-09
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    64   2e-09
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    63   2e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    64   2e-09
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    63   2e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    64   2e-09
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    63   2e-09
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    63   2e-09
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    63   2e-09
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    61   2e-09
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    63   2e-09
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    63   2e-09
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    63   2e-09
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    63   2e-09
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    63   2e-09
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    63   2e-09
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    62   2e-09
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    63   2e-09
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    62   2e-09
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    62   2e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    63   2e-09
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    63   2e-09
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    62   2e-09
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    63   2e-09
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    62   3e-09
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    62   3e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    63   3e-09
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    63   3e-09
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    62   3e-09
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    63   3e-09
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    62   3e-09
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    62   3e-09
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    62   3e-09
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    63   3e-09
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    62   3e-09
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    62   3e-09
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    62   3e-09
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    62   3e-09
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    62   3e-09
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    62   4e-09
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    62   4e-09
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    62   4e-09
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    62   4e-09
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    62   4e-09
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    62   4e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    62   4e-09
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    62   4e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    62   4e-09
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    62   4e-09
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    62   4e-09
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    62   4e-09
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    62   4e-09
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    62   5e-09
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    62   5e-09
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     62   5e-09
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    62   5e-09
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    62   5e-09
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    62   5e-09
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    61   5e-09
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    62   5e-09
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    62   5e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    61   5e-09
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    62   5e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    62   5e-09
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    62   5e-09
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    62   5e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    61   5e-09
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    60   6e-09
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    62   6e-09
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    62   6e-09
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    62   6e-09
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     62   6e-09
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    62   6e-09
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    62   6e-09
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    61   6e-09
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               61   6e-09
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    62   6e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    60   6e-09
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    62   7e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    62   7e-09
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    60   7e-09
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    62   7e-09
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    62   7e-09
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    62   7e-09
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    60   7e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    62   7e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    60   7e-09
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    61   7e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    61   7e-09
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    62   8e-09
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    60   8e-09
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    61   8e-09
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    60   8e-09
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    61   8e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    61   8e-09
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    61   8e-09
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    61   9e-09
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    60   9e-09
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    60   9e-09
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    61   9e-09
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    61   9e-09
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    61   9e-09
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    60   9e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    61   1e-08
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    61   1e-08
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    61   1e-08
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    60   1e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    61   1e-08
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    60   1e-08
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    61   1e-08
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    60   1e-08
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    61   1e-08
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    61   1e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    61   1e-08
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    60   1e-08
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      61   1e-08
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    60   1e-08
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    61   1e-08
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    61   1e-08
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    60   1e-08
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    61   1e-08
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    60   1e-08
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    61   1e-08
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    61   1e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    60   1e-08
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    60   1e-08
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    60   1e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    61   1e-08
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    60   1e-08
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    60   1e-08
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    60   1e-08
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    60   1e-08
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    60   1e-08
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    60   2e-08
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    59   2e-08
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    60   2e-08
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    60   2e-08
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    60   2e-08
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    60   2e-08
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    60   2e-08
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    60   2e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    60   2e-08
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    60   2e-08
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    59   2e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    60   2e-08
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               60   2e-08
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    60   2e-08
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    59   2e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    60   2e-08
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     59   2e-08
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    60   2e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    60   2e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    60   2e-08
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    59   2e-08
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    60   2e-08
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    59   2e-08
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    60   2e-08
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    60   2e-08
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    58   2e-08
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    60   2e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              60   3e-08
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    59   3e-08
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    60   3e-08
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    59   3e-08
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    59   3e-08
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    59   3e-08
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    60   3e-08
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    60   3e-08
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    60   3e-08
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    60   3e-08
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    59   3e-08
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    59   3e-08
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    59   3e-08
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    58   3e-08
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    58   3e-08
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    59   3e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    59   3e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     59   3e-08
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    59   3e-08
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    59   3e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    59   3e-08
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    59   4e-08
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    59   4e-08
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    59   4e-08
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    59   4e-08
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    59   4e-08
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    59   4e-08
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    59   4e-08
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    59   4e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    59   4e-08
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    59   4e-08
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    59   4e-08
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    59   4e-08
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    58   4e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    59   4e-08
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    58   4e-08
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    59   5e-08
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    58   5e-08
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    59   5e-08
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    59   5e-08
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    59   5e-08
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    59   5e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    59   5e-08
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    59   5e-08
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    59   5e-08
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    59   5e-08
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    58   5e-08
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    59   6e-08
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    59   6e-08
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    57   6e-08
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    58   6e-08
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    59   6e-08
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    59   6e-08
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     58   6e-08
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    59   6e-08
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    58   6e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    57   7e-08
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    58   7e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    58   7e-08
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    59   7e-08
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    58   7e-08
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    58   7e-08
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    58   8e-08
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    58   8e-08
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    58   8e-08
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    58   8e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    58   8e-08
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    57   8e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    58   8e-08
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    58   8e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    58   9e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    57   9e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    58   9e-08
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    57   9e-08
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               57   1e-07
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    58   1e-07
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    58   1e-07
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    57   1e-07
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    57   1e-07
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    58   1e-07
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    57   1e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    57   1e-07
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    57   1e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    58   1e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    57   1e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    58   1e-07
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    58   1e-07
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              58   1e-07
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    57   1e-07
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    57   1e-07
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    57   1e-07
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    57   1e-07
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    57   1e-07
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    57   1e-07
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    57   1e-07
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    57   1e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    57   1e-07
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    57   1e-07
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    57   1e-07
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    57   1e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    57   2e-07
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    57   2e-07
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    57   2e-07
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    57   2e-07
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    57   2e-07
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              57   2e-07
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    57   2e-07
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    57   2e-07
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    57   2e-07
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    57   2e-07
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     57   2e-07
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    57   2e-07
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    56   2e-07
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    57   2e-07
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    57   2e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    57   2e-07
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    57   2e-07
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    57   2e-07
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    56   2e-07
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    57   2e-07
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    53   2e-07
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    57   2e-07
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    57   2e-07
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    57   2e-07
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    57   2e-07
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    57   3e-07
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    57   3e-07
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    55   3e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    56   3e-07
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    56   3e-07
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    56   3e-07
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    56   3e-07
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    56   3e-07
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      56   3e-07
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    56   3e-07
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    56   3e-07
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    56   4e-07
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    55   4e-07
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    56   4e-07
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    56   4e-07
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    55   4e-07
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    55   4e-07
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    56   4e-07
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    55   4e-07
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    56   4e-07
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    56   4e-07
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    56   5e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    55   5e-07
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    55   5e-07
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    55   5e-07
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    56   5e-07
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    55   5e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    55   5e-07
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    55   6e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    55   6e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    55   6e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    55   6e-07
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    54   6e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    55   6e-07
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    55   6e-07
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    55   7e-07
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    55   7e-07
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    55   7e-07
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    55   7e-07
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    54   7e-07
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    55   7e-07
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    55   7e-07
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    55   7e-07
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    55   7e-07
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    55   7e-07
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    55   8e-07
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    55   8e-07
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    55   8e-07
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    54   8e-07
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    54   8e-07
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    54   9e-07
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    55   9e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    54   9e-07
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    54   9e-07
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    55   9e-07
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    55   1e-06
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    54   1e-06
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    55   1e-06
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    54   1e-06
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    54   1e-06
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    54   1e-06
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    54   1e-06
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    54   1e-06
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    54   1e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    55   1e-06
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    54   1e-06
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    54   1e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    54   1e-06
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    54   1e-06
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    54   1e-06
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    54   1e-06
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    54   1e-06
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    54   1e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    54   1e-06
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    54   1e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    54   1e-06
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    54   1e-06
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      54   1e-06
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    54   1e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    54   1e-06
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    54   1e-06
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    54   1e-06
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    53   2e-06
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    53   2e-06
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    53   2e-06
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    53   2e-06
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             53   2e-06
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    53   2e-06
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    54   2e-06
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    54   2e-06
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    54   2e-06
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    53   2e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    54   2e-06
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    54   2e-06
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    54   2e-06
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    54   2e-06
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    54   2e-06
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    54   2e-06
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    52   2e-06
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    54   2e-06
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    53   2e-06
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    53   2e-06
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    54   2e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    53   2e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    53   2e-06
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    53   2e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    53   2e-06
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    54   2e-06
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    53   2e-06
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    54   2e-06
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    53   3e-06
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    53   3e-06
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    53   3e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    53   3e-06
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    53   3e-06
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     53   3e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    53   3e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    53   3e-06
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    53   3e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    53   3e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    53   3e-06
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    53   3e-06
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    52   3e-06
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    53   3e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    53   3e-06
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    53   3e-06
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    52   3e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    52   3e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    53   3e-06
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    52   4e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    52   4e-06
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    52   4e-06
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    53   4e-06
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    52   4e-06
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    52   4e-06
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    52   4e-06
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    53   4e-06
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    53   4e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    52   5e-06
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    52   5e-06
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    52   5e-06
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    52   5e-06
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    52   5e-06
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    52   5e-06
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    52   5e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    52   5e-06
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    52   6e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    52   6e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    52   6e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    52   6e-06
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    51   6e-06
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    52   6e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    51   7e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    52   7e-06
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    52   7e-06
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    51   8e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    51   8e-06
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    51   8e-06
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    51   8e-06
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    51   9e-06
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    51   9e-06
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    52   9e-06
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    52   9e-06
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    51   9e-06
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    51   9e-06
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    50   1e-05
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    51   1e-05
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    51   1e-05
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    51   1e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    51   1e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    51   1e-05
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    51   1e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    50   1e-05
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    51   1e-05
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              51   1e-05
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    51   1e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    51   1e-05
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    50   1e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    51   1e-05
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    51   1e-05
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    51   1e-05
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    50   1e-05
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    50   1e-05
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    50   1e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    51   1e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    51   1e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    50   1e-05
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    51   1e-05
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    50   2e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    51   2e-05
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    50   2e-05
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    50   2e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    50   2e-05
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    50   2e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    50   2e-05
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    50   2e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    50   2e-05
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    50   2e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    50   2e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               50   2e-05
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    50   2e-05
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    50   2e-05
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    50   2e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    50   2e-05
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    50   2e-05
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    50   2e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    50   2e-05
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    50   2e-05
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    50   2e-05
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    50   2e-05
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    50   2e-05
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    50   2e-05
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    50   2e-05
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    50   2e-05
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    50   2e-05
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    50   2e-05
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    50   3e-05
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    50   3e-05
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    50   3e-05
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    50   3e-05
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    50   3e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    50   3e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    49   3e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    49   3e-05
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    50   3e-05
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    50   3e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    49   3e-05
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    49   4e-05
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    49   4e-05
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    50   4e-05
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    49   4e-05
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    50   4e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    50   4e-05
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    49   4e-05
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    49   4e-05
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    49   4e-05
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    49   4e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    49   4e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    49   4e-05
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    49   4e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    49   4e-05
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    49   5e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    49   5e-05
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    49   5e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    49   5e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    49   5e-05
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    49   5e-05
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    49   5e-05
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    48   5e-05
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               48   5e-05
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     49   6e-05
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    49   6e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    48   6e-05
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    49   6e-05
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    49   6e-05
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    49   6e-05
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    48   7e-05
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    48   7e-05
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    49   7e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    49   7e-05
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    48   8e-05
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    48   8e-05
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    48   9e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    48   9e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    48   9e-05
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    48   9e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    48   9e-05
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    48   9e-05
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               48   1e-04
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    48   1e-04
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    48   1e-04
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    48   1e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    48   1e-04
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    47   1e-04
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    48   1e-04
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    48   1e-04
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    48   1e-04
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    48   1e-04
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    48   1e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    47   1e-04
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    47   1e-04
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    48   1e-04
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    47   1e-04
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    47   1e-04
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    47   1e-04
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    47   1e-04
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    47   1e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    47   2e-04
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    47   2e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       47   2e-04
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    47   2e-04
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    47   2e-04
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    47   2e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    47   2e-04
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    47   2e-04
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    47   2e-04
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    46   2e-04
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    47   2e-04
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    47   2e-04
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    47   2e-04
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    47   2e-04
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    47   2e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    47   2e-04
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    47   2e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    47   2e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    46   3e-04
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    46   3e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    47   3e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    45   3e-04
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    46   3e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    46   3e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    46   3e-04
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    46   3e-04
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    46   3e-04
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    46   4e-04
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    46   4e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    45   4e-04
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    46   4e-04
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    46   4e-04
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    46   4e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    46   5e-04
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    46   5e-04
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    46   5e-04
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    46   5e-04
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    45   5e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    45   5e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    45   5e-04
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    45   5e-04
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    45   6e-04
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    45   6e-04
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    45   7e-04
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    45   7e-04
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    45   7e-04
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    45   7e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    45   8e-04
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    45   8e-04
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    45   8e-04
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    45   9e-04
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    45   0.001
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    45   0.001
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    44   0.001
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    45   0.001
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    45   0.001
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    45   0.001
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    44   0.001
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    44   0.001
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     44   0.001
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    44   0.001
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    44   0.001
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    44   0.001
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    44   0.001
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    44   0.002
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    44   0.002
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    44   0.002
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    43   0.002
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    44   0.002
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    44   0.003
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    43   0.003
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    43   0.003
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    43   0.003
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    43   0.004
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    43   0.004
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    42   0.004
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    42   0.004
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    42   0.005
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    42   0.005
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    43   0.005
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     42   0.005
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    42   0.005
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    42   0.005
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    42   0.006
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    42   0.006
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    42   0.006
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    42   0.006
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    42   0.006
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    42   0.007
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    42   0.007
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    42   0.007
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    42   0.007
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    41   0.008
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    42   0.008
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.009
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    42   0.009
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    42   0.010
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    41   0.010
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    41   0.010
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    42   0.011
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    42   0.011
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    41   0.011
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    41   0.011
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    41   0.012
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    41   0.012
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    41   0.012
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    41   0.012
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    41   0.013
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    40   0.014
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    41   0.014
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    41   0.016
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    41   0.016
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    41   0.017
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    40   0.019
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    41   0.019
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    40   0.020
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.022
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    40   0.023
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    40   0.025
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     40   0.025
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    40   0.027
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    40   0.027
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    40   0.029
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    40   0.033
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    39   0.039
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    39   0.042
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    39   0.042
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    40   0.043
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    39   0.046
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    39   0.050
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    39   0.053
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    39   0.053
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    39   0.058
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    39   0.061
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    39   0.062
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    39   0.062
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    39   0.064
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    39   0.069
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    39   0.069
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    39   0.071
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    39   0.071
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    39   0.072
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    39   0.074
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    39   0.075
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    39   0.077
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    39   0.080
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     38   0.083
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    38   0.084
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    38   0.084
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    38   0.092
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    38   0.097
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    38   0.097
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    38   0.11 
Suva_3.128 Chr3 (192094..193266) [1173 bp, 390 aa] {ON} YCR091W ...    38   0.12 
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    38   0.12 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    38   0.13 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    38   0.13 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    38   0.14 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    37   0.15 
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    37   0.15 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    38   0.16 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    37   0.16 
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    37   0.17 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    38   0.17 
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    37   0.17 
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    37   0.18 
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     37   0.18 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    37   0.18 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    37   0.19 
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    37   0.20 
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    37   0.23 
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    37   0.23 
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     37   0.23 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    37   0.25 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    37   0.25 
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    37   0.25 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    37   0.25 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    37   0.26 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    37   0.28 
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     37   0.28 
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    37   0.28 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    37   0.28 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    37   0.29 
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    37   0.30 
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    36   0.34 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    37   0.38 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    36   0.42 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    36   0.45 
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    36   0.47 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    36   0.49 
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    35   0.54 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    36   0.55 
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    36   0.58 
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    36   0.59 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    35   0.61 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    35   0.63 
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    35   0.66 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    35   0.85 
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    35   0.87 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    35   0.88 
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    35   0.90 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    35   1.0  
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    34   1.2  
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   1.2  
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    34   1.3  
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    34   1.3  
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    34   1.3  
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    34   1.4  
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    34   1.5  
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    34   1.7  
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    34   1.8  
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    34   1.8  
ZYRO0E02376g Chr5 complement(181177..182817) [1641 bp, 546 aa] {...    34   2.0  
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    34   2.1  
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    34   2.1  
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    33   2.7  
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    33   2.8  
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    33   2.9  
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    33   3.3  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    33   3.5  
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    33   3.7  
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    33   3.7  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    33   3.8  
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    33   4.0  
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    33   4.0  
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    33   4.0  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    33   4.2  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    33   4.7  
Kwal_56.22943 s56 complement(340249..341478) [1230 bp, 409 aa] {...    33   4.8  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    33   4.9  
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    33   4.9  
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    32   5.2  
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    32   5.6  
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    32   5.7  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    32   6.1  
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    32   6.2  
Smik_10.186 Chr10 (325900..327342) [1443 bp, 480 aa] {ON} YJL054...    32   6.7  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    32   7.8  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    32   7.9  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    32   8.7  
CAGL0L10092g Chr12 (1084445..1088695) [4251 bp, 1416 aa] {ON} no...    32   9.1  
Skud_4.72 Chr4 (122993..123892) [900 bp, 299 aa] {ON} YDL186W (R...    32   9.5  

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/487 (100%), Positives = 487/487 (100%)

Query: 378 KWTPTQTLSVPKRDRQPRRKTSDASVSSFSKILSSPITGAANNYVESQKQIQPPMQRSPV 437
           KWTPTQTLSVPKRDRQPRRKTSDASVSSFSKILSSPITGAANNYVESQKQIQPPMQRSPV
Sbjct: 378 KWTPTQTLSVPKRDRQPRRKTSDASVSSFSKILSSPITGAANNYVESQKQIQPPMQRSPV 437

Query: 438 SLGPLQLNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAPNPPAVKKVEII 497
           SLGPLQLNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAPNPPAVKKVEII
Sbjct: 438 SLGPLQLNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAPNPPAVKKVEII 497

Query: 498 EPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSS 557
           EPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSS
Sbjct: 498 EPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSS 557

Query: 558 NNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGD 617
           NNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGD
Sbjct: 558 NNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGD 617

Query: 618 HDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIID 677
           HDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIID
Sbjct: 618 HDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIID 677

Query: 678 FGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDI 737
           FGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDI
Sbjct: 678 FGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDI 737

Query: 738 WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACL 797
           WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACL
Sbjct: 738 WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACL 797

Query: 798 ERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWN 857
           ERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWN
Sbjct: 798 ERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWN 857

Query: 858 RLSDFRL 864
           RLSDFRL
Sbjct: 858 RLSDFRL 864

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/313 (87%), Positives = 275/313 (87%)

Query: 1   MQDSVTSHQYLHPXXXXXXXXXXXXXXXMRRSQGDIIDSDDENPLSPPKLSNFGSALFTD 60
           MQDSVTSHQYLHP               MRRSQGDIIDSDDENPLSPPKLSNFGSALFTD
Sbjct: 1   MQDSVTSHQYLHPVSNYNNGNIGSVNNIMRRSQGDIIDSDDENPLSPPKLSNFGSALFTD 60

Query: 61  KENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTGTLHMDDGSHSTLFTSVSKHQPSMT 120
           KENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTGTLHMDDGSHSTLFTSVSKHQPSMT
Sbjct: 61  KENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTGTLHMDDGSHSTLFTSVSKHQPSMT 120

Query: 121 TVNQEQRTPGEEGLGSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLT 180
           TVNQEQRTPGEEGLGSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLT
Sbjct: 121 TVNQEQRTPGEEGLGSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLT 180

Query: 181 ANLDFSSNMSHEDSRDLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGL 240
           ANLDFSSNMSHEDSRDLSHQDG          GLLQNQDYNVFLDTEPNCRPDSKENDGL
Sbjct: 181 ANLDFSSNMSHEDSRDLSHQDGNISSSSNNHSGLLQNQDYNVFLDTEPNCRPDSKENDGL 240

Query: 241 KSASSIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRKXXXXXX 300
           KSASSIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK      
Sbjct: 241 KSASSIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRKNIFTNN 300

Query: 301 XXXXXXXAKDYGG 313
                  AKDYGG
Sbjct: 301 SINSSSTAKDYGG 313

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/490 (80%), Positives = 431/490 (87%), Gaps = 6/490 (1%)

Query: 378 KWTPTQTL-SVPKRDRQPRRKTSDASVSSFSKILSSPITGAANNYVESQKQIQPPMQRSP 436
           K TP Q   S+ KRDRQPRRK SDASVSSFSK+LSSPI+  A NY +SQK    P+Q++ 
Sbjct: 333 KLTPPQAANSMIKRDRQPRRKHSDASVSSFSKLLSSPISAGAPNYADSQKHT--PVQKNS 390

Query: 437 VSLGPLQLNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAPNPPAVKKVEI 496
               PL +N NTKKREALN LDVN+    +I+ KK K DE + Y ++KAP   +VKKVEI
Sbjct: 391 TPYEPLLINQNTKKREALNSLDVNANRHPSIITKKQKVDELHDY-LKKAPAAASVKKVEI 449

Query: 497 IEPVKDTVITTIPLKPPSTE--NGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKV 554
           +EPV+D VITTIPLKPPS E     +Q PQRKRQ+I VNGSEYEKVELLGRGGSSKVYKV
Sbjct: 450 VEPVRDPVITTIPLKPPSAEVPANVHQLPQRKRQVITVNGSEYEKVELLGRGGSSKVYKV 509

Query: 555 RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME 614
           R+S+N+IYALKRVSFDEFDD S DGFKGEIELLK+LE+QTRVVKLIDHEMNHGVLYVVME
Sbjct: 510 RNSSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHEMNHGVLYVVME 569

Query: 615 CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILK 674
           CGDHDLSQVLAQR++MP DIEFVRYHAQEMLKCV+VVHD GIVHSDLKPANFVFVKGILK
Sbjct: 570 CGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILK 629

Query: 675 IIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKP 734
           IIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYT D  Q +QE+  NRWKVGKP
Sbjct: 630 IIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWKVGKP 689

Query: 735 SDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIK 794
           SDIWSCGCI+YQMIYG+PPYG FQGQNRLLAIMNPEVKIVYPEKT  GD VPRTALDTIK
Sbjct: 690 SDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRTALDTIK 749

Query: 795 ACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADD 854
           ACLERNPERRWTVD+LLRGPFIKP++VTHFFIRDLIKNAVKYGSDQRYVSKEKVE+LADD
Sbjct: 750 ACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAVKYGSDQRYVSKEKVENLADD 809

Query: 855 VWNRLSDFRL 864
           VW+RLSDFRL
Sbjct: 810 VWHRLSDFRL 819

 Score =  329 bits (843), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 180/296 (60%), Positives = 213/296 (71%), Gaps = 7/296 (2%)

Query: 1   MQDSVTSHQYLHPXXXXXXXXXXXXXXXMRRSQGDI-IDSDDENPLSPPKLSNFGSALFT 59
           M++  TS QYL P               +RR Q  +  DSDD++PL PPKLSNFGSAL T
Sbjct: 1   MRELGTSQQYLRPASSCSQSGSVNQL--LRRPQLHLNSDSDDDHPLGPPKLSNFGSALLT 58

Query: 60  DKENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTGTLHMDDGSHSTLFTSVSKHQPSM 119
           DKENETPTYLR+SG   Q            KP T TGT++ +D SHSTLF+S+SKHQPSM
Sbjct: 59  DKENETPTYLRRSGTSLQGG-NATATSGHTKPSTFTGTMNTED-SHSTLFSSMSKHQPSM 116

Query: 120 TTVNQEQRTPGEEGLGSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTL 179
           TTV+ E+  PG++GL S+R+Q+IQQSMKDE+ SRQ  RRSRRFITSRL+TLGPAKRN+T 
Sbjct: 117 TTVDAERTAPGDDGLSSHRYQVIQQSMKDEILSRQGTRRSRRFITSRLATLGPAKRNST- 175

Query: 180 TANLDFSSNMSHEDSRDLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDG 239
           T N +FSSN+SH++ RD+SHQ+G          G+L N  YNVFLDTE   R D KE+  
Sbjct: 176 TTNFEFSSNISHDEPRDVSHQEGNVSTSSNSNSGVLNNNGYNVFLDTEERARHDDKESHS 235

Query: 240 LKSASSI-DYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
               S + DY NISFGDLNPYQYLKKHNLPTSELPNISRIYFE+QK+ENRRAAVRK
Sbjct: 236 AARQSGLSDYGNISFGDLNPYQYLKKHNLPTSELPNISRIYFEMQKRENRRAAVRK 291

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/515 (63%), Positives = 400/515 (77%), Gaps = 57/515 (11%)

Query: 386 SVPKRDRQPRRKTSDASVSSFSKILSSPIT------------GAANNYVESQKQIQPPMQ 433
           S+PKR  QPRRK SD + ++ SK  SSP++            G +    E  + I+ P +
Sbjct: 344 SIPKR--QPRRKISDHATNNDSKAWSSPVSSSKGLKTAPSRDGTSPRASEMYENIERPER 401

Query: 434 RSPVSLGPLQLNPNTKKREALNKLDVNSTNQQAI----------------VHK---KHKS 474
            +  S+         ++REAL+ +++NS   Q                  +H+   +H  
Sbjct: 402 DTFGSI---------RRREALSNININSNYHQLQNKRTKYSTENLEEARGIHRPPFEHSV 452

Query: 475 DEQNFY-HIRKAPNPPAV---KKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQII 530
            E+ F  H  K  +PPAV   K VEI+EP+K T   +IPLKPP+T   SY    R++  I
Sbjct: 453 QEERFANHGFKHRSPPAVPERKHVEIVEPLKTT--ESIPLKPPATSGDSYN---RRKPTI 507

Query: 531 QVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKR 589
            VNG+EYEK+ELLGRGGSSKVYKV++ +NNK+YALKRVSFDEFDD+SI+GFKGEIELLK+
Sbjct: 508 YVNGTEYEKLELLGRGGSSKVYKVKNVANNKVYALKRVSFDEFDDSSIEGFKGEIELLKK 567

Query: 590 LEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQ 649
           LE + RVVKLIDHEM+HGVLY VMECGDHDLS  LA R+ M  D+EFVR+H+QEMLKCV+
Sbjct: 568 LETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLKCVK 627

Query: 650 VVHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 709
           VVHD+GIVHSDLKPANFVFVKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALV
Sbjct: 628 VVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 687

Query: 710 AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 769
           AMNYT  QGQ     +QNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP
Sbjct: 688 AMNYT--QGQP---AEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 742

Query: 770 EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDL 829
           EVKIVYPEKT++GD+VP+TA+DT+KACLERNPE+RW+VD++L GPF+KP++VTHFFIRDL
Sbjct: 743 EVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDL 802

Query: 830 IKNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864
           IKN+VKYG++QR +S EK+E+LA+DVW+RL+DFRL
Sbjct: 803 IKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837

 Score =  192 bits (488), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 159/283 (56%), Gaps = 33/283 (11%)

Query: 38  DSDDENPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTG- 96
           DSDDEN L PPKLSNFGSAL +DKEN  P    ++  V+    Y      A +P T    
Sbjct: 35  DSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAV 94

Query: 97  -----------------TLHMDDGSHSTLFTSVSKHQPSMTTVNQEQRTPGEEGL----- 134
                            T H ++ S ST+F +   +Q SMTT N E  TP E+G      
Sbjct: 95  REFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHNQQSMTTFNPE--TPSEQGKPEDMY 152

Query: 135 ---GSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSNMSH 191
                 R + +QQ+++DELS R   RR+RRF++SR + LGPAKR ++ T   + S     
Sbjct: 153 LEKSRSRVKSMQQTLRDELSLRSSKRRNRRFVSSRFNLLGPAKRASSNTGTPNHSE---L 209

Query: 192 EDSRDLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNI 251
            D  ++S Q+              QN+ YNVF +++ +  P  K++      +SI+YDNI
Sbjct: 210 ADESNVSQQEANFSHSSSAGATAHQNE-YNVFYESQNSSSPQ-KDSAAPTDHTSINYDNI 267

Query: 252 SFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
            FGDLNPYQYLKKHN+PT+ELPNISR+YFE QK ENR+ A+RK
Sbjct: 268 EFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRK 310

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/503 (63%), Positives = 387/503 (76%), Gaps = 43/503 (8%)

Query: 392 RQPRRKTSDASVSSFSKILSSPITGAANNYVESQK---QIQPPMQRSPVSLGPLQLNPNT 448
           RQPRRK S+++ S+  K  SSP +G  N  V S +   Q Q   + S   +       + 
Sbjct: 349 RQPRRKISESATSNDPKAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSF 408

Query: 449 KKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAP---------------------N 487
           ++REAL+ +++NS +     HKK K  + N     + P                     +
Sbjct: 409 RRREALSNININSYSAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRS 468

Query: 488 PPAV--KKVEIIEPVKDTVITTIPLKPPSTE---NGSYQTPQRKRQIIQVNGSEYEKVEL 542
           PP +  K VEI+EP++     +IPLKPP++    NG      RKR ++ VNG+EYEK+EL
Sbjct: 469 PPLIPGKHVEIVEPIRTK--ESIPLKPPASSDDING------RKRPVVYVNGTEYEKLEL 520

Query: 543 LGRGGSSKVYKVRSSNN-KIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLID 601
           LGRGG+SKVYKV+++NN K+YALKRVSFDEFDD+SIDGFKGEIELLK+LE Q RVVKLID
Sbjct: 521 LGRGGTSKVYKVKNANNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLID 580

Query: 602 HEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDL 661
           HEM+HGVLYVVMECGDHDLSQ LA R+ MP D+EFVRYHAQEMLKCV+VVHD GIVHSDL
Sbjct: 581 HEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDL 640

Query: 662 KPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTE 721
           KPANFVFVKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYT +Q    
Sbjct: 641 KPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAP-- 698

Query: 722 QEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTH 781
              +Q+RWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKT++
Sbjct: 699 ---EQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSN 755

Query: 782 GDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQR 841
           GD VP+TA+DT+KACLERNP +RWTV+++  G F+KPVSVTHFFIRDLI+N+V+YG++Q+
Sbjct: 756 GDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQK 815

Query: 842 YVSKEKVEDLADDVWNRLSDFRL 864
            +S  KVE+LA+DVW+RL +FRL
Sbjct: 816 EISSAKVEELAEDVWHRLEEFRL 838

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 161/292 (55%), Gaps = 50/292 (17%)

Query: 38  DSDDENPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTGT 97
           DSDDEN L PP LSNFGSAL +DKEN  P    +S   ++  P   ++   ++ P+ T T
Sbjct: 36  DSDDENMLGPPTLSNFGSALLSDKENVEP---HRSTASSRHHPLNQMSRTHSQLPSRTET 92

Query: 98  LHMD----------------------DGSHSTLFTSVSKHQPSMTTVNQEQRTPGEEGL- 134
           L M                       D S STLF +   +Q SMTT N + +   + GL 
Sbjct: 93  LAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDDQL-HQSGLD 151

Query: 135 ------GSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSN 188
                    + + +QQ+++D+LSSR   RR+RRF +SRLS LGPAKR ++ +   + S  
Sbjct: 152 RVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRFASSRLSLLGPAKRASSTSGTPNRSEL 211

Query: 189 MSHEDSRDLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSA----- 243
           +   +  ++S  +G              N+ +N+F + +         N  ++S+     
Sbjct: 212 I---EESNISQPEGNISNSSTRTASANLNE-HNIFYEPQ-------NSNQAIQSSHSPFI 260

Query: 244 -SSIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
            S+I+Y+++ FGDLNPYQYLKK+NLPT+ELPNISRIYFE QK +NR+AA+RK
Sbjct: 261 SSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRK 312

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/516 (63%), Positives = 378/516 (73%), Gaps = 60/516 (11%)

Query: 392 RQPRRKTSDAS------------VSSFSKILSSPITGAANNYVE--SQKQIQPPMQRSPV 437
           RQPRRK SD               +S S   +   T A + Y++   QK   PP   +P+
Sbjct: 363 RQPRRKASDTPSSAFSKSLSSPLTTSNSSTYAVAATAAKHPYIDHPQQKYDTPPATDTPI 422

Query: 438 SLGPLQLNPNTKKREALNKLDVNSTNQQAIVHKKHKSD------------------EQNF 479
                      KKREAL  +D NS        K H+S                   +Q F
Sbjct: 423 H----------KKREALANIDTNSQRHSHAQTKMHRSSAASLRNEVHQHRQQQLGSQQEF 472

Query: 480 YHIRKAPNPPAVKKVEI-----IEPVKDTVITTIPLKPPSTENGSYQTPQ------RKRQ 528
            H R    PP    +        E  K   + T+PLKPP+T  GS + P       R++ 
Sbjct: 473 LHRRAPAPPPPPPSLPTDSDRRGELTKAARVETVPLKPPAT--GSLKPPASLDSHARRKP 530

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
            IQVNG+EYEK+ELLGRGGSSKVYKVR+ NNK+YALKRV+FDEFD++S+DGFKGEIELLK
Sbjct: 531 TIQVNGTEYEKMELLGRGGSSKVYKVRTPNNKVYALKRVAFDEFDESSVDGFKGEIELLK 590

Query: 589 RLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
           +LE+Q RVV+L+D+EM HGVL+VVMECGDHDLS +LA RA++P DIEFVRYHAQEML+CV
Sbjct: 591 KLENQPRVVRLVDYEMAHGVLFVVMECGDHDLSSILAHRASLPLDIEFVRYHAQEMLRCV 650

Query: 649 QVVHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEAL 708
           +VVHD  IVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYR+TQIGTPNYMAPEAL
Sbjct: 651 KVVHDADIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEAL 710

Query: 709 VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 768
           VAMNY   QGQ     QQNRWKVGKPSDIWSCGCI+YQMIYGRPPYGGFQGQNRLLAIMN
Sbjct: 711 VAMNYA--QGQPH---QQNRWKVGKPSDIWSCGCILYQMIYGRPPYGGFQGQNRLLAIMN 765

Query: 769 PEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRD 828
           PEVKIVYPEKT  GD+VPRTALDT+KACLERNP++R TVD++L G FI+PVSVTHFF+RD
Sbjct: 766 PEVKIVYPEKTPSGDVVPRTALDTMKACLERNPDKRCTVDEVLNGAFIRPVSVTHFFVRD 825

Query: 829 LIKNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864
           LIKNAVKYGS+QR VS EKVE+LADDVWNRL++FRL
Sbjct: 826 LIKNAVKYGSEQREVSSEKVEELADDVWNRLAEFRL 861

 Score =  202 bits (514), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/290 (44%), Positives = 171/290 (58%), Gaps = 44/290 (15%)

Query: 38  DSDDENPLSPPKLSNFGSALFTDKENETPTY-----------LRKSGV-------VAQPA 79
           DSDDE+P+ PPKLSNFGSAL  DKEN TPT            LRKS           +P+
Sbjct: 35  DSDDEHPIGPPKLSNFGSALLFDKENHTPTGTGLQRDAAAADLRKSVAFQDISTGCQRPS 94

Query: 80  PYP---NINMNA--NKPPTLTGTL---HMDDGSHSTLFTSVSKHQPSMTTVNQEQRTPGE 131
             P   N+++N+  N   T   +    + +D S STLFT+ S+HQPSMTTV+     P  
Sbjct: 95  QVPLSRNLSLNSMSNTNNTFGASYPSYNSEDPSQSTLFTT-SRHQPSMTTVH-----PEP 148

Query: 132 EGL-------GSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLD 184
            GL        S+R + +Q S+K+ELSSR   RR+RRF++SRL  LGPAKR ++ TA L 
Sbjct: 149 HGLDSSKSEQSSHRLRALQHSLKEELSSRHAKRRNRRFVSSRLGLLGPAKRASS-TAGLA 207

Query: 185 FSSNMSHEDSRDLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSAS 244
           ++   S  D   +S Q+            +  N+ YNVFL++        +++      +
Sbjct: 208 YTD--SGNDDASISQQEANVSGSSSTSGFVGNNEGYNVFLESHTGA--GERQHHTSSKDT 263

Query: 245 SIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
            +DY ++ FGDLNPYQYLKKHNLPTSELPNIS+IYFE QK+ENRR A+RK
Sbjct: 264 GVDYRDVDFGDLNPYQYLKKHNLPTSELPNISKIYFERQKEENRRTALRK 313

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/501 (60%), Positives = 365/501 (72%), Gaps = 52/501 (10%)

Query: 394 PRRKTSDASVSS-----FSKILSSPITGAANNYVESQKQIQPP--------MQRSPVSLG 440
           PRRK SD SVSS     F    SSP+     N++  Q  +           + +      
Sbjct: 317 PRRKLSDTSVSSAAKTSFQSSFSSPLAYPKKNFLIDQPVVTSKPAADHGKNLTKQYAQRE 376

Query: 441 PLQLNPNTKKREALNKLDVNSTNQQAIVHKKH----KSDEQ-------------NFYHIR 483
              L  + KKREAL  +D+N  +Q+++   K     ++ EQ               Y  R
Sbjct: 377 QYTLESSFKKREALANIDINRNSQESLQQPKRFKPIRTQEQLSESHLPEPYVNKEEYLNR 436

Query: 484 KAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELL 543
           + P P A K+VEI+EP           KP           Q ++ +++VN  EYEKVELL
Sbjct: 437 EPPKPRATKRVEILEP-----------KPSQG--------QSRKNVVKVNDVEYEKVELL 477

Query: 544 GRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHE 603
           GRGGSSKVYKVR  +N +YALKRV FDEFDD+S+ GFKGEIELLK+LE+Q RVV+L+DHE
Sbjct: 478 GRGGSSKVYKVRDRSNNVYALKRVVFDEFDDSSVSGFKGEIELLKKLENQNRVVQLVDHE 537

Query: 604 MNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKP 663
           M HGVLY++MECGDHDLS++L  RA MP D+EFVRYHA+EML+CV+VVHD+GIVHSDLKP
Sbjct: 538 MEHGVLYLIMECGDHDLSRILNHRAGMPLDMEFVRYHAREMLRCVKVVHDSGIVHSDLKP 597

Query: 664 ANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQE 723
           ANFVFVKGILKIIDFGIANAVPDHTVNIYR+ QIGTPNYMAPEALVAMNYT D    E+ 
Sbjct: 598 ANFVFVKGILKIIDFGIANAVPDHTVNIYRENQIGTPNYMAPEALVAMNYTQDD---EKY 654

Query: 724 IQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGD 783
            QQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP+VKI++ +KT+  +
Sbjct: 655 QQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDE 714

Query: 784 LVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYV 843
            +PR+ALDT+KACL RNP++R TVD++L   F+KP+ VT FFIRDLIKNAV+YG+DQ+ V
Sbjct: 715 TIPRSALDTMKACLTRNPDKRLTVDEVLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEV 774

Query: 844 SKEKVEDLADDVWNRLSDFRL 864
           SKEKVE+LADDV +RLSDFRL
Sbjct: 775 SKEKVEELADDVLSRLSDFRL 795

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 144/283 (50%), Gaps = 51/283 (18%)

Query: 38  DSDDENPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQPAP----------------- 80
           DSDDE    PPKLS+FG AL  +KEN  P+ +R+     +P+P                 
Sbjct: 24  DSDDEKITGPPKLSDFGVALLMEKENMAPSMVRR----GEPSPNSFKRELKTRFGPTNTD 79

Query: 81  YPNINMNANKPPTLTGTLHMDDGSHSTLFT-SVSKHQPSMTTVNQEQ-RTPGEEGLGSY- 137
           Y + + N         + +  + S ST+F  S    QPSMTT++    + P  +   S+ 
Sbjct: 80  YFSGSNNQTSFSQTYVSANSGEPSQSTIFAQSRFNQQPSMTTMDTNGIKIPASDLETSFG 139

Query: 138 RFQMIQQSMKDELSSRQIMRRSRRFI-TSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRD 196
           R + +QQ+M++EL++R   RRSRRF+  +R+  LGPAKR          +S+ +  D  D
Sbjct: 140 RIKSMQQNMREELTTRHAQRRSRRFLHGTRIGVLGPAKR----------ASSTNGADMSD 189

Query: 197 LSHQDGXXXXXXXXXXGLLQNQDYNVF-----LDTEPNCRPDSKENDGLKSASSIDYDNI 251
           LS               ++Q  D         + +    +PD  + +  ++   +DY +I
Sbjct: 190 LS----------IGNVQMVQQTDNTPLEEHREVQSPAEIKPDLTKKE-TRTRDVLDYKSI 238

Query: 252 SFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
            FGD+NP QYLK HNL +SELP +S++YFE Q++E  + A++K
Sbjct: 239 DFGDMNPVQYLKLHNLSSSELPKLSKVYFERQREEIHQMALQK 281

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/389 (73%), Positives = 328/389 (84%), Gaps = 10/389 (2%)

Query: 476 EQNFYHIRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGS 535
           ++N +H R+AP PP VKKVEI+EP K T           + NG   T   +R    VN  
Sbjct: 469 QENEFHHREAPKPPVVKKVEIVEPEKRTDSKG------KSSNGEALT---RRNATTVNDV 519

Query: 536 EYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           EYEK+ELLGRGGSSKVYKV+ +NNK+YALKRV FDEFDD+S++GFKGEIELL +L+D+TR
Sbjct: 520 EYEKIELLGRGGSSKVYKVKDNNNKLYALKRVVFDEFDDSSVNGFKGEIELLNKLKDKTR 579

Query: 596 VVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTG 655
           VVKL D+EM HGVLY++MECGDHDLSQ+L QRA MP DIEFVRYHA+EMLKCV+VVHD G
Sbjct: 580 VVKLFDYEMEHGVLYLIMECGDHDLSQILNQRAGMPLDIEFVRYHAREMLKCVKVVHDAG 639

Query: 656 IVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTP 715
           IVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYR+TQIGTPNYMAPEALVAMNYT 
Sbjct: 640 IVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYT- 698

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
            Q   ++  QQNRWKVGKPSD+WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI++
Sbjct: 699 GQNDGDKYKQQNRWKVGKPSDVWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIIF 758

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVK 835
            EKT + + VPR+ LDT+KACL RNP++R TVD++L  PF+KPV VT FFIRDLIKNAV+
Sbjct: 759 SEKTANDEAVPRSILDTMKACLLRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKNAVR 818

Query: 836 YGSDQRYVSKEKVEDLADDVWNRLSDFRL 864
           YG+DQ+ VSKEKVE+LADDV  +L+D RL
Sbjct: 819 YGADQKEVSKEKVEELADDVLGKLADIRL 847

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 133/259 (51%), Gaps = 37/259 (14%)

Query: 38  DSDDENPLSPPKLSNFGSALFTDKE----NETPTYLRKSGVVAQPAPY---PNINMNANK 90
           DSDDE    PPKLSNFGSAL ++KE    NE   +        +P+     P  N   + 
Sbjct: 45  DSDDEKISIPPKLSNFGSALLSEKEKENINENDLFEMLPKDSVKPSSLNNEPYYNSVNHT 104

Query: 91  PPTLTGTLHMDDGSHSTLFTSVSKHQ-PSMTTVNQE--QRTPGEEGLGSY-RFQMIQQSM 146
           P     ++H  D S STLF     HQ PSMTT+N    Q   G +   S+ + + +QQSM
Sbjct: 105 PGNTYASIHSGDPSQSTLFAQYRSHQQPSMTTMNSTDVQDKDGNDFENSFQKIKSMQQSM 164

Query: 147 KDELSSRQIMRRSRRFI-TSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGXXX 205
           ++EL+SR   RRSRRF+ +SR   LGPAKR + +     F   +    S   +       
Sbjct: 165 REELTSRHAERRSRRFLNSSRKEFLGPAKRASAI-----FPEALDRRFSGTTNSN--GTN 217

Query: 206 XXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPYQYLKKH 265
                  GLLQ       L+ E +  P+ K    L  +S +D      GDLNP QYLKKH
Sbjct: 218 DNNNSTDGLLQ-------LNREES--PEEK----LSLSSQVD-----LGDLNPVQYLKKH 259

Query: 266 NLPTSELPNISRIYFEIQK 284
           +LPTSELP ISR+YFE QK
Sbjct: 260 DLPTSELPRISRLYFEKQK 278

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/501 (57%), Positives = 359/501 (71%), Gaps = 54/501 (10%)

Query: 392 RQPRRKTSDAS-VSSFSKILSSPITGAANNYVESQKQIQPPMQRSPVSLGPLQLNPNTKK 450
           RQPRRK +  +  +S    LSSP+      + E  +++                     K
Sbjct: 319 RQPRRKHNFGTDKTSLQDPLSSPLQKNQLVFQEVDREL-------------------ANK 359

Query: 451 REALNKLDVNS-TNQQAIVHKKHKSDE------QNFYHIRKAPNP---PAVKKVEIIEPV 500
           REAL  LDVN+ ++ Q     K+++D         F+  RKAP+P      KKVEI+EP 
Sbjct: 360 REALKPLDVNNPSSSQEAKRPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPP 419

Query: 501 KDTVITTIPLKPPSTE--------------NGSYQTPQRKRQ---IIQVNGSEYEKVELL 543
           K TV   IPLK    +              NGS+ T +R       I VNG+ YEKVELL
Sbjct: 420 KSTV-EVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELL 478

Query: 544 GRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHE 603
           G+GGS KVYKV+SS++K+YALKRVSFDEFD++SIDGFKGEIELLK+LE++ RVVKLID+ 
Sbjct: 479 GKGGSGKVYKVKSSDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYH 538

Query: 604 MNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKP 663
           M  GVL+++MECG+HDLSQVL QR+ +PFD EFVRYH QEM+KCV+VVHD  IVHSDLKP
Sbjct: 539 MGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKP 598

Query: 664 ANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQE 723
           ANFVFVKG+LKIIDFGIANAVPDHTVNIYRD QIGTPNYMAPE LVAMN+T + G     
Sbjct: 599 ANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDG----- 653

Query: 724 IQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGD 783
            +Q +WKVGKPSD+WSCGCI+YQM+YG+PPYG FQG NRL AIMNP+VKI YPEK + G 
Sbjct: 654 -EQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGT 712

Query: 784 LVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYV 843
           ++PRT +DTI++CLERNP  R T+D LL G  I PV+VT FFI DLIKNAV YG DQ++V
Sbjct: 713 VIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHV 772

Query: 844 SKEKVEDLADDVWNRLSDFRL 864
           + E+VE+L++DVWN+L++F+L
Sbjct: 773 NNERVEELSEDVWNKLAEFKL 793

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 134/238 (56%), Gaps = 42/238 (17%)

Query: 99  HMDDGSHSTLFTSVSKH-QPSMTTVN-----------------QEQRTPGEEGL------ 134
           H +D S ST+FT V+K  QPSMTT+N                  +     EE L      
Sbjct: 60  HTEDQSQSTVFTMVNKQFQPSMTTMNTVVKEDNDISNSNSNHDNKYNKLNEESLMKDDTH 119

Query: 135 --GSYRFQMIQQSMKDEL---SSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSNM 189
              S +F+++QQSMK+EL   +++   +R+RRFITSRLS+LGPAKRN + + N+D  S  
Sbjct: 120 SHTSQKFKVLQQSMKEELYNSTTKSSNKRNRRFITSRLSSLGPAKRNLSTSFNVDSPSES 179

Query: 190 SHE----------DSRDLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDG 239
             +          D+ ++S QD              +  D+N+FL+T       S + + 
Sbjct: 180 RVDNSQINSSIINDTSNISQQDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENK 239

Query: 240 LKSAS---SIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
             SA+   +I+Y+NI FGDLNPYQYLKK+NLP+ ELP IS++YFE QK+ENR+  +RK
Sbjct: 240 DPSANLQPNINYENIDFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRK 297

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/445 (62%), Positives = 326/445 (73%), Gaps = 56/445 (12%)

Query: 449 KKREALNKLDVNSTNQQA--------------------IVH--------KKHKSDEQNFY 480
           KKREAL+ ++VN+ +  +                    I H        ++ K ++ N  
Sbjct: 374 KKREALSSINVNTNHNHSYQELGDNKRNKISTKGIESEIEHVAARNSMLEQQKVEQLNSA 433

Query: 481 HIRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKV 540
           +I K       KKVEIIEP K      I  K                 ++ VNG EYEK+
Sbjct: 434 NIHK----HGKKKVEIIEP-KSASANRIASKS----------------VVSVNGVEYEKI 472

Query: 541 ELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           ELLGRGGSSKVYKV++  NNKI+ALKRV FDEFD++SID FKGEIELLK+LE++ RVV L
Sbjct: 473 ELLGRGGSSKVYKVKNVHNNKIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTL 532

Query: 600 IDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHS 659
           I H+M  GVL ++MECGDHDLSQ+L QR NMP DIEF+R+HA+EMLKCV+VVHD GIVHS
Sbjct: 533 IQHQMESGVLLLIMECGDHDLSQILNQRMNMPLDIEFIRFHAREMLKCVKVVHDAGIVHS 592

Query: 660 DLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQ 719
           DLKPANFVFVKGILKIIDFGIANAVPDHTVNIYR+TQIGTPNYMAPEALVAMN   D   
Sbjct: 593 DLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSD- 651

Query: 720 TEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKT 779
                QQN+WKVGKPSDIWSCGCI+YQM YGRPPYG FQGQNRLLAIMNP VKIV+ EKT
Sbjct: 652 -----QQNKWKVGKPSDIWSCGCILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKT 706

Query: 780 THGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSD 839
           ++ + +PR+AL+T+KACL RNP++RW VD +L G F  PV VT F IRDLIKNAV YG+D
Sbjct: 707 SNNERIPRSALETMKACLIRNPDKRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGAD 766

Query: 840 QRYVSKEKVEDLADDVWNRLSDFRL 864
           QRYV+ EK+ +LADDV NRL+DFRL
Sbjct: 767 QRYVTDEKITELADDVLNRLADFRL 791

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 133/268 (49%), Gaps = 38/268 (14%)

Query: 38  DSDDENPLSPPKLSNFGSALFT-DKENETPTYLRKSGVVAQPAPYPNINMNANKPPTL-- 94
           DSDDE     PKLSNFGSAL T +KEN T   L             N N+  N   +L  
Sbjct: 45  DSDDEQITGFPKLSNFGSALLTSEKENITKNKL------------TNTNLTLNDDKSLAY 92

Query: 95  ---TGTLHMDDGSHSTLFTSVSKHQPSMTTVNQEQRTPGEEGLGSY-RFQMIQQSMKDEL 150
              + TL ++   +    +S+SK   +    N  +      G  ++ RF+ + +S+KDEL
Sbjct: 93  DNYSSTLSINRAGNVNTTSSMSKANNNYEYNNSSENIS--TGNSTFQRFKGLHESIKDEL 150

Query: 151 SSRQIMRR-SRRFIT-SRLSTLGPAKRNTTLTANLDFSSNMSHE--DSRDLSHQDGXXXX 206
           +++ + RR +RRF   +++  LGPA R  T   N     N  HE  + +   +       
Sbjct: 151 NTKNLERRKTRRFFNRTKMGVLGPAMR--TNLENEKLGKNSKHETIEEKINKYDQPAHLI 208

Query: 207 XXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPYQYLKKHN 266
                        Y+           D+ ++    S ++I+YD I FG+LNP QY+KK+N
Sbjct: 209 SSSSTVASSSYTSYH-----------DTHQSINQTSQTTINYDLIDFGELNPVQYIKKNN 257

Query: 267 LPTSELPNISRIYFEIQKKENRRAAVRK 294
           LPT+ELP IS++YFE Q+ E+R+ A++K
Sbjct: 258 LPTTELPTISKLYFERQRAESRKIALKK 285

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/489 (56%), Positives = 351/489 (71%), Gaps = 58/489 (11%)

Query: 394 PRRKTSDASVSSFSKILSSPITGAANNYVESQKQIQPP----MQRSPVSLGPLQLNPNTK 449
           PRRK SD S     +IL S I     N  ES     PP    +QR   S   L       
Sbjct: 326 PRRKISDTSSKISKQILKSNI-----NLSESGSHGFPPDLQSIQRQHESAEKLS------ 374

Query: 450 KREALNKLDVNSTNQQAI--VHKKHKSDE-----QNF-------YHIRKAPNPPAVKKVE 495
            R  L  L+VN+ + + +  + + HK  +     Q+F        + ++AP     KKVE
Sbjct: 375 -RAPLIDLNVNNVSPKRMDKLRETHKFSDSRLNVQDFSKKTDVVVYEKQAPR----KKVE 429

Query: 496 IIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVR 555
           I+EP +                    +   KR  I VN +EYEK+ELLGRGGSS+VYKV+
Sbjct: 430 IVEPKRS------------------HSKLAKRNTITVNDTEYEKIELLGRGGSSRVYKVK 471

Query: 556 SSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMEC 615
           +S NK++ALKRVSFDEFDD+S+DGFKGEIELL++L +++RVVKL D++M+ GVL+++MEC
Sbjct: 472 NSQNKVFALKRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMEC 531

Query: 616 GDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKI 675
           GDHDLSQ+L+QR++MP D++FVRYHA+E+++C+++VHD GIVHSDLKPANFVFVKGILKI
Sbjct: 532 GDHDLSQILSQRSDMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGILKI 591

Query: 676 IDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPS 735
           IDFGIANA+PDHTVNIYR+ QIGTPNYMAPEALVAMNYT +          N+WKVGKPS
Sbjct: 592 IDFGIANAIPDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDGG------NKWKVGKPS 645

Query: 736 DIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKA 795
           DIWSCGCIIYQMIYGRPPY GFQGQNRLLAIMNP+VK+++ EKT + + +PR+ +D +K 
Sbjct: 646 DIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKG 705

Query: 796 CLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDV 855
           CL R+PE+RW+VD +L  PF  P+ VT FFI+DLIKNAV+YG DQR VS EK+E+LA+DV
Sbjct: 706 CLTRDPEKRWSVDQVLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDV 765

Query: 856 WNRLSDFRL 864
             RL+DF++
Sbjct: 766 LGRLTDFKM 774

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 150/283 (53%), Gaps = 49/283 (17%)

Query: 38  DSDDENPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQPAPYPNINMNANKPP--TLT 95
           DSDDE    PP LSNF SA  ++ +  T     +   V     + N NM  ++ P  ++ 
Sbjct: 29  DSDDEKVSGPPVLSNFASAFLSEGDKNTSNIREEETNV-----FNNSNMKLSQTPNNSIE 83

Query: 96  GTLHMDDGSHSTLFT-SVSKHQPSMTTVN-----------QEQRTPGEEGLGSYRFQMIQ 143
                D   HSTLF  +V   Q S+TT+N            ++ T  E+ L   + + +Q
Sbjct: 84  PNQADDLSLHSTLFANTVGNRQSSLTTMNSTNNFALNHDTNKEHTVFEDNL--QKIKSLQ 141

Query: 144 QSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTT--LTANLD--FSSNMSHEDSRDLSH 199
           Q+MK+EL+SR I RR++RF+TSR + LGPAKR +T  ++A+ +  +  N  H ++   S 
Sbjct: 142 QTMKEELTSRYIERRNKRFLTSRRNNLGPAKRASTSAISASTEDRYQENDKHSNNEKYST 201

Query: 200 QDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASS--------IDYDNI 251
           QD            +L  Q   +         P +++N   +S++         +DY +I
Sbjct: 202 QDDS---------NILAKQVGRL-------SSPLNRQNRAFQSSNGDDTNMKEPVDYSSI 245

Query: 252 SFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
            FG+L P++YLKKH+LPTSELP ISRIYFE QK ENR+  +RK
Sbjct: 246 EFGELTPFEYLKKHDLPTSELPYISRIYFEKQKLENRQTVLRK 288

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/375 (67%), Positives = 307/375 (81%), Gaps = 24/375 (6%)

Query: 491 VKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSK 550
           VKKVEI+EP            P S  N      +  + I+ VN  EYE++ELLGRGGSSK
Sbjct: 423 VKKVEIVEP------------PTSMTN-----RKSSKSIVSVNDIEYERIELLGRGGSSK 465

Query: 551 VYKVRSSNN-KIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVL 609
           VYKV+++NN ++YALKRV FDEFDDTS+D FKGEIELLK+LE++ RVVKLI ++M++GVL
Sbjct: 466 VYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVL 525

Query: 610 YVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFV 669
           Y+VMECGDHDLSQ+L QRANMP D++F+RY+++EMLKCV+VVHD GIVHSDLKPANFV V
Sbjct: 526 YLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLV 585

Query: 670 KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRW 729
           KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVA+N      +     ++NRW
Sbjct: 586 KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALN------EVSNVEKKNRW 639

Query: 730 KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTA 789
           +VGKPSDIWSCGCI+YQM YGRPPYG FQ QNRLLAIMNPEVKIV+ EKT+  + VP++A
Sbjct: 640 RVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSA 699

Query: 790 LDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVE 849
           LDT+KACL R+PE+RWT D++L   F+ PV VT + +RDLI+NAV YGSDQ  VS++K+ 
Sbjct: 700 LDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKIT 759

Query: 850 DLADDVWNRLSDFRL 864
           +LADDV NRL+DFRL
Sbjct: 760 ELADDVLNRLADFRL 774

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 135/297 (45%), Gaps = 73/297 (24%)

Query: 38  DSDDENPLSP-PKLSNFGSALFTDK-ENETPTYLRKSGVVAQPAPYPNINMNANKPPTLT 95
           DSD +  L+  PKLSNFGSAL ++K EN T   L  S +        +++ N N+  TLT
Sbjct: 26  DSDSDEKLTVLPKLSNFGSALISEKNENITRNSLTNSSI--------SMSSNYNQINTLT 77

Query: 96  GTLHMDDGSHSTLFTSVSKHQPSMTTVNQEQRTPGEEGLGSYRFQMIQQSMKDELSSRQI 155
               +  G+ ++ F             N +  +P  +G+ +    +I Q M  + + R+ 
Sbjct: 78  KNNEI--GTINSNFN------------NGQIASPKFKGIKN----LIDQEMTVKHNERRK 119

Query: 156 MRRSRRFITSRLSTLGPAKRNTTLTANLDFS---SNMS-----------HEDSRDLSHQD 201
            RR  R I   L++LG AKR      NLD++   S+M+           H+    ++  +
Sbjct: 120 GRRIFRKI--ELNSLGKAKR-----TNLDYTIAPSHMTEVNYDQYQENDHKTFESMNDME 172

Query: 202 GXXXXXXXXXXGLLQNQDY--NVFLDTEPN--CRPDSKENDGLKSASS------------ 245
                       +L N     N+      N    P S     L S+++            
Sbjct: 173 NDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTTPSSSFGSTLYSSTTNPFTDSNTYNHS 232

Query: 246 --------IDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
                   IDY+ I  GDLNP+Q LKK+NLP++EL  IS++YFE QK+ENR+  ++K
Sbjct: 233 NTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKK 289

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  535 bits (1377), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/435 (55%), Positives = 329/435 (75%), Gaps = 39/435 (8%)

Query: 447 NTKKREALNKLDVNSTN-----QQ-----------AIVHKKHKSDEQNFYHIRKAPNPPA 490
           +++KREAL  + +N+++     QQ           AI+H       Q+ ++ R AP PP 
Sbjct: 353 DSEKREALRNISINTSHADSGLQQDNKRLKRSLDDAIIHDNENMKNQDVFYHRPAPKPPV 412

Query: 491 VKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSK 550
            KKVEI+EP+K   ++                    R II VN S+YEK+ELLGRGGSS+
Sbjct: 413 TKKVEIVEPIKSASLSN------------------SRNIITVNDSQYEKIELLGRGGSSR 454

Query: 551 VYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLY 610
           VYKV+ + NK+YALKRVSFD FDD+S+DGFKGEIELL++L+DQ RV++L+D+EM  G+LY
Sbjct: 455 VYKVKGAGNKVYALKRVSFDAFDDSSVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLY 514

Query: 611 VVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK 670
           ++MECGDHDLSQ+L QR+NM  D  F+R++A+EML+C++VVHD GIVHSDLKPANFV VK
Sbjct: 515 LIMECGDHDLSQILNQRSNMSLDFNFIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK 574

Query: 671 GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQ-NRW 729
           GILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYT    QT +  Q+ N+W
Sbjct: 575 GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT----QTNENRQEGNKW 630

Query: 730 KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTA 789
           KVG+PSD+WSCGCI+YQMIYG+PPYG FQGQNRLLAIMNP+VKI +P+ T++ + +P++A
Sbjct: 631 KVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPDHTSNNERIPKSA 690

Query: 790 LDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVE 849
           ++ +KACL RNP++RWTVD +L   F++P  ++   + DLI+NAV+YGS++  +S + + 
Sbjct: 691 IELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPQISHDDLN 750

Query: 850 DLADDVWNRLSDFRL 864
           D+ + V  + +D+++
Sbjct: 751 DVVETVLRKFADYKI 765

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 153/268 (57%), Gaps = 37/268 (13%)

Query: 39  SDDENPLSPPKLSNFGSALF--TDKENETPTYLRKSGVVAQPA-PYPNINMNANKPPTLT 95
           SDDE   +PPKLSNFGSAL   T+K + +     K+  +A P     N + + + PP+  
Sbjct: 22  SDDEEFTTPPKLSNFGSALLSHTEKTSVSQELSNKNDKIANPVFEETNRSSSRSHPPSSM 81

Query: 96  GTLHMDDGSHST---LFTSVSK--HQPSMTTVNQE--QRTPGEEGLGSY-RFQMIQQSMK 147
           G L     S S+   LF    K  HQ SMTT+N    +   G     S+ + + ++Q+MK
Sbjct: 82  GNLTSGHTSTSSHSTLFGRYLKNNHQTSMTTMNTNDIEINVGNSLDKSFEKIRSLRQNMK 141

Query: 148 DELSSRQIMRRSRRF-ITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGXXXX 206
           ++++S+   RRS+RF I++R + LGPAKR +TLT       N+  +D  + S+Q      
Sbjct: 142 EDITSKYTERRSKRFLISNRTTKLGPAKRASTLT-------NVFDDDVPNSSNQ------ 188

Query: 207 XXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPYQYLKKHN 266
                  L+ N       +T  +   D  E +  ++  + DY++I+FGDLNP QY+KKHN
Sbjct: 189 -------LISN-----LRETTESPLDDPSETEFKETKKNSDYESINFGDLNPIQYIKKHN 236

Query: 267 LPTSELPNISRIYFEIQKKENRRAAVRK 294
           LPTS+LP IS+IYF+ Q++ENR+AA+RK
Sbjct: 237 LPTSDLPMISQIYFDKQREENRQAALRK 264

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score =  531 bits (1367), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/435 (55%), Positives = 328/435 (75%), Gaps = 39/435 (8%)

Query: 447 NTKKREALNKLDVNSTNQQAIVHKKHKSDEQN-----------------FYHIRKAPNPP 489
           +++KRE L  + +N+ +   ++ +++K  +++                 FYH R AP PP
Sbjct: 352 DSEKREVLRNISINANHADNLLQQENKRLKRSLDDAITNENINSKNLEVFYH-RPAPKPP 410

Query: 490 AVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSS 549
             KKVEI+EP K   ++                    R II VN S+YEK+ELLGRGGSS
Sbjct: 411 VTKKVEIVEPAKSASLSN------------------NRNIITVNDSQYEKIELLGRGGSS 452

Query: 550 KVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVL 609
           +VYKV+ S N++YALKRVSFD FDD+SIDGFKGEIELL++L+DQ RV++L+D+EM  G+L
Sbjct: 453 RVYKVKGSGNRVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLL 512

Query: 610 YVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFV 669
           Y++MECGDHDLSQ+L QR+ MP D  FVR++ +EML C++VVHD GIVHSDLKPANFV V
Sbjct: 513 YLIMECGDHDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV 572

Query: 670 KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRW 729
           KGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYT +   +E + + N+W
Sbjct: 573 KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQN---SENQHEGNKW 629

Query: 730 KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTA 789
           KVG+PSD+WSCGCIIYQMIYG+PPYG FQGQNRLLAIMNP+VKI +PE T++ + +P++A
Sbjct: 630 KVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSA 689

Query: 790 LDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVE 849
           ++ +KACL RNP++RWTVD +L   F++P  ++   + DLI+NAV+YGS++ ++S++ + 
Sbjct: 690 IELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLN 749

Query: 850 DLADDVWNRLSDFRL 864
           D+ D V  + +D+++
Sbjct: 750 DVVDTVLRKFADYKI 764

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 146/268 (54%), Gaps = 38/268 (14%)

Query: 39  SDDENPLSPPKLSNFGSALFTDKENETPTYLRKS---GVVAQPAPYPNINMNANKPPTLT 95
           SDDE   +PPKLSNFGSAL +  E  + + +  S     +A      + + + + PP   
Sbjct: 22  SDDEEFTTPPKLSNFGSALLSHTEKTSASEILSSHNNDKIANRLEEMDRSSSRSHPPPSM 81

Query: 96  GTLHMDDGSHST---LFTSV--SKHQPSMTTVNQE--QRTPGEEGLGSY-RFQMIQQSMK 147
           G L     S S+   LF     + HQ SMTT+N    +   G     S+ R + ++Q+MK
Sbjct: 82  GNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTSDIEINVGNSLDKSFERIRNLRQNMK 141

Query: 148 DELSSRQIMRRSRRF-ITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGXXXX 206
           ++++++   RRS+RF I++R + LGPAKR  TLT       N+  ED  +  +Q      
Sbjct: 142 EDITAKYAERRSKRFLISNRTTKLGPAKRAMTLT-------NIFDEDVPNSPNQP----- 189

Query: 207 XXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPYQYLKKHN 266
                     N    V L  E     DS + +  ++  + DYD+I FGDLNP QY+KKHN
Sbjct: 190 ---------INARETVELPLE-----DSHQTNFKETKRNTDYDSIDFGDLNPIQYIKKHN 235

Query: 267 LPTSELPNISRIYFEIQKKENRRAAVRK 294
           LPTS+LP IS+IYF+ Q++ENR+AA+RK
Sbjct: 236 LPTSDLPLISQIYFDKQREENRQAALRK 263

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score =  530 bits (1364), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 241/439 (54%), Positives = 324/439 (73%), Gaps = 41/439 (9%)

Query: 445 NPNTKKREALNKLDVNSTNQQAIVHKKHK-------------------SDEQNFYHIRKA 485
           +P+ +KRE L  + +N+ +   I+ +++K                    +++ FYH R A
Sbjct: 353 DPDCEKREVLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYH-RPA 411

Query: 486 PNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGR 545
           P PP  KKVEI+EP +                    T    R +I VN S+YEK+ELLGR
Sbjct: 412 PKPPVTKKVEIVEPARTA------------------TSSSNRNMITVNDSQYEKIELLGR 453

Query: 546 GGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMN 605
           GGSS+VYKV+ S NK+YALKRVSFD FDD+SIDGFKGEIELL++L+D+ RV++L+D+EM 
Sbjct: 454 GGSSRVYKVKGSGNKVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMG 513

Query: 606 HGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPAN 665
            G+LY++MECGDHDLSQ+L QR NM  D  FVR++A+EML+C++VVHD GIVHSDLKPAN
Sbjct: 514 DGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPAN 573

Query: 666 FVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQ 725
           FV VKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYT +    +    
Sbjct: 574 FVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNN---DNRHD 630

Query: 726 QNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLV 785
            N+WKVG+PSD+WSCGCI+YQMIYG+PPYG FQGQNRLLAIMNP+VKI +PE T++ + +
Sbjct: 631 GNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKI 690

Query: 786 PRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSK 845
           P++A++ +KACL RNP++RWTVD +L   F++P  ++   + DLI+NAV+YGS++  +S 
Sbjct: 691 PKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISH 750

Query: 846 EKVEDLADDVWNRLSDFRL 864
           + + D+ + V  + +D+++
Sbjct: 751 DNLNDVVETVLRKFADYKI 769

 Score =  122 bits (306), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 148/271 (54%), Gaps = 41/271 (15%)

Query: 39  SDDENPLSPPKLSNFGSALFTDKENETPT---YLRKSGVVAQPA-PYPNINMNANKPPTL 94
           SDDE   +PPKLSNFGSAL +  E  + +      K+  +A P     N + + + PP+ 
Sbjct: 22  SDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANPVFEEMNRSSSRSHPPSS 81

Query: 95  TGTL---HMDDGSHSTLFTSV--SKHQPSMTTVNQE--QRTPGEEGLGSY-RFQMIQQSM 146
            G L   H    S STLF     + HQ SMTT+N    + + G     S+ R + ++Q+M
Sbjct: 82  MGNLTSGHTSTSSQSTLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDKSFERIKNLRQNM 141

Query: 147 KDELSSRQIMRRSRRF-ITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGXXX 205
           K++++S+   RRS+RF I++R + LGPAKR TTL +  D       +D  D S       
Sbjct: 142 KEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD-------DDVADSS------- 187

Query: 206 XXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSID--YDNISFGDLNPYQYLK 263
                      NQ  ++  +T  +   DS +  G +     D  Y++I F DLNP QY+K
Sbjct: 188 -----------NQLISISRETTESPLADSYQ-AGFRGTRKKDMKYESIDFEDLNPIQYIK 235

Query: 264 KHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
           KHNL TS+LP IS+IYF+ Q++EN++AA+RK
Sbjct: 236 KHNLSTSDLPIISQIYFDRQREENKQAALRK 266

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  527 bits (1358), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/394 (60%), Positives = 311/394 (78%), Gaps = 22/394 (5%)

Query: 471 KHKSDEQNFYHIRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQII 530
           ++K  ++ FYH R AP PP  KKVEI+EP K            S+ N         R +I
Sbjct: 394 ENKKIQEVFYH-RPAPKPPVTKKVEIVEPAKSA----------SSSNN--------RSMI 434

Query: 531 QVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRL 590
            VN S+YEK+ELLGRGGSS+VYKV+ S NKIYALKRVSFD FDD+S+DGFKGEIELL++L
Sbjct: 435 TVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRVSFDAFDDSSVDGFKGEIELLEKL 494

Query: 591 EDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQV 650
           +DQ RV++L+D+EM  G+LY++MECGDHDLSQ+L QR+NMP D  FVR++ +EML C++V
Sbjct: 495 KDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554

Query: 651 VHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVA 710
           VHD GIVHSDLKPANFV VKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVA
Sbjct: 555 VHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 614

Query: 711 MNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 770
           MNYT     ++ + + N+WKVG+PSD+WSCGCIIYQMIYG+PPYG FQGQNRLLAIMNP+
Sbjct: 615 MNYTQ---SSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPD 671

Query: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLI 830
           VKI +PE T++ + +P++A++ +KACL RNP++RWTVD +L   F++P  ++   + DLI
Sbjct: 672 VKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLI 731

Query: 831 KNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864
           KNAV+YGS++  +S + + D+ + V  + SD+++
Sbjct: 732 KNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 148/269 (55%), Gaps = 39/269 (14%)

Query: 39  SDDENPLSPPKLSNFGSALFTDKEN----ETPTYLRKSGVVAQPAPYPNINMNANKPPTL 94
           SDDE   +PPKLSNFGSAL +  E     ET +  + + +        + + + + PP+ 
Sbjct: 22  SDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDRSSSRSHPPSS 81

Query: 95  TGTL---HMDDGSHSTLFTSV--SKHQPSMTTVNQE--QRTPGEEGLGSY-RFQMIQQSM 146
            G L   H    SHSTLF     + HQ SMTT+N    +   G     S+ R + ++Q+M
Sbjct: 82  MGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTNDIEINVGNSLDKSFERIRNLRQNM 141

Query: 147 KDELSSRQIMRRSRRF-ITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGXXX 205
           K++++S+   RRS+RF I++R + LGPAKR TTLT   D           ++ +      
Sbjct: 142 KEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD----------EEVPNSSNLPI 191

Query: 206 XXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPYQYLKKH 265
                   LL++ + + F +++ N                +DY++I FGDLNP QY+KKH
Sbjct: 192 NPRETIETLLEDSNKSGFRESKKN----------------MDYESIEFGDLNPIQYIKKH 235

Query: 266 NLPTSELPNISRIYFEIQKKENRRAAVRK 294
           NLPTS+LP IS+IYF+ Q++ENR+AA+RK
Sbjct: 236 NLPTSDLPLISQIYFDKQREENRQAALRK 264

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  513 bits (1322), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 243/431 (56%), Positives = 318/431 (73%), Gaps = 28/431 (6%)

Query: 440 GPLQLNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAPNPPAVK------K 493
           GP+Q +     R+ L  LD+N+ +     HK     +    +  K P   + K      K
Sbjct: 339 GPIQYS----SRDVLTSLDINNQSPSKADHKFGYDIQIGKPYTVKTPLNESYKRLSPKKK 394

Query: 494 VEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK 553
           VEIIEP          +     + G       K+  I VNG +YEK+ELLGRGGSSKVYK
Sbjct: 395 VEIIEPF---------IYAQKKKTG-------KKLSITVNGIDYEKIELLGRGGSSKVYK 438

Query: 554 VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVM 613
           V++  NKI+ALKRVSFDEFDD+SI GFKGEIELL++L  + RVV+L D++M+ GVLY++M
Sbjct: 439 VKNDQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQMSSGVLYLIM 498

Query: 614 ECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGIL 673
           ECGD+DLSQVL QR   P D++F+RYH +E+LKCV+ VHD GIVHSDLKPANFVF+KG+L
Sbjct: 499 ECGDNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVHDAGIVHSDLKPANFVFIKGLL 558

Query: 674 KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGK 733
           K+IDFGIAN +PDHTVN+YR++QIGTPNYMAPE L+A N++ +Q    +E+  ++WKVGK
Sbjct: 559 KLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQSDLNKEM--SKWKVGK 616

Query: 734 PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTI 793
           PSD+WSCGCIIYQMIYGRPPY GFQGQNRLLAIMNPEVK+++ E+T   + +P + +D +
Sbjct: 617 PSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTAKDEKIPTSLIDLM 676

Query: 794 KACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLAD 853
           KACL R+P +RW++D LL  PF  P+ VT FFI+DLIKNAVKYG+DQ+ V+  K+E+L++
Sbjct: 677 KACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTDAKIEELSN 736

Query: 854 DVWNRLSDFRL 864
           DV  RL+DF++
Sbjct: 737 DVLERLNDFKM 747

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 144/279 (51%), Gaps = 46/279 (16%)

Query: 38  DSDDENPLS-PPKLSNFGSALFTDKENETPTYLRKS------GVVAQPAPYPNINMNANK 90
           DSDDE PLS PPKLS F SALF+ K++       ++      G + + A   N++ N + 
Sbjct: 25  DSDDE-PLSDPPKLSTFASALFSVKDSSNQLDFSENYNSTTNGPINKYAGLKNVSANESH 83

Query: 91  PPTLTGTLHMDDGSHSTLFTSVS-KHQPSMTTVNQEQRTPGEEGLG----SY-------- 137
             T   T   D  S ST+F   +   QPS+TT N     PG++       SY        
Sbjct: 84  NITNNATQFDDHSSISTIFAHTNLPRQPSITTTNNN--VPGDDDNARLAESYNELEMESN 141

Query: 138 --RFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSR 195
             R +++QQSMK+EL+SR + RR+RRF+TSRL+ LGPAKR ++  +  D   ++ +    
Sbjct: 142 LQRIKVLQQSMKEELTSRYVERRNRRFLTSRLTRLGPAKRASSAVSEKDILRSIDNNTQH 201

Query: 196 DLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGD 255
            L                       +V    E +  P+S       +  +IDY +I FG 
Sbjct: 202 LLPE---------------YHTPPLSVLDQKEISTVPESA------ARGNIDYSSIDFGR 240

Query: 256 LNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
           L P++YLKK  LPTSELP+IS+ YF+ QK+E+ +  ++K
Sbjct: 241 LKPFEYLKKKKLPTSELPSISKAYFQKQKEESLQNTLKK 279

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  513 bits (1320), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 244/424 (57%), Positives = 317/424 (74%), Gaps = 25/424 (5%)

Query: 443 QLNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAPNPPAVKKVEIIEPVKD 502
           ++ PN K+RE L  L   STN++    K+ K+ E+N             K+ EII   K+
Sbjct: 347 EIRPN-KRREPLVDL---STNRKEPELKRFKTFEEN------------KKRDEIINE-KE 389

Query: 503 TVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIY 562
            V+  +P      E    +   R+R +I VN +EYEK+ELLGRGGSSKVYKV+  +NK++
Sbjct: 390 NVVQDVPKSMKRVEIMEPKMSHRQRNVINVNETEYEKIELLGRGGSSKVYKVKGPSNKVF 449

Query: 563 ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQ 622
           ALKRV FDEFDD+SI+GFKGEI+LL +L ++ RVVKL D+EMN G+LY++MECGD DLSQ
Sbjct: 450 ALKRVVFDEFDDSSINGFKGEIKLLNKLRNENRVVKLFDYEMNQGLLYLIMECGDVDLSQ 509

Query: 623 VLAQRANM--PFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIIDFGI 680
           +L Q+ N+  PFDIEF+RY+ +EM+KCV+VVHD GIVHSDLKPANFV VKG+LKIIDFGI
Sbjct: 510 ILNQKINLNLPFDIEFIRYYTREMIKCVKVVHDNGIVHSDLKPANFVLVKGVLKIIDFGI 569

Query: 681 ANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSC 740
           A+AVPDHTVNIYR+TQ GTPNYMAPE L+AMNYT +  +        +WKVGKPSD+WSC
Sbjct: 570 ADAVPDHTVNIYRETQTGTPNYMAPETLIAMNYTNNGAKDL------KWKVGKPSDVWSC 623

Query: 741 GCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERN 800
           GCIIYQMIYG+ PY GFQGQ+R+ AIMN +VKIVYPEKT   +L+P+T ++ +K CL R+
Sbjct: 624 GCIIYQMIYGKAPYAGFQGQHRIFAIMNSDVKIVYPEKTNEEELIPKTMVELMKNCLRRD 683

Query: 801 PERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWNRLS 860
           P +RWTVDD+L   F+ P+  +  FIRDLIKNA+ +GS Q+ VS++K+ DL +DV  RL 
Sbjct: 684 PGKRWTVDDILSSTFLNPIVTSQSFIRDLIKNAITFGSQQKIVSEDKINDLTNDVLTRLQ 743

Query: 861 DFRL 864
           +F++
Sbjct: 744 EFKM 747

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 142/269 (52%), Gaps = 53/269 (19%)

Query: 42  ENPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQ-PAPYPNINMNA-NKPPTLT---- 95
           EN + PPKLSNFGSAL T+ +N        SG  ++    + ++N N+ + P +L+    
Sbjct: 30  ENIIGPPKLSNFGSALLTENDN--------SGTTSRFHTQFRSLNGNSVHSPISLSRNNS 81

Query: 96  -GTLHMDDGS-HSTLFTSVSKHQP-SMTTVNQEQ------RTPGEEGLGSY-RFQMIQQS 145
            G+  + + S  +++F +   ++P SMTT+              ++   SY +   IQQS
Sbjct: 82  YGSYGIAEQSPQTSIFATTINNRPISMTTIQNGSADSNVTNNVNDKYESSYNKINKIQQS 141

Query: 146 MKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGXXX 205
           +KDEL+SR   R  R   T+R++ LGPAKR +T+  ++   +N                 
Sbjct: 142 IKDELTSRHTGRIKRFLNTNRMNKLGPAKRASTMEVDIPLPANT---------------- 185

Query: 206 XXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPYQYLKKH 265
                      N  YN   D       +  E + +K   + DY NI+FGDLNP+Q+L+K+
Sbjct: 186 -----------NDSYNSSSDVFSGQAIE--EANDIKEVQNYDYSNINFGDLNPFQFLRKY 232

Query: 266 NLPTSELPNISRIYFEIQKKENRRAAVRK 294
           NLPT+ELPNIS+IYFE QK+ENR + ++K
Sbjct: 233 NLPTTELPNISKIYFERQKEENRLSILKK 261

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  506 bits (1304), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/419 (58%), Positives = 308/419 (73%), Gaps = 24/419 (5%)

Query: 450 KREALNKLDVNS-TNQQAIVHKKHKS--DEQNFYHIRKAPNPPAVKKVEIIEPVKDTVIT 506
           +REAL  +DVNS     AI +K+ K    +  F  I        +K+VEI+EP   T   
Sbjct: 375 QREALQNIDVNSNVRDGAIDYKRQKIALKDSEFDGILDKKKYRGIKRVEIVEPPTST--- 431

Query: 507 TIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKR 566
               +PPS +N           ++ VNG+EYE+VELLGRGGSS VYKVR   N++YALK+
Sbjct: 432 ----RPPSRKN-----------VVSVNGTEYERVELLGRGGSSNVYKVRGLKNRVYALKK 476

Query: 567 VSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQ 626
           VSFDEFD++S++GFKGEI LLK+L++Q RVV+L D EM  GVLY++MECGD+DLSQVL Q
Sbjct: 477 VSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQVLHQ 536

Query: 627 RANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVPD 686
           RAN PFD+EF+RYHA+EM+ CV+VVHD GIVHSDLKPANFVFVKGILKIIDFGIANAVPD
Sbjct: 537 RANQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPD 596

Query: 687 HTVNIYRDTQIGTPNYMAPEALVAMNYTPDQ-GQTEQEIQQNRWKVGKPSDIWSCGCIIY 745
           HTVNIYRD QIGTPNYMAPEALVA NYT D  G+ +Q  + N+WK+GKP+DIWSCGCIIY
Sbjct: 597 HTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQ--KTNKWKIGKPADIWSCGCIIY 654

Query: 746 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRW 805
           QMIYG+PPY  +QGQ RLL+IM+P VKI Y E      ++P  AL+ ++ CL RNPE RW
Sbjct: 655 QMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQYCLMRNPEERW 714

Query: 806 TVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864
           +   +L  PF+ P+ V+  FI++LI  AV YG+ +  VS  ++E L D V  RL+DFR+
Sbjct: 715 SALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTDSVLARLADFRM 773

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 90/274 (32%), Positives = 136/274 (49%), Gaps = 28/274 (10%)

Query: 38  DSDDENPLSPPKLSNFGSALFTDK-ENETPTYLRKSGVVAQPAPYPN----INMNANKPP 92
           DSDD    +PPKLSNFGS L +D  EN  P    K  +  +   + +    +N + N+  
Sbjct: 19  DSDDGEIGNPPKLSNFGSELISDAIENINPNRSDKKLISEETRIHESHSQQLNTDINQST 78

Query: 93  TLTGT----LHMDDGSHSTLFT-SVSKHQPSMTTVNQEQRTPGEEGLGSYRFQMIQQSMK 147
            +T +    L+ +D S ST+F  S +  QPS TT +   +   +      + +  Q ++K
Sbjct: 79  RVTHSASSPLYFEDTSPSTMFVQSQASAQPSATTYDISSQDYSDSSKSFIKLKSKQDTLK 138

Query: 148 DELSSRQIMRRSRRFI--TSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGXXX 205
            EL++R   RR+RRF+  T+R + LGPA RN T  A       ++  D+  +   D    
Sbjct: 139 QELTTRYSERRTRRFLHATNRTTKLGPALRNLTSPA-------LAINDNNSI---DNKMN 188

Query: 206 XXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSI------DYDNISFGDLNPY 259
                      N  Y  F  T+ +     +E++  K    I      DY +I+  + NP 
Sbjct: 189 ETSKVNSSFDTNNAYVDFHQTKQDIYTSGEEHNNTKDNGKIGATQQNDYSDINIHECNPI 248

Query: 260 QYLKKHNLPTSELPNISRIYFEIQKKENRRAAVR 293
           QY+K HNLPTSEL  IS+ YFE QK+ENR+ A++
Sbjct: 249 QYMKMHNLPTSELSKISKAYFEKQKEENRKKALK 282

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  503 bits (1295), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 296/380 (77%), Gaps = 21/380 (5%)

Query: 486 PNPPAV-KKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLG 544
           P P  V KKVEIIEP                +  +YQ P     II VN  EYEKV LLG
Sbjct: 621 PQPQQVRKKVEIIEP--------------EAKIHNYQKP-----IIIVNNIEYEKVALLG 661

Query: 545 RGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEM 604
           RGGSSKVYKV+   N  YALKRV FDEFDD+SI+GFKGEIELLK+LE + RVV+L D++M
Sbjct: 662 RGGSSKVYKVKGPKNSYYALKRVLFDEFDDSSIEGFKGEIELLKKLEHEERVVRLFDYKM 721

Query: 605 NHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPA 664
            +G L+++MECGD DLS++L QR+  P D+EF+RY+++EMLKCVQVVH+  IVHSDLKPA
Sbjct: 722 ENGTLHLIMECGDLDLSRILHQRSKQPLDLEFIRYYSREMLKCVQVVHNNDIVHSDLKPA 781

Query: 665 NFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEI 724
           NFV V  +LKIIDFGIANAVPDHTVNIYR+ QIGTPNYMAPEALV+MN T ++ +  Q+ 
Sbjct: 782 NFVLVGSVLKIIDFGIANAVPDHTVNIYRECQIGTPNYMAPEALVSMNLTSNENENAQK- 840

Query: 725 QQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDL 784
             NRWKVGKPSD+WSCGCI+YQM YG+PPYG +QGQNRLLAIMNPEV+I YPE T + + 
Sbjct: 841 PVNRWKVGKPSDVWSCGCILYQMFYGKPPYGHYQGQNRLLAIMNPEVEIKYPEFTPNNEP 900

Query: 785 VPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVS 844
           +PR+A+DT+KACL R+P +R+T+++LL  PF  P+ VT FF++DLIKN+V+YG D++ +S
Sbjct: 901 IPRSAIDTMKACLYRDPSKRFTIEELLNNPFFSPIMVTPFFLQDLIKNSVRYGIDRKNIS 960

Query: 845 KEKVEDLADDVWNRLSDFRL 864
            E++E ++DDV NRL +F L
Sbjct: 961 NEELEKMSDDVLNRLREFIL 980

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 36/48 (75%)

Query: 247 DYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
           DY +I F  LNP QY +KH+LP SELP +++ Y + Q++ENR+A +++
Sbjct: 319 DYSSIEFNGLNPMQYWRKHDLPPSELPKLNKAYLQKQREENRKAVLKQ 366

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 22/27 (81%), Gaps = 2/27 (7%)

Query: 38 DSDDENPL--SPPKLSNFGSALFTDKE 62
          DSDDE+ +   PPKLSNFGSAL +++E
Sbjct: 31 DSDDEDNIERGPPKLSNFGSALLSNQE 57

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  444 bits (1142), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 219/421 (52%), Positives = 286/421 (67%), Gaps = 38/421 (9%)

Query: 444 LNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFYHIRKAPNPPAVKKVEIIEPVKDT 503
           +N   +KRE L  L+VN    +       K  + N   + K   P  +K+VEI EP    
Sbjct: 383 VNKLIRKREVLANLNVNQKEPEL------KKPKNNLEQLDK---PAIIKRVEIQEP---- 429

Query: 504 VITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYA 563
                              P +K   I +N  EYEK+ELLG GGSSKVYKVR S+ K++A
Sbjct: 430 ------------------KPSKKNTSIVINNEEYEKIELLGSGGSSKVYKVRDSSKKVFA 471

Query: 564 LKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQV 623
           LKRV+ D F+++S++ FKGEI LL++L++Q RVV+L ++ +   VLY++MECGD+DLS +
Sbjct: 472 LKRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSVLYLIMECGDYDLSVM 531

Query: 624 LAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIIDFGIANA 683
           L +R N P D EFVRY+A+E+  CV+VVHD GIVHSDLKPANF+FVKG LKIIDFGIANA
Sbjct: 532 LRERLNKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIFVKGTLKIIDFGIANA 591

Query: 684 VPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCI 743
           VP+HTVNIYR+TQIGTPNYMAPEALVAMNYT  +         +RWKVGKPSD+WS GCI
Sbjct: 592 VPEHTVNIYRETQIGTPNYMAPEALVAMNYTNGESNV------SRWKVGKPSDVWSLGCI 645

Query: 744 IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPER 803
           IYQM+YG+PPY  FQG +R+ AI+ P VKI YP     G  VP + ++ IK CL R+P +
Sbjct: 646 IYQMVYGKPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELIKVCLNRDPNK 704

Query: 804 RWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFR 863
           R  VD +L   F+ P+ V+  F+RDL+KNAV+YG  Q  VS   ++ LA+DV  +LS++R
Sbjct: 705 RVDVDGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALANDVIEKLSEYR 764

Query: 864 L 864
           +
Sbjct: 765 I 765

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 133/297 (44%), Gaps = 85/297 (28%)

Query: 43  NPLSPPKLSNFGSALFTDKENETPTYLRKSGVVAQPAP---------------------- 80
           N + PPKLS+FGS L  +  N + T+ +  G+    +P                      
Sbjct: 44  NIIGPPKLSDFGSNLLNESANHSGTFTKFRGLGMAHSPRVTQRIDGPGGNNIVSHRNGSS 103

Query: 81  ------YPNINMNANKPPTLTGT---LHMDDGSHSTLFTSV----------SKHQPSMT- 120
                 + +   N  +P ++T      H D    ST+   V          S+   S++ 
Sbjct: 104 PSSSSIFGSTVYNPARPSSMTTVNNLKHEDSSRISTVKNDVLNRTLERRRLSRTASSLSN 163

Query: 121 --TVNQEQRTPGEEGLGSYRFQMIQQSMKDELSSRQIMRRSRRFIT-SRLSTLGPAKRNT 177
             TVN       E  +     + I+Q+++DE +S+ + RR++RF+   R + LGPAKR T
Sbjct: 164 PPTVNSIDLKDHEVNI-----EKIKQTIRDETTSKLLERRAKRFLNLERRNRLGPAKR-T 217

Query: 178 TLTANLDFSSNMSHEDSRDLSHQDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKEN 237
           ++T++L     ++ E    L  +D           G ++ QD  +               
Sbjct: 218 SMTSSL-----ITSEMDDLLIQRDAK---------GEVEQQDREM--------------- 248

Query: 238 DGLKSASSIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRK 294
                   +DY NI FGDLNP+QY+ K+N+P  ELP IS++Y E +K+ENRR A+RK
Sbjct: 249 -----TPQVDYSNIVFGDLNPFQYVNKYNIPMEELPQISKVYIEKRKEENRRVALRK 300

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score =  364 bits (934), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 179/404 (44%), Positives = 262/404 (64%), Gaps = 17/404 (4%)

Query: 461 STNQQAIVHKKHKSDEQNFYHIRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSY 520
           + N+QA +  K    E+  Y IR   +    KK + I  ++  V  ++P           
Sbjct: 255 TANEQAKLISKKLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQSVP----------S 304

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGF 580
           Q     +Q  ++   E   VELLG+GGSSKVYKV+    K YALK++  +E D+      
Sbjct: 305 QANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENLKTDL 364

Query: 581 KGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYH 640
           + EIELLKRL  + RVVKLI+++++  ++ V+MECG+ DLS VL +R N PFDI FVR  
Sbjct: 365 EREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLM 424

Query: 641 AQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTP 700
           ++EM++C++ VHD+ IVHSDLKPANF+FVKG LK+IDFGIAN + D+T+N+YR+TQ+GTP
Sbjct: 425 SKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTP 484

Query: 701 NYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQ 760
           NYMAPE L++ NY+ +            WK+GKPSDIWS GCI+YQM YG PPY  F G 
Sbjct: 485 NYMAPETLISQNYSNNNNNLL-------WKIGKPSDIWSYGCILYQMTYGHPPYSSFLGH 537

Query: 761 NRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVS 820
           +RLLAIMNP ++I YP ++  G  VP++ +  IK CL R+P+ R T D++    F  P+ 
Sbjct: 538 DRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMI 597

Query: 821 VTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864
           ++  F+  LI NA+ YG + + +++++++ L+++V ++LS   L
Sbjct: 598 ISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 91/209 (43%), Gaps = 45/209 (21%)

Query: 86  MNANKPP-TLTGTLHMDDGSHSTLFTSVSKHQ-PSMTTV---NQEQRTPGEEGLGSYRFQ 140
           M +N P  ++   L   D + S++FT  +  Q PS TT+    +E     +    +   +
Sbjct: 1   MKSNSPMLSIDKILESADSTCSSIFTQSNNCQIPSDTTIPIYTKECDIYAKHERYNDIME 60

Query: 141 MIQQSMKDELSSRQIMRRSRRFIT-SRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSH 199
           M Q+ MKD+++ +   +R  R+ T S+   LGPA+R+T         S++S     DL +
Sbjct: 61  M-QREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLS-----DLEN 114

Query: 200 QDGXXXXXXXXXXGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPY 259
            +                         EP       E  GLK            G+LNP+
Sbjct: 115 IN-------------------------EPKRESILGEETGLKETE--------LGELNPF 141

Query: 260 QYLKKHNLPTSELPNISRIYFEIQKKENR 288
           QYLKK+NLPT EL  ++++Y   +  E R
Sbjct: 142 QYLKKNNLPTKELSRLTKLYCNRKLDETR 170

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score =  108 bits (270), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 143/316 (45%), Gaps = 57/316 (18%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    IY ALK V  D  + T     + EI L+K L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGIYVALKEVKLDSEEGTPSTAVR-EISLMKELKHE 63

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R   N P  F++  V+Y   ++L+ V 
Sbjct: 64  N-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVA 122

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          DIWSCGCI+ +MI GRP + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLI 221

Query: 767 ---MNPEVKIVYPEKTTHGDLVPR-----------------------TALDTIKACLERN 800
              M    +  +P  +T     PR                       T +D +   L+ N
Sbjct: 222 FETMGTPTERTWPGVSTLPKYNPRLPQHLPKDLGALLQSQTREKMELTLIDLLYGLLQLN 281

Query: 801 PERRWTVDDLLRGPFI 816
           P+RR +    L  P+ 
Sbjct: 282 PDRRLSAKQALNHPWF 297

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 49/332 (14%)

Query: 523 PQRKRQIIQVN----GSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSI 577
           PQ  +Q I        S +++ E++GRG    VYK       ++YA+K ++ D  D   +
Sbjct: 5   PQNSKQSIAEGEMDVSSLFKRTEVIGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEV 63

Query: 578 DGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEF 636
           +  + EI+ L  L+  + + +     +    L+++ME C    L  +L        D ++
Sbjct: 64  EDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPGK---IDEKY 120

Query: 637 VRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDT 695
           +    +E+L  ++ +H   ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R T
Sbjct: 121 IGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQT 178

Query: 696 QIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 755
             GTP +MAPE ++   Y   +                  DIWS G   Y++  G PPY 
Sbjct: 179 MAGTPYWMAPEVIMEGVYYDTK-----------------VDIWSLGITTYEIATGNPPYC 221

Query: 756 GFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPF 815
             +    +  I+  +     P +       P +  + I  CL+ +P+ R + DDLLR  F
Sbjct: 222 DVEALRAMQLIIKSK-----PPRLEGRSYSP-SLKEFIALCLDEDPKERLSADDLLRSKF 275

Query: 816 IK-----PVSVT------HFFIRDLIKNAVKY 836
           IK     P S+       +   RD  KN  KY
Sbjct: 276 IKAHRATPTSILKELVSRYLLFRD--KNKNKY 305

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 142/316 (44%), Gaps = 45/316 (14%)

Query: 535 SEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S +++ E++GRG    VYK       ++YA+K ++ D  D   ++  + EI+ L  L+  
Sbjct: 21  SLFKRTEVVGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQM 79

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             + +     +    L+++ME C    L  +L        D +++    +E+L  ++ +H
Sbjct: 80  PNITRYYGSYLKDTSLWILMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKCIH 136

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R T  GTP +MAPE ++  
Sbjct: 137 KDNVIHRDIKAANVLITNEGSVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEG 194

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +     L  M   +
Sbjct: 195 VYYDTK-----------------VDIWSLGITTYEIATGNPPYCDVEA----LRAMQLII 233

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK-----PVSVT---- 822
           K   P     G     +  + I  CL+ +P+ R + DDLLR  FIK     P S+     
Sbjct: 234 KSKPPR--LEGRSYSSSLKEFIALCLDEDPKERLSADDLLRSKFIKTHRATPTSILKELI 291

Query: 823 --HFFIRDLIKNAVKY 836
             +   RD  KN  KY
Sbjct: 292 SRYLLFRD--KNKNKY 305

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 155/332 (46%), Gaps = 35/332 (10%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S +++ E++GRG    VYK      K +YA+K ++ D  +D  ++  + EI+ L  L+  
Sbjct: 14  STFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSED-EVEDVQREIQFLASLKQI 72

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             + +     +    L+++ME C    L  +L        D +++    +E+L  ++V+H
Sbjct: 73  PNITRYYGSYLRGTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKVIH 129

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              ++H D+K AN +   +G +K+ DFG+A  +  +  ++ R T  GTP +MAPE ++  
Sbjct: 130 KDNVIHRDIKAANVLITNEGQVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEG 187

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +    +  I+  + 
Sbjct: 188 VYYDTK-----------------VDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSK- 229

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVT-HFFIRDLI 830
               P +    +  P+   + I  CL+ +P+ R + ++LL+  FIK    T    +++LI
Sbjct: 230 ----PPRLEERNYTPQLK-EFIALCLDEDPQERLSAEELLKTKFIKTHKATPTTILKELI 284

Query: 831 KNAVKYGSDQRYVSKEKVEDLADDVWNRLSDF 862
              + +    +  S +    LADD+ N  ++ 
Sbjct: 285 SRYLLFRDKNK--SYKDSAYLADDIPNAKAEL 314

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score =  110 bits (276), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 139/292 (47%), Gaps = 38/292 (13%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRV------SFDEFDDTSIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V      S DE   + ++  K E+  LK 
Sbjct: 1146 WIKGEIIGKGSFGSVYLGLNVTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKD 1205

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  + V  + +E      +  ++  R    FD + +R+ A ++L+ +
Sbjct: 1206 L-DHVNIVQYLGFENKNHVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGL 1262

Query: 649  QVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +  V GI KI DFGI+      + NIY ++ +   GT  +MA
Sbjct: 1263 AYLHSKGILHRDMKADNLLLDVDGICKISDFGISK----KSNNIYSNSDMTMRGTVFWMA 1318

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GC++ +M  G+ P+  F+    + 
Sbjct: 1319 PEMVDT-----KQGYSAK------------VDIWSLGCVVLEMFAGKRPWSNFEVVAAMF 1361

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
             I   +     PE T    L+   A   + AC E +PE+R T DDLL  PF 
Sbjct: 1362 KIGKFKSAPPIPEDTQK--LLSAEAKSFLDACFEIDPEKRPTADDLLSHPFC 1411

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 144/316 (45%), Gaps = 45/316 (14%)

Query: 535 SEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S +++ E++GRG    VYK       ++YA+K ++ D  D   ++  + EI+ L  L+  
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQI 79

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
           + + +     +    L+++ME C    L  +L        D +++    +E+L  ++ +H
Sbjct: 80  SNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKCIH 136

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R T  GTP +MAPE ++  
Sbjct: 137 KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEG 194

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +     L  M   +
Sbjct: 195 VYYDTK-----------------VDIWSLGITTYEIATGNPPYCDVEA----LRAMQLII 233

Query: 772 KIVYPEKTTHGDLVPRTAL-DTIKACLERNPERRWTVDDLLRGPFIK-----PVSVT--- 822
           K   P      D    T+L + I  CL+ +P+ R + DDLL+  FI+     P S+    
Sbjct: 234 KSKPPRLE---DRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKEL 290

Query: 823 ---HFFIRDLIKNAVK 835
              +   RD  KN  K
Sbjct: 291 ISRYLLFRDKNKNKYK 306

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score =  109 bits (272), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 155/328 (47%), Gaps = 43/328 (13%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEF---DDTSI---DGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V+  EF   D+++I   +  K E+  LK 
Sbjct: 1038 WIKGEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKD 1097

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L +   +V+ +  E  +G+  + +E      +  ++  R    FD + +R+  +++L+ +
Sbjct: 1098 L-NHVNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLEGL 1154

Query: 649  QVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +    G+ KI DFGI+      + NIY ++ +   GT  +MA
Sbjct: 1155 AYLHSKGILHRDMKADNLLLDNDGVCKISDFGISR----KSNNIYSNSDMTMRGTVFWMA 1210

Query: 705  PEAL-VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 763
            PE +  A  Y+               KV    DIWS GC++ +M  G+ P+  F+    +
Sbjct: 1211 PEMVDTAHGYSA--------------KV----DIWSLGCVVLEMFAGKRPWSNFEVVAAM 1252

Query: 764  LAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTH 823
              I   +     P+ T   DLV       +  C E +PE R T D L+  PF K  S   
Sbjct: 1253 FQIGKSKTAPPIPDDTK--DLVSPAGQSFLDQCFEIDPEMRPTADSLVGHPFCKTSSSFD 1310

Query: 824  F---FIRDLIKNAVKYGSDQRYVSKEKV 848
            F    +   IK+  K  S +  +S +++
Sbjct: 1311 FPKTKLAQFIKSNDKLNSSRLRISSQEL 1338

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 147/306 (48%), Gaps = 57/306 (18%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++    KI+A K V+       SI   K   +LL 
Sbjct: 71  LIKTRGRDYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVA-----KISIKSEKTRKKLLS 125

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++       T +V+ +D   +   +Y+++E C +  L  +L +R  M  + E VR+   
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRR-KMLTEPE-VRFFTT 183

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           +++  V+ +H   ++H DLK  N  F K   LK+ DFG+A  + +     Y  T  GTPN
Sbjct: 184 QIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKY--TVCGTPN 241

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 761
           Y+APE L   +     G + +             DIWSCG +IY ++ G+PP   FQ + 
Sbjct: 242 YIAPEVLTGKH----TGHSYE------------VDIWSCGVMIYALLIGKPP---FQAK- 281

Query: 762 RLLAIMNPEVKIVYPEKTTHGDLV-PR------TALDTIKACLERNPERRWTVDDLL--- 811
                   EV I+Y E+   GD V P+       AL  IK  L  +P  R ++D+++   
Sbjct: 282 --------EVNIIY-ERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

Query: 812 --RGPF 815
             RG F
Sbjct: 333 WFRGLF 338

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 143/310 (46%), Gaps = 35/310 (11%)

Query: 511 KPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSF 569
           +P  TE G+     R  Q +   GS +++ E++GRG    VYK   S  K ++A+K ++ 
Sbjct: 3   RPSGTEAGTRSASHRVEQDV---GSIFKRTEIIGRGKFGVVYKGYHSRTKQVFAIKVLNL 59

Query: 570 DEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRA 628
           D  D+  ++  + E++ L  ++    + +     +    L++++E C    L  +L    
Sbjct: 60  DS-DEDEVEDVQREVQFLASMKQVPNITQYYGSYLKDTTLWIIIEYCAGGSLRTLLRPGK 118

Query: 629 NMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDH 687
               D +++    +E+L  ++ +H   ++H DLK AN +    G +K+ DFG+A  +  +
Sbjct: 119 ---IDEKYIGVIMRELLIALKFIHRDNVIHRDLKAANVLITNDGQVKLCDFGVAAQL--N 173

Query: 688 TVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQM 747
             N  R T  GTP +MAPE ++   Y   +                  DIWS G   Y+ 
Sbjct: 174 QSNSRRHTMAGTPYWMAPEVIMEGVYYDTK-----------------VDIWSLGITTYEA 216

Query: 748 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTV 807
             G PPY   +    +  I   + K    E  ++  L+     + I  CL+ +P+ R + 
Sbjct: 217 ATGNPPYCEVEALRAMQLIT--KSKPPRLEGRSYSPLLK----EFIALCLDEDPKERLSA 270

Query: 808 DDLLRGPFIK 817
           ++LL+  FIK
Sbjct: 271 EELLKTKFIK 280

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score =  102 bits (253), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 88/296 (29%), Positives = 144/296 (48%), Gaps = 41/296 (13%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E +G G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+  
Sbjct: 5   SQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR----ANMPFDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R    ++   +++ V+Y   ++L+ V 
Sbjct: 63  DNIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVA 122

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   +G LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALV-AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 765
            L+ + NY                      DIWSCGCI+ +MI G+P + G   + +L  
Sbjct: 179 VLMGSRNYCTS------------------IDIWSCGCILAEMIMGKPLFPGSNDEEQLKL 220

Query: 766 I---MNPEVKIVYPEKT---THGDLVPRTALDTIKACLERNPERRW--TVDDLLRG 813
           I   M   V+  +P+ T    +  L+P      +K  L+ N E      V DLL G
Sbjct: 221 IFDTMGTPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDDNVVDLLHG 276

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 149/305 (48%), Gaps = 17/305 (5%)

Query: 541 ELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E++G+G  + V K V  S  K +A+K +S  +   +++DG   E+E+L+RL D  R+V+L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMDGVSRELEVLQRL-DHPRIVRL 264

Query: 600 IDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
                +H   Y++ME     DL   +A    +  D    R  ++++L+ ++ +H  GI H
Sbjct: 265 KGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAG--REISRQILEAIKYIHSMGISH 322

Query: 659 SDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTP 715
            DLKP N +  +    ++KI DFG+A    + T   +  T  GT  Y+APE +   N   
Sbjct: 323 RDLKPDNILIEQDDPVLVKITDFGLAKVQDNGT---FMKTFCGTLAYVAPEIISGKNDGE 379

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
            +   +   ++N +      D+WS GC++Y ++ G  P+ G   Q +L   ++   +  Y
Sbjct: 380 LRENADANSERNEY--SSLVDMWSMGCLVYVILTGHLPFSG-STQKQLYKQIS---RGSY 433

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVK 835
            E       +   A D I + L+  P  R T +  L  P+IK    +  F+++   N+V 
Sbjct: 434 HEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIKMAQFSQSFVKNNSVNSVN 493

Query: 836 YGSDQ 840
              D+
Sbjct: 494 ETDDK 498

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 147/325 (45%), Gaps = 44/325 (13%)

Query: 537 YEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           +++ E++GRG    VYK   +  K + A+K ++ D  DD  ++  + EI+ L  L+    
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADD-EVEDVQKEIQFLSSLKQVPN 77

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDI--EFVRYHAQEMLKCVQVVH 652
           +       +N   L+V+ME C    L  +L      P  I  +++    +E+L  +  +H
Sbjct: 78  ITHYYGSYLNDTKLWVIMEYCAGGSLRTLL-----RPGKIGEQYIGVIMRELLTALMHIH 132

Query: 653 DTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
             G++H D+K AN +    G +K+ DFG+A  +      I R T  GTP +MAPE ++  
Sbjct: 133 KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL--SQTKIRRQTMAGTPYWMAPEVIMEG 190

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +    +  I   + 
Sbjct: 191 VYYDTK-----------------VDIWSLGITAYEIATGNPPYCEVEALRAMQLIT--KS 231

Query: 772 KIVYPEKTTHGDLVPRTALDTIKA-CLERNPERRWTVDDLLRGPFIK-----PVSVTHFF 825
           K    E   H      +AL  I A CL+ +P+ R + +DLL+  FIK     PVS+    
Sbjct: 232 KPPRLEGRQHS-----SALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSILKEL 286

Query: 826 IRDLIKNAVKYGSDQRYVSKEKVED 850
           I   + +  K  S +  VS   +ED
Sbjct: 287 ISRYLLHRDKR-SQRESVSSSALED 310

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score =  101 bits (252), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 128/257 (49%), Gaps = 34/257 (13%)

Query: 532 VNGSEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRL 590
           ++ S+++++E LG G  + VYK  + +  +Y ALK V  D  + T     + EI L+K L
Sbjct: 1   MSSSQFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 59

Query: 591 EDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLK 646
           +    +V+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++L+
Sbjct: 60  K-HDNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLE 118

Query: 647 CVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYM 703
            +   H+  I+H DLKP N +  K G LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 119 GLAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 174

Query: 704 APEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 763
           AP+ L+                          DIWSCGCI+ +MI G+P + G   + +L
Sbjct: 175 APDVLMGSR-----------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQL 217

Query: 764 LAIMNPEVKIVYPEKTT 780
             I +   K+  P +TT
Sbjct: 218 KLIFD---KMGTPNETT 231

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 147/306 (48%), Gaps = 57/306 (18%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + KI+A K V+       SI   K   +LL 
Sbjct: 71  LIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVA-----KISIKSEKTRKKLLS 125

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ ID   +   +Y+++E C +  L  +L +R  +  + E VR+   
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLT-EPE-VRFFTT 183

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           +++  V+ +H   ++H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 184 QIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKY--TVCGTPN 241

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 761
           Y+APE L   +     G + +             DIWSCG +IY ++ G+PP   FQ + 
Sbjct: 242 YIAPEVLTGKH----TGHSYE------------VDIWSCGVMIYALLIGKPP---FQAK- 281

Query: 762 RLLAIMNPEVKIVYPEKTTHGDLV-PR------TALDTIKACLERNPERRWTVDDLL--- 811
                   EV I+Y E+   GD V PR       AL  I+  L  +P  R ++D+++   
Sbjct: 282 --------EVNIIY-ERIKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

Query: 812 --RGPF 815
             RG F
Sbjct: 333 WFRGIF 338

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 133/286 (46%), Gaps = 32/286 (11%)

Query: 535 SEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S +++ E++GRG    VYK       +++A+K ++ D  D   ++  + EI+ L  L+  
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKTRRVFAIKVLNLDS-DSDEVEDVQREIQFLASLKQI 79

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             + +     +    L+++ME C    L  +L        D +++    +E+L  ++ +H
Sbjct: 80  HNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMREVLVALKCIH 136

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              ++H D+K AN +   +G +K+ DFG+A  V  +  ++ R T  GTP +MAPE ++  
Sbjct: 137 KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEG 194

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y                KV    DIWS G   Y++  G PPY   +     L  M   +
Sbjct: 195 VYY-------------DTKV----DIWSLGITTYEIATGNPPYCEVEA----LRAMQLII 233

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           K   P     G     +  + I  CL+ +P+ R + DDLL+  FIK
Sbjct: 234 KSKPPR--LEGRSYSPSLKEFIALCLDEDPKERLSADDLLKSKFIK 277

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 152/335 (45%), Gaps = 44/335 (13%)

Query: 535 SEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S + + E++GRG    VYK       +IYA+K ++ D  D+  ++  + EI+ L  L+  
Sbjct: 40  SVFRRTEVIGRGKFGIVYKGYHVKTKQIYAIKVLNLDS-DEDEVEDVQREIQFLASLKQL 98

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             + +     +    L+++ME C    L  +L        D +++    +E+L  ++ +H
Sbjct: 99  PNITRYYGSYLKDTSLWIIMEYCAGGSLRTLLRPGK---IDEKYIGVITREILIALKYIH 155

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              I+H D+K AN +   +G +K+ DFG+A  +   T    R T  GTP +MAPE ++  
Sbjct: 156 KDNIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKR--RQTMAGTPYWMAPEVIMEG 213

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +    +  I   + 
Sbjct: 214 VYYDTK-----------------VDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSK- 255

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK-----PVSVTHFFI 826
               P +    +  P    + +  CL+ +P+ R + +DLL+  FIK     PVS+    +
Sbjct: 256 ----PPRLEGRNYSPLLK-EFVALCLDEDPKERMSAEDLLKTKFIKAHKLTPVSI----L 306

Query: 827 RDLIKNAVKYGSDQRYVSKEKV---EDLADDVWNR 858
           ++LI   + +    + + +E     E+ AD+  +R
Sbjct: 307 KELISRYLLFRDRNKTLKEEGALPEEEKADNKKSR 341

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 138/300 (46%), Gaps = 33/300 (11%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           + + + E++G+G    VYK  +   K +YA+K ++ D  D+  ++  + EI+ L  L+  
Sbjct: 39  AAFRRTEVIGKGKFGVVYKGYNLRTKHVYAIKVLNLDS-DEDEVEDVQREIQFLASLKQL 97

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             V +     + +  L+++ME C    L  +L        D +++    +E+L  ++ +H
Sbjct: 98  PNVTRYYGSYLKNTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKFIH 154

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              I+H D+K AN +   +G +K+ DFG+A  +   T  + R T  GTP +MAPE ++  
Sbjct: 155 KDNIIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRT--LRRQTMAGTPYWMAPEVIMEG 212

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +    +  I   + 
Sbjct: 213 VYYDTK-----------------VDIWSLGITAYEISTGNPPYCDVEALRAMQLITKSK- 254

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVT-HFFIRDLI 830
               P +    +  P    + I  CL+ +P  R + D+LL+  FIK    T    +++LI
Sbjct: 255 ----PPRLEGRNYTPLIK-EFIALCLDEDPNERLSADELLKSKFIKAHKTTPTIVLKELI 309

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score =  101 bits (252), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 88/316 (27%), Positives = 141/316 (44%), Gaps = 57/316 (18%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRA--NMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  RA  N P    +  V+Y   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRAVGNTPQGLALPLVKYFEWQLLQGVA 122

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          DIWSCGCI+ +MI G+P + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDIWSCGCILVEMITGKPLFPGTSDEEQLKLI 221

Query: 767 M--------------------NPEVKIVYPE------KTTHGDLVPRTALDTIKACLERN 800
                                NP   I  P+      ++   + +    +D +   L+ N
Sbjct: 222 FETMGTPTERTWPGISSLPKYNPNFPIHLPKDLRAFLQSQTRESLDNNVVDLLHGLLQLN 281

Query: 801 PERRWTVDDLLRGPFI 816
           PE R +    L  P+ 
Sbjct: 282 PEMRLSAKQALNHPWF 297

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 120/243 (49%), Gaps = 31/243 (12%)

Query: 533 NGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLE 591
           +GS+++++E LG G  + VYK +  +  +  ALK V  D  + T     + EI L+K L+
Sbjct: 3   SGSQFKQLEKLGNGTYATVYKGLNKTTGEFVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 592 DQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMPFDIEF--VRYHAQEMLKC 647
            +  +V+L D       L +V E  D DL + +  R   N P  +E   V+Y   ++L+ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTVGNAPVGLELHLVKYFQWQLLEG 120

Query: 648 VQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMA 704
           +   H+  I+H DLKP N +   KG LKI DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGQLKIGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 705 PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
           P+ L+                          DIWSCGCI+ +MI G+P + G   + +L 
Sbjct: 177 PDVLMGSR-----------------TYSTSIDIWSCGCILAEMITGKPLFPGTNEEEQLK 219

Query: 765 AIM 767
            I 
Sbjct: 220 LIF 222

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 121/242 (50%), Gaps = 31/242 (12%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++L+ + 
Sbjct: 64  N-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 650 VVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          DIWSCGCI+ +MI G+P + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLI 221

Query: 767 MN 768
            +
Sbjct: 222 FD 223

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 136/295 (46%), Gaps = 47/295 (15%)

Query: 541 ELLGRGGSSKV---YKVRSSNNKIYALKRVSFDEFDDTSID-------------GFKGEI 584
           E LG G + KV   Y   + N    A+K +S   F D+++              G + EI
Sbjct: 22  ETLGLGSTGKVQLAYNKTTGNQA--AIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREI 79

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQE 643
            ++K L +   V++L D    +  LY+V+E  +  +L  +L +R  +P + E +R+  Q 
Sbjct: 80  VIMKLL-NHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPEN-EAIRFFRQ- 136

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNY 702
           ++  +   H  GIVH DLKP N +   K  +KI DFG+A      T +   +T  G+P+Y
Sbjct: 137 IIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAAL---ETEDKLLETSCGSPHY 193

Query: 703 MAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  + Y                  G  SD+WSCG I+Y ++ GR P+    G  R
Sbjct: 194 AAPEIVSGIPYH-----------------GFASDVWSCGVILYALLTGRLPFDEEDGNIR 236

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            L +     +   PE     D + + A + I   L  NP  R T  D+L+ P ++
Sbjct: 237 NLLLKVQAGQFEMPE----DDEISKEAQNLISKILVVNPAERITARDILKHPLLQ 287

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/309 (29%), Positives = 141/309 (45%), Gaps = 47/309 (15%)

Query: 541 ELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDG---------------FKGEI 584
           E LG G + KV   R+ S  +  A+K +S   F+  ++ G                + EI
Sbjct: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSIVGSNTPDALPYGIEREI 82

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQE 643
            ++K L +   V++L D    +  LY+V+E  +  +L  +L +R  +P + E +R+  Q 
Sbjct: 83  IIMKLL-NHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEN-EAIRFFRQ- 139

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNY 702
           ++  V   H  GIVH DLKP N +   K  +KI DFG+A      T     +T  G+P+Y
Sbjct: 140 IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHY 196

Query: 703 MAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  + Y                  G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 197 AAPEIVSGIPYQ-----------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK--PVS 820
            L +   + +   P      D + R A D I   L  +PERR    D+L+ P ++  P  
Sbjct: 240 ALLLKVQKGEFELP----SDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSI 295

Query: 821 VTHFFIRDL 829
                IRDL
Sbjct: 296 RDSKSIRDL 304

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 138/297 (46%), Gaps = 38/297 (12%)

Query: 531  QVNGSEYEKVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEFDDTS------IDGFKGE 583
            + N   + K E++G+G    V+  +  +  ++ A+K++    +   S      ++  K E
Sbjct: 1129 EYNEFAWMKGEMIGKGSFGAVFLSLNITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSE 1188

Query: 584  IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            +  LK L D   +V+ +  EM H +  + +E      +  ++  R    FD + +R+   
Sbjct: 1189 VSTLKDL-DHLNIVQYLGFEMKHNIYSLFLEYVAGGSVGSLI--RMYGRFDDKLIRHLTN 1245

Query: 643  EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---G 698
            ++L+ +  +H  GI+H D+K  N +  + GI KI DFGI+    D    IY ++++   G
Sbjct: 1246 QVLEGLSYLHSQGILHRDMKADNLLLDQDGICKISDFGISKKSED----IYSNSEMTMRG 1301

Query: 699  TPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQ 758
            T  +MAPE +           T+Q       KV    DIWS GC++ +M  G+ P+  F+
Sbjct: 1302 TVFWMAPEMV----------DTKQGYNA---KV----DIWSLGCVVLEMFAGKRPWSNFE 1344

Query: 759  GQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPF 815
                +  I   +     PE T   DL+  TA + +  C   +P+ R T   LL  PF
Sbjct: 1345 VVTAMYKIGQSKSAPPIPEDT--KDLISPTAKNFLNQCFHIDPKERPTAGQLLEHPF 1399

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 120/242 (49%), Gaps = 31/242 (12%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++L+ + 
Sbjct: 64  N-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 650 VVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          DIWSCGCI+ +MI G+P + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLI 221

Query: 767 MN 768
            +
Sbjct: 222 FD 223

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 137/295 (46%), Gaps = 45/295 (15%)

Query: 541 ELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDG---------------FKGEI 584
           E LG G + KV   R+ S  +  A+K +S   F+  ++ G                + EI
Sbjct: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQE 643
            ++K L +   V++L D    +  LY+V+E  +  +L  +L +R  +P + E +R+  Q 
Sbjct: 83  IIMKLL-NHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-EHEAIRFFRQ- 139

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNY 702
           ++  V   H  GIVH DLKP N +   K  +KI DFG+A      T     +T  G+P+Y
Sbjct: 140 IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHY 196

Query: 703 MAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  + Y                  G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 197 AAPEIVSGIPYQ-----------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            L +   + +   P      D + R A D I+  L  +PERR    D+L+ P ++
Sbjct: 240 TLLLKVQKGEFEMP----SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 132/285 (46%), Gaps = 32/285 (11%)

Query: 536 EYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           ++ +  ++GRG    VYK    N K +YA+K ++ D  D+  ++  + EI+ L  L+   
Sbjct: 34  KFRRTNVIGRGKFGVVYKGYHLNTKHVYAIKVLNLDS-DEDEVEDVQKEIQFLASLKQLP 92

Query: 595 RVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            + +     + +  L+++ME CG   L  +L        D +++    +E+L  ++ +H 
Sbjct: 93  NITRYYGSYLKNTSLWIIMEYCGGGSLRSLLRPGK---IDEKYIGVIMREILIALKYIHK 149

Query: 654 TGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
             ++H D+K AN +    G +K+ DFG+A  +  +     R T  GTP +MAPE ++   
Sbjct: 150 DNVIHRDIKAANVLINNDGSIKLCDFGVAAQL--NQTKSRRQTMAGTPYWMAPEVIMEGV 207

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
           Y   +                 +DIWS G   Y++  G PPY   +    +  I   + K
Sbjct: 208 YYDTK-----------------ADIWSTGITAYEVTTGNPPYCDVEALRAMQLIA--KSK 248

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
               E   +  L+     + I  CL+ +P  R T D+LL+  FIK
Sbjct: 249 PPRLEGRNYSALIK----EFIATCLDEDPSERPTADELLKTAFIK 289

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 136/295 (46%), Gaps = 45/295 (15%)

Query: 541 ELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDG---------------FKGEI 584
           E LG G + KV   R+ S  +  A+K +S   F+  ++ G                + EI
Sbjct: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSGTSIVGSTTPDALPYGIEREI 82

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQE 643
            ++K L +   V++L D    +  LY+V+E  +  +L  +L +R  +P + E +R+  Q 
Sbjct: 83  IIMKLL-NHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLPEN-EAIRFFRQ- 139

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNY 702
           ++  V   H  GIVH DLKP N +   K  +KI DFG+A      T     +T  G+P+Y
Sbjct: 140 IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHY 196

Query: 703 MAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  + Y                  G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 197 AAPEIVSGIPYQ-----------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            L +   + +   P      D + R A D I   L  +PERR    D+L+ P ++
Sbjct: 240 TLLLKVQKGEFELP----SDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQ 290

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score =  100 bits (248), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 120/242 (49%), Gaps = 31/242 (12%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++L+ + 
Sbjct: 64  N-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 650 VVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +  K G LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          DIWSCGCI+ +MI G+P + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLI 221

Query: 767 MN 768
            +
Sbjct: 222 FD 223

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 140/292 (47%), Gaps = 36/292 (12%)

Query: 532 VNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRL 590
           V  ++Y  + ++G+G    VYK V    N++ A+K+V++D  +D  ++    EI LLK L
Sbjct: 74  VTKAQYGLINVIGKGSFGVVYKAVNRQTNQVIAIKQVNYD--NDEELNDIMSEINLLKNL 131

Query: 591 EDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQ 649
            +   +VK          LY+++E C    L  +++    +P + +  +Y  Q +   V 
Sbjct: 132 -NHKHIVKYHGFMQKSDTLYILLEYCAHGSLKNLISSSKGIP-EKDAQQYIIQTLYGLV- 188

Query: 650 VVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEAL 708
            +H  G++H D+K AN +  K   +K+ DFG++  V + T+ +   T  G+ N+MAPE L
Sbjct: 189 YLHAQGVIHRDIKAANILLDKDNTVKLADFGVSTRVGNATMAM---TLAGSLNWMAPEIL 245

Query: 709 VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 768
                  ++G +              SDIWS G  + ++I G PP+      N   AI N
Sbjct: 246 ------GNKGASTL------------SDIWSLGATVVELITGNPPFHNLVDINIYYAIEN 287

Query: 769 PEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVS 820
                + PE          TA+D +  C ++N  RR T   LL   +++P++
Sbjct: 288 DNY--IPPEGA-----FSETAIDFLNLCFKKNMYRRPTAQQLLNHKWLQPMT 332

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 90/301 (29%), Positives = 139/301 (46%), Gaps = 36/301 (11%)

Query: 537 YEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y+ +  +G+G S  VY       N   A+K+++ ++     +     EI L+ +      
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKEL--IVNEI-LVMKGSKHNN 754

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+VVME  +   L+ V+         I  V   ++E LK +Q +H  
Sbjct: 755 IVNFIDSYLFRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAV---SRETLKGLQFLHSK 811

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    +  + VN+ R T +GTP +MAPE +    Y
Sbjct: 812 GVIHRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVNLKRTTMVGTPYWMAPEVVSRKEY 869

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 772
            P              KV    DIWS G +I +MI G PPY        L L   N   K
Sbjct: 870 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 911

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKN 832
           +  P     G+L  + A+  +  CL  +PE R T  DLL  PFI  ++  +  +  L+K 
Sbjct: 912 LKDP-----GNLSHKMAM-FLNWCLMVDPEDRGTAADLLEDPFITEIAEENTSLAPLVKL 965

Query: 833 A 833
           A
Sbjct: 966 A 966

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score =  104 bits (260), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 148/323 (45%), Gaps = 45/323 (13%)

Query: 535 SEYEKVELLGRGGSSKVYK---VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLE 591
           S + + E++GRG    VYK   VR+   +IYA+K ++ D  D+  ++  + E++ L  L+
Sbjct: 35  SMFRRTEVIGRGKFGIVYKGYHVRTK--QIYAIKVLNLDS-DEDEVEDVQREVQFLSSLK 91

Query: 592 DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQV 650
               + +     +    L+++ME C    L  +L        D +++    +E+L  ++ 
Sbjct: 92  QIPNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKY 148

Query: 651 VHDTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 709
           +H   ++H D+K AN +   +G +K+ DFG+A  +   T  + R T  GTP +MAPE ++
Sbjct: 149 IHKDNVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQST--LRRQTMAGTPYWMAPEVIM 206

Query: 710 AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 769
              Y   +                  DIWS G   Y++  G PPY   +    +  I   
Sbjct: 207 EGVYYDTK-----------------VDIWSLGITAYEIATGNPPYCEVEALRAMQLITKS 249

Query: 770 EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK-----PVSVTHF 824
           +     P +       P    + I  CL+ +P+ R + ++L +  FIK     PVS+   
Sbjct: 250 K-----PPRLESRSYTPLLK-EFIALCLDEDPKERLSAEELSKTKFIKAHKLTPVSI--- 300

Query: 825 FIRDLIKNAVKYGSDQRYVSKEK 847
            +++LI   + +    +  SKE+
Sbjct: 301 -LKELISRYLLFRDRNKASSKEE 322

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score =  102 bits (253), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 148/318 (46%), Gaps = 42/318 (13%)

Query: 536 EYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLED-- 592
           +YE ++ +GRG    VYK R  ++N+I A+K V+ ++ D+  ID    EI  L  L    
Sbjct: 19  QYEILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDE-PIDLLAQEIFFLSELRSPY 77

Query: 593 --QTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQ 649
               +   L+D  M     ++VME CG    +++L          E   +   E+L  + 
Sbjct: 78  ITNYKTAFLVDVSM-----WIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLD 132

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEAL 708
            +H    +H D+K AN +    G +K+ DFG++  +    V   RDT +GTP +MAPE  
Sbjct: 133 YLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSGQM---MVTRKRDTFVGTPFWMAPEV- 188

Query: 709 VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 768
                          I +N+    + +DIWS G  + +++ G PP   +     L+AI  
Sbjct: 189 ---------------IDRNKQGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 769 PEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRD 828
            +   +    ++H       A D +  CL ++P +R T  +LL+  F+K V +  + +RD
Sbjct: 234 RDPPKLDKRFSSH-------ARDFVAQCLIKDPSQRPTAAELLKHRFVKRVRL--YNLRD 284

Query: 829 LIKNAVKYGSDQRYVSKE 846
            + + VK      + S+E
Sbjct: 285 QV-DLVKRNKMISFASRE 301

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 99.8 bits (247), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 120/241 (49%), Gaps = 31/241 (12%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++L+ V 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELSLVKYFHWQLLEGVS 122

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H++ I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          D+WSCGCI+ +MI G+P + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQLKLI 221

Query: 767 M 767
            
Sbjct: 222 F 222

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 132/286 (46%), Gaps = 32/286 (11%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S  ++ E++GRG    VYK      K +YA+K ++ D  D   ++  + EI+ L  L+  
Sbjct: 42  SSIKRTEVIGRGKFGVVYKGYHLKTKHVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQV 100

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             + +     +    L+++ME C    L  +L  R  M  D +++    +E+L  +Q +H
Sbjct: 101 PNITRYYGSYLQDTNLWIIMEYCAGGSLRTLL--RPGM-IDEKYIGVIMRELLTALQCIH 157

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              ++H D+K AN +   +G +K+ DFG+A  +  +  ++ R T  GTP +MAPE ++  
Sbjct: 158 KDNVIHRDIKAANVLITNEGKVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEG 215

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +    +  I   + 
Sbjct: 216 VYYDTK-----------------VDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKP 258

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             +   + + G        + I  CL+ +P+ R + ++L +  FIK
Sbjct: 259 ARLEGRQYSSG------LKEFIALCLDEDPKERLSAEELQKSKFIK 298

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 140/303 (46%), Gaps = 36/303 (11%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+Y  +  +G+G S  VY    + ++   A+K+++ ++     +     EI L+ R    
Sbjct: 618 SKYRDLIKIGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKEL--ILNEI-LVMRESKH 674

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
           + +V  ID  +  G L++VME  +   L+ V+         I  V    +E LK +Q +H
Sbjct: 675 SNIVNFIDSYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGAV---CRETLKGLQFLH 731

Query: 653 DTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
             G++H D+K  N +  +KG +K+ DFG    + ++  N+ R T +GTP +MAPE +   
Sbjct: 732 SKGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPYWMAPEVVSRK 789

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPE 770
            Y P              KV    DIWS G +I +MI G PPY        L L   N  
Sbjct: 790 EYGP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGT 831

Query: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLI 830
            K+  PE  +       T    +  CL+ +P  R T  +LL  PFI  ++  +  +  L+
Sbjct: 832 PKLKEPEALSD------TLTKFLDWCLKVDPSERATATELLDDPFITEIAEDNSSLSPLV 885

Query: 831 KNA 833
           K A
Sbjct: 886 KLA 888

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score =  101 bits (251), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 147/318 (46%), Gaps = 42/318 (13%)

Query: 536 EYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLED-- 592
           +YE ++ +GRG    VYK R  + N+I A+K V+ ++ D+  ID    EI  L  L    
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDE-PIDLLAQEIFFLSELRSPY 77

Query: 593 --QTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQ 649
               +   L+D  M     ++VME CG    +++L          +   +   E+L  + 
Sbjct: 78  ITNYKTAFLVDVSM-----WIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLD 132

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEAL 708
            +H    +H D+K AN +    G +K+ DFG++  +    V   RDT +GTP +MAPE  
Sbjct: 133 YLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSGQM---MVTRKRDTFVGTPFWMAPEV- 188

Query: 709 VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 768
                          I +N+    + +DIWS G  + +++ G PP   +     L+AI  
Sbjct: 189 ---------------IDRNKKGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 769 PEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRD 828
            +   +    ++H       A D +  CL ++P +R T  +LL+  F+K V +  + +RD
Sbjct: 234 RDPPKLDKRFSSH-------AKDFVAQCLIKDPSQRPTASELLKHRFVKRVRL--YNLRD 284

Query: 829 LIKNAVKYGSDQRYVSKE 846
            + + VK      + S+E
Sbjct: 285 QV-DLVKRNKMISFASRE 301

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 99.0 bits (245), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 138/316 (43%), Gaps = 57/316 (18%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    I+ ALK V  D  + T     + EI L+K L+ +
Sbjct: 6   SQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 64

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR----ANMPFDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D DL   +  R    +    ++  V+Y   ++ + V 
Sbjct: 65  -NIVRLYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQLFEGVT 123

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    T++ T  Y AP+
Sbjct: 124 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----TEVVTLWYRAPD 179

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL--- 763
            L+                          D+WSCGCI+ +MI G+P + G   + +L   
Sbjct: 180 VLMGSR-----------------SYSTSIDMWSCGCILAEMITGKPLFPGTNDEEQLKLI 222

Query: 764 LAIMNPEVKIVYPEKTT-----------------------HGDLVPRTALDTIKACLERN 800
             IM    + ++P  T+                         ++V    +D +   L+ N
Sbjct: 223 FDIMGTPDEQLWPAVTSLPKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVTGLLQLN 282

Query: 801 PERRWTVDDLLRGPFI 816
           P+ R T    L  P+ 
Sbjct: 283 PDARLTAKQALHHPWF 298

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score =  103 bits (258), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 142/299 (47%), Gaps = 38/299 (12%)

Query: 531  QVNGSEYEKVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEF---DDT---SIDGFKGE 583
            + N   + K E++G+G    V+  +  +  ++ A+K+V   ++   ++T   ++D  + E
Sbjct: 1134 EYNEFAWMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEVPKYGLQNETVVNTVDALRLE 1193

Query: 584  IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            +  LK L D   +V+ +  E  +G+  + +E      +  ++  R    FD   +R+   
Sbjct: 1194 VSTLKDL-DHLNIVQYLGFEAKNGIYSLFLEYVAGGSVGSLI--RMYGRFDDILIRHLTI 1250

Query: 643  EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---G 698
            ++L+ +  +H  GI+H D+K  N +  + G+ KI DFGI+    D    IY ++++   G
Sbjct: 1251 QVLQGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSND----IYSNSEMTMKG 1306

Query: 699  TPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQ 758
            T  +MAPE +        QG + +             DIWS GCI+ +M  G+ P+  F+
Sbjct: 1307 TVFWMAPEMV-----DTKQGYSAK------------VDIWSLGCIVLEMFAGKRPWSNFE 1349

Query: 759  GQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
                +  I   +     PE T    L+   A + +  C E +PE+R T D LL  PF K
Sbjct: 1350 VVAAMFKIGQAKSAPPIPEDTL--PLISENAKEFLDCCFEIDPEKRPTADKLLSHPFSK 1406

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score =  103 bits (257), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 137/292 (46%), Gaps = 38/292 (13%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRV------SFDEFDDTSIDGFKGEIELLKR 589
            + K E++G+G    V+  +  +  ++ A+K+V      S DE   + ++  + E+  LK 
Sbjct: 1146 WIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKD 1205

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D T +V+ +  E  + V  + +E      +  ++  R    FD   +R+ A ++L+ +
Sbjct: 1206 L-DHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGL 1262

Query: 649  QVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H   I+H D+K  N +  V GI KI DFGI+      + NIY ++ +   GT  +MA
Sbjct: 1263 SYLHSKKILHRDMKADNLLLDVDGICKISDFGISK----KSNNIYSNSDMTMRGTVFWMA 1318

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GC++ +M  G+ P+   +    + 
Sbjct: 1319 PEMVDT-----KQGYSAK------------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMF 1361

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
             I   +     PE T    ++     + + AC E NPE+R T D+LL  PF 
Sbjct: 1362 KIGKFKSAPPIPEDTQK--IISAEGKEFLDACFEINPEKRPTADELLSHPFC 1411

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 119/243 (48%), Gaps = 31/243 (12%)

Query: 533 NGSEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLE 591
           + S+++++E LG G  + VYK  +     Y ALK V  D  + T     + EI L+K L+
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 592 DQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKC 647
            +  +V+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++L+ 
Sbjct: 62  HEN-IVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEG 120

Query: 648 VQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMA 704
           +   H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 705 PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
           P+ L+                          DIWSCGCI+ +MI G+P + G   + +L 
Sbjct: 177 PDVLMGSR-----------------TYSTSIDIWSCGCILAEMITGKPLFPGSNDEEQLK 219

Query: 765 AIM 767
            I 
Sbjct: 220 LIF 222

>Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W
           (REAL)
          Length = 719

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/327 (27%), Positives = 140/327 (42%), Gaps = 51/327 (15%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSN-NKIYALKRVSFDEF-DDTSIDGFKGE 583
           K Q I V    +EK+ LLG+G   KVY VR  + N+I+ALK +S  E      I     E
Sbjct: 312 KFQDITVEPRSFEKIRLLGQGDVGKVYLVRERDTNQIFALKVLSKHEMIKRKKIKRVLTE 371

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L    D   +V L         LY+ ME C   +  + L  R +     E  +++A 
Sbjct: 372 QEILAT-SDHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYAS 430

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDF-----GIANAVPDHTVNIYRDTQ 696
           E++  ++ +H  G ++ DLKP N +  + G + + DF      I +  P    + Y DT+
Sbjct: 431 EVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQAIGSKNPTMKDSTYLDTK 490

Query: 697 I-----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIY 745
           I           GT  Y+APE +    +T                     D W+ G ++Y
Sbjct: 491 ICSDGFRTNSFVGTEEYLAPEVIRGNGHTA------------------AVDWWTLGILVY 532

Query: 746 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERR- 804
           +M++G  P+ G         I+  + K  +P    HG  V +   D IK  L +N  +R 
Sbjct: 533 EMLFGCTPFKGVNSNETFSNILAKDAK--FP----HGKEVSKNCKDLIKKLLNKNETKRL 586

Query: 805 ---WTVDDLLRGPFIKPVSVTHFFIRD 828
                  D+ R PF K V  +  F+R+
Sbjct: 587 GSKLGATDIKRHPFFKKVQWS--FLRN 611

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 119/242 (49%), Gaps = 31/242 (12%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++L+ + 
Sbjct: 63  DNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRIVGNTPRGLELHLVKYFQWQLLEGLA 122

Query: 650 VVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          DIWSCGCI+ +MI G+P + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDIWSCGCILAEMITGKPLFLGSNDEEQLKLI 221

Query: 767 MN 768
            +
Sbjct: 222 FD 223

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 115/230 (50%), Gaps = 31/230 (13%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+ +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRAN--MP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  R +  MP   ++  V+Y   ++L+ V 
Sbjct: 64  N-IVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRVDREMPRGLELSLVKYFQWQLLQGVA 122

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            L+                          DIWSCGCI+ +MI G+  + G
Sbjct: 179 VLMGSR-----------------SYCTSIDIWSCGCILAEMIMGKALFPG 211

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 136/293 (46%), Gaps = 38/293 (12%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRV------SFDEFDDTSIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V      S DE   + ++  + E+  LK 
Sbjct: 1174 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDEATISVVEALRSEVSTLKN 1233

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  + +  + +E      +  ++  R    FD   +R+   ++L+ +
Sbjct: 1234 L-DHLNIVQYLGFENKNSIYSLFLEYVAGGSVGSLI--RLYGRFDESLIRFLTVQVLRGL 1290

Query: 649  QVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +  + G+ KI DFGI+    D    IY ++ +   GT  +MA
Sbjct: 1291 SYLHSRGILHRDMKADNLLLDLDGVCKISDFGISRKSND----IYCNSDMTMRGTVFWMA 1346

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GC++ +M  G+ P+   +    + 
Sbjct: 1347 PEMVDT-----KQGYSAK------------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMF 1389

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             I   +     PE T    L+ +   + + AC E +PERR T D LLR  F +
Sbjct: 1390 KIGKSKTAPPIPEDTL--PLISKEGREFLDACFEIDPERRPTADTLLRHRFCE 1440

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 136/291 (46%), Gaps = 38/291 (13%)

Query: 537  YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDD------TSIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V   ++        ++++  + E+  LK 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  + +  + +E      +  ++  R    FD   +++   ++LK +
Sbjct: 1235 L-DHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGL 1291

Query: 649  QVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +  + GI KI DFGI+    D    IY ++ +   GT  +MA
Sbjct: 1292 AYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKD----IYSNSDMTMRGTVFWMA 1347

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GCI+ +M  G+ P+   +    + 
Sbjct: 1348 PEMVDT-----KQGYSAK------------VDIWSLGCIVLEMFAGKRPWSNLEVVAAMF 1390

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPF 815
             I   +     PE T    L+ +   + + AC E NPE+R T ++LL  PF
Sbjct: 1391 KIGKSKSAPPIPEDTL--PLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 139/300 (46%), Gaps = 37/300 (12%)

Query: 537 YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           +++ E++GRG    VYK      N++ A+K ++ D  DD  ++  + E++ L  L+    
Sbjct: 19  FKRTEVIGRGKFGIVYKGYYIKTNRVCAIKVLNLDSADD-EVEDVQKEVQFLSSLKQVPN 77

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDI--EFVRYHAQEMLKCVQVVH 652
           +       +N+  L+V+ME C    L  +L      P  I  +++    +E+L  +  +H
Sbjct: 78  ITHYYGSYLNNTELWVIMEYCAGGSLRTLL-----RPGKIGEQYIGVIMRELLIALMHIH 132

Query: 653 DTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
             G++H D+K AN +    G +K+ DFG+A  +      I R T  GTP +MAPE ++  
Sbjct: 133 KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL--SQTKIRRQTMAGTPYWMAPEVIMEG 190

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                  DIWS G   Y++  G PPY   +    +  I   + 
Sbjct: 191 VYYDTK-----------------VDIWSLGITAYEIATGNPPYCDVEALRAMQLIT--KS 231

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK-PVSVTHFFIRDLI 830
           K    E   H   +     + I  CL+ +P+ R + ++LL+  FI+   +V+   +++LI
Sbjct: 232 KPPRLEGRQHSSALK----EFIALCLDEDPKERPSAEELLKTKFIRLHKNVSASILKELI 287

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 135/302 (44%), Gaps = 36/302 (11%)

Query: 536 EYEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           +Y  +  +G+G S  VY       +   A+K+++ ++     +     EI ++K      
Sbjct: 550 KYTNLVKIGQGASGGVYTAYEVGTDASVAIKQMNLEKQPKKEL--IINEIIVMKD-SKHP 606

Query: 595 RVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +V  ID  +  G L+V+ME  +   L+ V+         I  V    +E L+ +Q +H 
Sbjct: 607 NIVNFIDSFLLKGDLWVIMEFMEGGSLTDVVTHCILTEGQIGTV---CRETLRGLQFLHS 663

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K  N +  +KG +K+ DFG    + +H  N+ R T +GTP +MAPE +    
Sbjct: 664 NGVIHRDIKSDNILLSMKGDIKLTDFGFCAQINEH--NLKRTTMVGTPYWMAPEVVSRKE 721

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEV 771
           Y P              KV    DIWS G +I +MI   PPY        L L   N   
Sbjct: 722 YGP--------------KV----DIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGTP 763

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIK 831
           K+  PE      L+     D +  CL+ NP+ R +   LL  PFI   S  +  +  L+K
Sbjct: 764 KLKEPE------LLSDVLNDFLSWCLKVNPDERASASTLLEDPFITEYSEPNVSLAPLVK 817

Query: 832 NA 833
            A
Sbjct: 818 LA 819

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 129/284 (45%), Gaps = 32/284 (11%)

Query: 537 YEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           +++ E++GRG    VYK   +  K +YA+K ++ D  +D  ++  + EI+ L  L+    
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPED-EVEDVQKEIQFLASLKQVPN 83

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           + +     +    L+V+ME C    L  +L        D +++    +++L  +  +H  
Sbjct: 84  ITRYYGSYLYDTKLWVIMEYCAGGSLRTLLRPGK---IDEKYLGVIVRKLLIALVYIHKD 140

Query: 655 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            ++H D+K AN +   +G +K+ DFG+A  +     N  R T  GTP +MAPE ++   Y
Sbjct: 141 NVIHRDIKAANVLITNEGHVKLCDFGVAAQL--TAANHKRQTMAGTPYWMAPEVIMEGVY 198

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
                                +DIWS G   Y++  G PPY   +    +  I   +   
Sbjct: 199 -----------------YNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSK--- 238

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             P +    +  P    + I  CL+ +PE R T +DLL   F+K
Sbjct: 239 --PPRLEGRNYSPLLK-EFIALCLDEDPEERPTAEDLLSSKFVK 279

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 136/295 (46%), Gaps = 45/295 (15%)

Query: 541 ELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDG---------------FKGEI 584
           E LG G + KV   R+ S  +  A+K +S   F+  ++ G                + EI
Sbjct: 23  ETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDALPYGIEREI 82

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQE 643
            ++K L +   V++L D    +  LY+V+E  +  +L  +L +R  +P + E +R+  Q 
Sbjct: 83  IIMKLL-NHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEN-EAIRFFRQ- 139

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNY 702
           ++  V   H  GIVH DLKP N +   K  +KI DFG+A      T     +T  G+P+Y
Sbjct: 140 IIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHY 196

Query: 703 MAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  + Y                  G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 197 AAPEIVSGIPYQ-----------------GFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            L +   + +   P      D V R A D I   L  +P+RR    D+L+ P ++
Sbjct: 240 TLLLKVQKGQFELP----SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 140/316 (44%), Gaps = 59/316 (18%)

Query: 537 YEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           ++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+ +  
Sbjct: 9   FKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHEN- 66

Query: 596 VVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRAN--MP--FDIEFVRYHAQEMLKCVQVV 651
           +V+L D       L +V E  D+DL + +  R +  MP   ++  V+Y   ++L+ V   
Sbjct: 67  IVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQLLQGVAFC 126

Query: 652 HDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPEAL 708
           H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ L
Sbjct: 127 HENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVL 182

Query: 709 VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM- 767
           +                          DIWSCGCI+ +MI G+  + G     +L  I  
Sbjct: 183 MGSR-----------------TYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFE 225

Query: 768 -------------------NPEVKIVYPEK-------TTHGDLVPRTALDTIKACLERNP 801
                              NP++ + YP K        T  + +    ++ I+  L+ NP
Sbjct: 226 TMGTPTEQTWVGVSQLPKYNPQIPL-YPNKDIKQLLQATTKEQISDVLVNLIQGLLQLNP 284

Query: 802 ERRWTVDDLLRGPFIK 817
             R +    L  P  +
Sbjct: 285 SMRLSAQQALSHPLFE 300

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 146/302 (48%), Gaps = 49/302 (16%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + KI+A K V+       SI   K + +LL 
Sbjct: 87  LIKTRGRDYRREHFLGEGGFARCFQIKDESGKIFAAKTVA-----KISIKSEKTKRKLLS 141

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++       + +V+ ID   +   +Y+++E C +  L  +L +R ++  + E VR+   
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLT-EPE-VRFFTT 199

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   I+H DLK  N  F K   LK+ DFG+A  + +     Y  T  GTPN
Sbjct: 200 QICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKY--TVCGTPN 257

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 761
           Y+APE L+  +     G + +             DIWS G +IY ++ G+PP+     Q 
Sbjct: 258 YIAPEVLMGKH----SGHSFE------------VDIWSIGVMIYALLVGKPPF-----QA 296

Query: 762 RLLAIMNPEVKIV---YPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLL-----RG 813
           + + ++   +K+    YP+       V + A   I   L  NP +R T+ D++     RG
Sbjct: 297 KDVNVIYERIKLCKYGYPKD----KYVSKEAEILIHDILSLNPLQRPTIIDIIDDVWFRG 352

Query: 814 PF 815
            F
Sbjct: 353 VF 354

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 143/302 (47%), Gaps = 36/302 (11%)

Query: 536 EYEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           +Y  +  +GRGGS+ VY       N   A+K+++ ++     +     EI ++K+ +   
Sbjct: 612 KYANLVKIGRGGSALVYTAYEVGTNLSVAIKQINLEKQPRKQL--ILNEIIVMKKSQ-HP 668

Query: 595 RVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +V  ID  +  G L+V+ME  +   L+ V+ +       I  V    +E+LK +  +H 
Sbjct: 669 NIVNFIDSYLVDGKLWVIMEYMEAGSLTDVVTRCILREGQIGAV---CREVLKGLVFLHS 725

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K  N +  + G +K+ DFG    + D  +++ R+T +GTP +MAPE +   +
Sbjct: 726 KGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQLND--IHLKRNTMVGTPYWMAPEIVEKKH 783

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEV 771
           Y P              KV    DIWS G +I +MI G PPY        L L   N   
Sbjct: 784 YCP--------------KV----DIWSLGVMIIEMIEGEPPYLNEPPLRALYLIATNGTP 825

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIK 831
           K+  PEK      +  T  + I  CL  +PE R T  +LL   FI  ++  +  +  L+K
Sbjct: 826 KLKDPEK------LSETLSEFINCCLFVDPELRKTAAELLNHRFITEIAGPNKSLSHLVK 879

Query: 832 NA 833
            A
Sbjct: 880 LA 881

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 150/307 (48%), Gaps = 38/307 (12%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEF-DDTSID 578
           +T Q+ R +++    +++  E+LG G  S V    S+++ K YA+K ++ +       + 
Sbjct: 158 ETGQKMRHVVKKGIKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVK 217

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFV 637
               E   L+RL +   +++L     +   LY ++E   + DL  ++ +  ++  + E  
Sbjct: 218 YVNIEKLALQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSL--NEECC 275

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIA----NAVPDHTVNIY 692
            Y+  +++  ++ +H  GI+H D+KP N +  K + +KI DFG A    N  P  + ++ 
Sbjct: 276 CYYGAQIIDAIKFMHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLL 335

Query: 693 RDTQ--IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYG 750
             ++  +GT  Y++PE L+  NYT  +                 SDIW+ GCI++QMI G
Sbjct: 336 TRSKSFVGTAEYVSPE-LLNDNYTDAR-----------------SDIWAFGCIVFQMIAG 377

Query: 751 RPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDL 810
           +PP   F+  N  L      +K+ Y    T G   P    D +K  L + PE+R T++ +
Sbjct: 378 KPP---FKATNEYLTFQK-VMKVQY--AFTAG--FPTVVRDLVKRILIKAPEQRLTIEAI 429

Query: 811 LRGPFIK 817
            +  F +
Sbjct: 430 EKHHFFR 436

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 140/307 (45%), Gaps = 38/307 (12%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEFDD------TSIDGFKGEIELLKR 589
            + K EL+G+G    VY  +  +  ++ A+K+V   EF        ++++  + E+ LLK 
Sbjct: 1338 WVKGELIGKGSFGSVYLSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKD 1397

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  + +  + +E      +  ++  R    FD   +R+   ++L  +
Sbjct: 1398 L-DHINIVQYLGFEKKNNIYSLFLEYVAGGSIGSLI--RMYGRFDESLIRHSTTQILAGL 1454

Query: 649  QVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +   +GI KI DFGI+    D    IY ++++   GT  +MA
Sbjct: 1455 SYLHSKGILHRDMKADNILLDGEGICKISDFGISRKSKD----IYSNSEMTMRGTVFWMA 1510

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GCII +M  G+ P+   +    + 
Sbjct: 1511 PEMVDT-----KQGYSAK------------VDIWSLGCIILEMFAGKRPWSNLEVVAAMF 1553

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHF 824
             I   +     PE T    L+ +   D +  C + +PE+R T + +L   F +      F
Sbjct: 1554 KIGQSKSAPPIPEDTL--PLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLFSQVDPNFDF 1611

Query: 825  FIRDLIK 831
               DL+K
Sbjct: 1612 SSTDLVK 1618

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 96.7 bits (239), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 123/259 (47%), Gaps = 34/259 (13%)

Query: 533 NGSEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLE 591
           + S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 592 DQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKC 647
               +V+L D       L +V E  D DL + +  R   N P   ++  V+Y   ++ + 
Sbjct: 62  -HDNIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTTGNSPQGLELSLVKYFQWQLFEG 120

Query: 648 VQVVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMA 704
           +   H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 ISFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 705 PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
           P+ L+                          D+WSCGCI+ +M+ G+P + G   + +L 
Sbjct: 177 PDVLMGSR-----------------SYSTSIDMWSCGCILAEMLTGKPLFPGTNDEEQLK 219

Query: 765 AI---MNPEVKIVYPEKTT 780
            I   M    +  +P  TT
Sbjct: 220 LIFDMMGTPTESTWPTVTT 238

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 85/327 (25%), Positives = 152/327 (46%), Gaps = 45/327 (13%)

Query: 541 ELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E +GRG    VY+ +  + NK+ A+K V  +  ++  ++    EI  L  L+    ++  
Sbjct: 26  ECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNE-RLEVLAQEIFFLAELKS-PYIINY 83

Query: 600 IDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
           I   +    +++VME CG    S +L    N     + V Y  +E+LK +Q +H+   +H
Sbjct: 84  ITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHEQKKIH 143

Query: 659 SDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQ 717
            D+K AN +   +G +K+ DFG++  +      + R T +GTP +MAPE           
Sbjct: 144 RDIKAANILLTEEGHVKLGDFGVSGQLKS---TLRRGTIVGTPYWMAPEV---------- 190

Query: 718 GQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN----PEVKI 773
               Q I+    K+    DIWS G  +++++ G PP        R+LA ++    P ++ 
Sbjct: 191 --ASQNIEGYDEKI----DIWSLGITVFELLKGVPPLVKLDPI-RVLANLSRKSAPRLQG 243

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNA 833
            Y +           A   +  CL +NP  R    DLL+ PF++ ++VT+      +K+ 
Sbjct: 244 AYSD----------AAKSFVALCLIKNPNERPAAVDLLKFPFVRFITVTN------LKHE 287

Query: 834 VKYGSDQRYVSKEKVEDLADDVWNRLS 860
           ++   + +   K     + D ++N LS
Sbjct: 288 IELVKEYKRYPKSPGHMMQDRLYNALS 314

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 99.4 bits (246), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 134/291 (46%), Gaps = 35/291 (12%)

Query: 537 YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y   + +GRG    VYK +     +I A+K V+  E  D  I+    EI  L  L+    
Sbjct: 21  YSIQDCVGRGNFGDVYKAIDKLTGEIVAIKVVNL-ESSDEDIELIAQEIFFLAELK-SPY 78

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +   I   +    +++VME CG    S ++    N     + V +  + +L+ +Q +H+ 
Sbjct: 79  ITNYITTMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQ 138

Query: 655 GIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
             +H D+K AN +    G++K+ DFG++  +        R+T +GTP +MAPE +     
Sbjct: 139 RKIHRDVKAANVLLTDDGLVKLADFGVSGQLRSTA---KRNTFVGTPYWMAPEIIS---- 191

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
               G  E+            +DIWS G  +Y+++ G PPY  +     +  I       
Sbjct: 192 NSSHGYNEK------------ADIWSLGITVYELLKGCPPYAKYDAGKVMRNI------- 232

Query: 774 VYPEKTTHGDLVPRT--ALDTIKACLERNPERRWTVDDLLRGPFIKPVSVT 822
             P+K     +V  +  A   I ACL ++P+ R T  +LL+ PF+K + +T
Sbjct: 233 --PKKNLQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQPFVKNIKIT 281

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 142/304 (46%), Gaps = 38/304 (12%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+Y  +  +G+G S  VY       + Y A+K+++ ++     +     EI ++K  + +
Sbjct: 648 SKYTDLIKIGQGASGGVYTAHDPTREGYVAIKQMNLEKQPKKEL--IINEIIVMKESKHE 705

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             +V  ID  +  G L+V+ME  +   L+ V+         +  V    +E L  +Q +H
Sbjct: 706 -NIVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTHCLLTEAQVGAV---CRETLSGLQFLH 761

Query: 653 DTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
             G++H D+K  N +  ++G +K+ DFG    +  + +N+ R T +GTP +MAPE +   
Sbjct: 762 SKGVIHRDIKSDNILLSMRGDIKLTDFGFCAQI--NELNLKRTTMVGTPYWMAPEVVSRK 819

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPE 770
            Y P              KV    DIWS G +I +MI G PPY        L L   N  
Sbjct: 820 EYGP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGT 861

Query: 771 VKIVYPEKTTHGDLVPRTALDT-IKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDL 829
             +  PE  +        AL+  +  CL+ NP+ R +  DLL  PFI  ++ ++  +  L
Sbjct: 862 PSLKEPEALSD-------ALNNFLGWCLKVNPDERASAKDLLLDPFITEIADSNESLAPL 914

Query: 830 IKNA 833
           +K A
Sbjct: 915 VKLA 918

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 131/286 (45%), Gaps = 32/286 (11%)

Query: 535 SEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S + + E++GRG    VYK       ++YA+K ++ D   D  ++  + E++ L  L+  
Sbjct: 44  SSFRRTEVIGRGKFGVVYKGYHVKTQQVYAIKVLNLDSESD-EVEDVQREVQFLSSLKQF 102

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             +++     +    L+++M+ C    +  +L        D +++    +E+L  +Q +H
Sbjct: 103 PNIIRYFGSYLKDTNLWIIMDYCAGGSIRTLLRPGK---IDEKYIGIIMREILIALQYIH 159

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              ++H D+K AN +   +G +K+ DFG+A  +  +   + R T  GTP +MAPE ++  
Sbjct: 160 KDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQL--NQTKLRRQTMAGTPYWMAPEVIMEG 217

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y   +                 +DIWS G   Y++  G PPY   +    +  I   + 
Sbjct: 218 AYYDTK-----------------ADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSK- 259

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
               P +   G     +  + I  CL+ +P+ R + ++L +  FIK
Sbjct: 260 ----PAR-LEGRSYSTSLKEFIALCLDEDPKERLSAEELQKTKFIK 300

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 135/286 (47%), Gaps = 40/286 (13%)

Query: 537 YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y   +++GRG    VY+ V+   NK  A+K++ F+  D++ ++    EI+LLK L  Q  
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFE--DESELNEHMLEIDLLKNLRHQ-N 66

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V+          LY+++E C    L  +L     +  D   V Y  Q +   +Q +H+ 
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLLEDDT--VNYVTQTLYG-LQYLHEQ 123

Query: 655 GIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K AN +  + GI+K+ DFG++       +N    T  G+PN+MAPE +     
Sbjct: 124 GVIHRDIKAANLLLTEEGIVKLADFGVST-----RINRMAMTYAGSPNWMAPEVMT---- 174

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
               GQ    +          SDIWS G  + +++ G PP+     ++   AI+N E   
Sbjct: 175 ----GQGASTV----------SDIWSLGATVVELLTGNPPFHNLVNESACYAIVNEE--- 217

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPV 819
             P  T   +       D +  C ++N  +R T  +LL   ++K +
Sbjct: 218 YIPPLTLSAE-----CKDFLSRCFQKNMFKRATAQELLAHIWLKKI 258

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score =  100 bits (249), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 146/313 (46%), Gaps = 41/313 (13%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEF-DDTSID 578
           +T +R+++II+    +++  E++G G  S V    + ++ K YA+K ++ +       + 
Sbjct: 166 KTGEREKKIIRKGIKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVK 225

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFV 637
               E   L+RL +   +VKL     +   LY ++E   + D   V+ +  ++  D    
Sbjct: 226 YVNIEKNALQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDC--T 283

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---------PDH 687
           RY++ +++  ++ +H  GI+H D+KP N +  K + +KI DFG A  +         P+ 
Sbjct: 284 RYYSAQIIDGIKYLHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEF 343

Query: 688 TVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQM 747
            +     + +GT  Y++PE L                  N   V    DIW+ GC+++QM
Sbjct: 344 NLLTRSKSFVGTAEYVSPELL------------------NDSYVDARCDIWAFGCMVFQM 385

Query: 748 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTV 807
           I G+PP   F+  N  L      +K+ Y    T G   P    D +K  L + PE+R T+
Sbjct: 386 IAGKPP---FKATNEYLTFQKV-MKVQYA--FTAG--FPVVVRDLVKRILLKVPEQRLTI 437

Query: 808 DDLLRGPFIKPVS 820
             + +  F K +S
Sbjct: 438 PQIEKHHFYKDIS 450

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score =  100 bits (249), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 91/351 (25%), Positives = 162/351 (46%), Gaps = 58/351 (16%)

Query: 526  KRQIIQVNGS-----EYE-----KVELLGRGGSSKVYK-VRSSNNKIYALKRV------S 568
            ++Q++ +N S     EY+     K E++G+G    VY  +  +  ++ A+K+V      S
Sbjct: 1193 EKQLVSINKSRNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSS 1252

Query: 569  FDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQR 627
             DE   ++++  + E+  LK L D   +V+ +  E    +  + +E      +  ++  R
Sbjct: 1253 QDEAIISTVEALRSEVSTLKDL-DHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLI--R 1309

Query: 628  ANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPD 686
                FD   +R+   ++L+ +  +H  GI+H D+K  N +  + G+ KI DFGI+    D
Sbjct: 1310 MYGRFDEPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKD 1369

Query: 687  HTVNIYRDTQI---GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCI 743
                IY ++ +   GT  +MAPE +        QG + +             DIWS GCI
Sbjct: 1370 ----IYSNSDMTMRGTVFWMAPEMVDT-----KQGYSAK------------VDIWSLGCI 1408

Query: 744  IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPER 803
            + +M  G+ P+  ++    +  I   +     P  T    L+ +   D + AC E +P+ 
Sbjct: 1409 VLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTL--PLISQNGRDFLDACFEIDPDN 1466

Query: 804  RWTVDDLLRGPFIKPVSVTHFF------IRDLIKNAVKYGSDQ-RYVSKEK 847
            R T D+LL  PF    +V  +F      +   IK+  K  S + R +S+EK
Sbjct: 1467 RPTADNLLSHPF---SAVDPYFDFKTTKLASFIKSNDKINSTKLRVISQEK 1514

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 126/286 (44%), Gaps = 40/286 (13%)

Query: 537 YEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y+ +  +G+G S  VY       N   A+K+++ ++     +     EI L+ +      
Sbjct: 667 YKNLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKEL--IINEI-LVMKASKHAN 723

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+VVME  +   L+ V+         I  V   ++E LK +Q +H  
Sbjct: 724 IVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAV---SRETLKGLQFLHSK 780

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    +  + +N+ R T +GTP +MAPE +    Y
Sbjct: 781 GVIHRDIKSDNVLLSMSGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY 838

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPE 770
            P              KV    DIWS G +I +MI G PPY        L  I     PE
Sbjct: 839 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPE 880

Query: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           +K          D +       +  CL  NP+ R T   LL  PFI
Sbjct: 881 LK--------DADSLSDDLKSFLGWCLHVNPDERATASQLLSDPFI 918

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 134/293 (45%), Gaps = 38/293 (12%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRVSF------DEFDDTSIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V        +E     ++  K E+  LK 
Sbjct: 1151 WMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKD 1210

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E+   +  + +E      +  ++  R    FD + +R+   ++L  +
Sbjct: 1211 L-DHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGL 1267

Query: 649  QVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
            + +H  GI+H D+K  N +  + GI KI DFGI+      + NIY ++ +   GT  +MA
Sbjct: 1268 KYLHSKGILHRDMKADNLLLDEDGICKISDFGISKK----SKNIYSNSDMTMRGTVFWMA 1323

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GC++ +M  G+ P+   +    + 
Sbjct: 1324 PEMV-----DTKQGYSAK------------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMF 1366

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             I   +     P+ T    L+     D +  C E +PE+R T DDLL   F K
Sbjct: 1367 QIGKSKSAPPIPDDTIQ--LISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSK 1417

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 141/322 (43%), Gaps = 69/322 (21%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQR--ANMP--FDIEFVRYHAQEMLKCVQ 649
             VV+L D       L +V E  D+DL + +  R   N P   ++  V+Y   ++++   
Sbjct: 63  DNVVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELNLVKYFQWQLMEGAA 122

Query: 650 VVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L+                          D+WSCGCI+ +M+ G+P + G   + +L  I
Sbjct: 179 VLMGSR-----------------TYSTSIDMWSCGCILAEMVTGKPLFPGTNDEEQLKLI 221

Query: 767 MN----------------PEVKIVYPEKTTHGDLVPRTALDTIKAC-------------- 796
            +                P+  + +P+K      +PR     ++ C              
Sbjct: 222 FDIMGTPNESTWPGVSSLPKFNLNFPQK------LPRDLRSILQVCSKEPLDDNLIDLLH 275

Query: 797 --LERNPERRWTVDDLLRGPFI 816
             L+ NP+ R +    L  P+ 
Sbjct: 276 GLLQLNPDMRLSAKQALHHPWF 297

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 139/294 (47%), Gaps = 46/294 (15%)

Query: 541 ELLGRGGSSKVYKVRSSNNK----IYALKRVSFDEFDDTSIDG---------FKGEIELL 587
           E LG G + KV    +   K    +  + +  F+  +++  +G          + EI ++
Sbjct: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K L +   V++L D    +  LY+V+E  +  +L  +L +R  +P + E VR   Q ++ 
Sbjct: 84  KLL-NHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPEN-EAVRAFRQ-III 140

Query: 647 CVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            +   H  G+VH DLKP N +    + +KI DFG+A    +  +    +T  G+P+Y AP
Sbjct: 141 GISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKL---LETSCGSPHYAAP 197

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QNRL 763
           E +  + Y                  G  SD+WSCG I++ ++ GR P+    G  +N L
Sbjct: 198 EIISGLPYE-----------------GFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240

Query: 764 LAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           L +   E ++  P+     D + + A D +   L  +P +R T+ ++L+ P ++
Sbjct: 241 LKVQKGEFEM--PD----DDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
            similar to Ashbya gossypii AFR092W
          Length = 1397

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 137/293 (46%), Gaps = 38/293 (12%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRV------SFDEFDDTSIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V      S D+   T+++    E+  LK 
Sbjct: 1098 WIKGEIIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDQITVTNVEALISEVSTLKN 1157

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  +G+  + +E      +  ++  R    FD + +R+  +++L+ +
Sbjct: 1158 L-DHLNIVQYLGFENKNGIYSLFLEYVAGGSVGSLI--RLYGHFDEQLIRFLTKQVLEGL 1214

Query: 649  QVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +    G+ KI D GI+      + NIY + ++   GT  +MA
Sbjct: 1215 AYLHRRGILHRDMKADNLLLDNNGVCKISDLGISR----KSNNIYSNAEMTMRGTVFWMA 1270

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GC++ +M  G+ P+   +    + 
Sbjct: 1271 PEMVDTT-----QGYSAK------------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMF 1313

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             I   +     PEKT    L+ +     I  C + +PE+R T D LL  PF +
Sbjct: 1314 QIGKSKTAPPIPEKTL--PLISKDGRVFIDDCFKIDPEKRPTADTLLSHPFCQ 1364

>KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON}
           Anc_2.496 YHL007C
          Length = 791

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 104/405 (25%), Positives = 163/405 (40%), Gaps = 85/405 (20%)

Query: 482 IRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTEN--------------GSYQTPQRKR 527
           +R AP PP  +    ++  +  +   +P  PP TE                +Y  P  KR
Sbjct: 408 LRAAPKPPGSRNESSVKTARSAMSDLLPDLPPQTEQKKVLNSHQQHTEGKNTYTFPSHKR 467

Query: 528 QIIQ-------------VNGSE----------------------YEKVELLGRGGSSKVY 552
              Q             + G E                      Y  ++ +G+G S  V+
Sbjct: 468 TETQHTDVQMGQVKQQQIAGRELQTKKFFTRLMAVCSVGDPRTIYVDLKKIGQGASGGVF 527

Query: 553 KVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYV 611
             +S+ N  Y A+K+++ ++     +     EI L+     Q  +V  ID  + +  L++
Sbjct: 528 IAKSTTNGSYVAIKQMNLEKQPKKEL--ILNEI-LVMNESRQENIVNFIDAYLLNDDLWI 584

Query: 612 VME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-V 669
           VME      L+ V+         I  V    +E LK ++ +H  G++H D+K  N +  +
Sbjct: 585 VMEYMQGGSLTDVVTYCLLSEGQIGTV---CRETLKGLRFLHSKGVLHRDIKSDNILLSL 641

Query: 670 KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRW 729
            G +K+ DFG    + D   N  R T +GTP +MAPE +    Y P              
Sbjct: 642 TGNIKVTDFGFCAQINDD--NAKRVTMVGTPYWMAPEIISRKEYGP-------------- 685

Query: 730 KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVKIVYPEKTTHGDLVPRT 788
           KV    DIWS G ++ +MI G PPY        L L   N +  +  PEK      + +T
Sbjct: 686 KV----DIWSLGIMVIEMIEGEPPYLNETPLKALYLIATNGKPSLKEPEK------LSKT 735

Query: 789 ALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNA 833
               +  CL  +P++R    DLLR PFI   S     +  L+K A
Sbjct: 736 FFLFLDKCLAVDPDKRAEATDLLRDPFITDCSDAISSLAPLVKLA 780

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 129/288 (44%), Gaps = 36/288 (12%)

Query: 535 SEYEKVELLGRGGSSKVYK---VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLE 591
           S Y++ E++GRG    VYK   +R+   +I A+K ++ D  +D  ++  + EI+ L  L+
Sbjct: 24  SIYKRTEVIGRGKFGVVYKGYHIRTK--QICAIKVLNLDTSED-EVEDVQKEIQFLSSLK 80

Query: 592 DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQV 650
               +       +    L+++ME C    L  +L        D +++    +E+L  +  
Sbjct: 81  QVPNITHYYGSYLYDTKLWIIMEYCAGGSLRTLLRPGK---IDEKYIGVIMRELLVALLY 137

Query: 651 VHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 709
           +H   ++H D+K AN +    G +K+ DFG+A  +     N+ R T  GTP +MAPE ++
Sbjct: 138 IHKDNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQS--NVRRQTMAGTPYWMAPEVIM 195

Query: 710 AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 769
              Y   +                  DIWS G   Y++  G PPY   +    +  I   
Sbjct: 196 EGVYYDTK-----------------VDIWSLGITTYEITTGNPPYCDVEALRAMQLITKS 238

Query: 770 EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           +     P +       P    + I  CL+ +P+ R   +DLL+  FIK
Sbjct: 239 K-----PPRLEGRQYSPLLK-EFIALCLDEDPKERLAAEDLLKTRFIK 280

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 134/291 (46%), Gaps = 38/291 (13%)

Query: 537  YEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDT------SIDGFKGEIELLKR 589
            + K E++G+G    VY   + +  ++ A+K+V   ++         +++  + E+  LK 
Sbjct: 1275 WMKGEMIGKGSFGAVYLCLNLTTGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKD 1334

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E +H +  + +E  G   +  ++  R    FD   +R+   ++L+ +
Sbjct: 1335 L-DHLNIVQYLGFENDHDIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLEGL 1391

Query: 649  QVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +  + G+ KI DFGI+    D    IY ++ +   GT  +MA
Sbjct: 1392 AYLHSKGILHRDMKADNLLLDLDGVCKISDFGISRKSKD----IYSNSDMTMRGTVFWMA 1447

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GC++ +M  G+ P+   +    + 
Sbjct: 1448 PEMVDT-----KQGYSAK------------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMF 1490

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPF 815
             I   +     PE T    L+ +     + AC E +P+ R T D LL  PF
Sbjct: 1491 KIGKNKSAPPIPEDTL--PLISQDGRQFLNACFEIDPDLRPTADKLLSHPF 1539

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 134/284 (47%), Gaps = 26/284 (9%)

Query: 539 KVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVV 597
           K E++G+G  + V K +     K +A+K +S  +     +DG   E+E+L+RL D  R+V
Sbjct: 190 KDEVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGV-MDGVARELEVLQRL-DHPRIV 247

Query: 598 KLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGI 656
            L     +    Y+VME     DL   +A   ++  D    R   +++L+ V+ +H  GI
Sbjct: 248 SLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVKYIHSMGI 305

Query: 657 VHSDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            H DLKP N +  +    ++KI DFG+A    + T   +  T  GT  Y+APE +   N 
Sbjct: 306 SHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGT---FMKTFCGTLAYVAPEVISGKNS 362

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
              +G T   +           D+WS GC++Y ++ G  P+ G   QN L   +      
Sbjct: 363 GEKEGNTYSSL----------VDMWSIGCLVYVILTGHLPFSG-STQNDLYKQITAG--- 408

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            Y E       +   A D I++ L+ +P  R T +  LR P+IK
Sbjct: 409 SYHEGPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047W
           (REAL)
          Length = 895

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 90/350 (25%), Positives = 147/350 (42%), Gaps = 64/350 (18%)

Query: 508 IPLKPPSTENGSYQTPQRKRQI-----------IQVNGSEYEKVELLGRGGSSKVYKVRS 556
            P +PP  +   +Q P+R R++           I V    +EKV LLG+G   KV+ VR 
Sbjct: 459 FPQEPP-PKISDFQEPRRSRRLRTKSFSNKFQDIMVGPQSFEKVRLLGQGDVGKVFLVRE 517

Query: 557 -SNNKIYALKRVSFDEF-DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME 614
              N++YALK +S DE      I     E E+L    +   +V L     +   LY+ ME
Sbjct: 518 KKTNRVYALKVLSKDEMIKRNKIKRVLTEQEILA-TSNHPFIVTLYHSFQSEDYLYLCME 576

Query: 615 -CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GI 672
            C   +  + L  R       +  R++A E+   ++ +H  G ++ DLKP N +  + G 
Sbjct: 577 YCMGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGH 636

Query: 673 LKIIDFGIANAVPDHTVNIYR--------DTQI-----------GTPNYMAPEALVAMNY 713
           + + DF ++    D  V + +        DT+I           GT  Y+APE +    +
Sbjct: 637 IMLSDFDLSIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGH 696

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
           T                     D W+ G ++Y+M++G  P+ G         I+  EV  
Sbjct: 697 T------------------AAVDWWTLGILVYEMLFGFTPFKGDNTNETFTNILKNEVS- 737

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVD----DLLRGPFIKPV 819
            +P    + + + RT  D I+  L +N  +R        D+ + PF K V
Sbjct: 738 -FP----NNNEISRTCKDLIRKLLTKNESKRLGCKMGAADVKKHPFFKKV 782

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 89/303 (29%), Positives = 140/303 (46%), Gaps = 40/303 (13%)

Query: 537  YEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
            Y  +  +G+G S  VY       N   A+K+++ ++   T +     EI ++K  + +  
Sbjct: 1027 YRNLVKIGQGASGGVYTAYEVGTNASVAVKQMNLEKQPKTEL--IINEIIVMKESKHK-N 1083

Query: 596  VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
            +V  ID  +  G L+VVME  +   L+ V+         I  V    +E L  ++ +H  
Sbjct: 1084 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLNGLKFLHSK 1140

Query: 655  GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            G++H D+K  N +  ++G +K+ DFG    +  + V++ R T +GTP +MAPE +    Y
Sbjct: 1141 GVIHRDIKSDNILLSMQGDIKLTDFGFCAQI--NEVHLKRTTMVGTPYWMAPEVVSRKEY 1198

Query: 714  TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPE 770
             P              KV    DIWS G +I +MI G PPY        L  I     PE
Sbjct: 1199 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPE 1240

Query: 771  VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLI 830
            +K   PEK +    +    LD   ACL+ +PE R T  +LL    I  V+  +  +  L+
Sbjct: 1241 LK--EPEKLSS---ILHNFLD---ACLKVDPEVRATATELLETELITEVASENISLAPLV 1292

Query: 831  KNA 833
            K A
Sbjct: 1293 KVA 1295

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 136/300 (45%), Gaps = 36/300 (12%)

Query: 537 YEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           + + E++GRG    VYK      K +YA+K +S  E D   +   + EI+ L  L+    
Sbjct: 42  FRRTEIIGRGKFGVVYKGYHMKTKGVYAIKVLSL-ESDLDEVADIQREIQFLVSLKQVPN 100

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           + +     +    L+++ME C    +  +L        D +++    +E+L  +  +H  
Sbjct: 101 ITRYYASYLKDTSLWIIMEYCAGGSVRTLLRPGK---IDEKYIAVIMRELLVALHYIHKD 157

Query: 655 GIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV-AMN 712
            ++H D+K AN +   +G +K+ DFG+A  +  +T  + R T  GTP +MAPE ++  ++
Sbjct: 158 NVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNT--MRRQTMAGTPYWMAPEVIMEGIS 215

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
           Y                     +DIWS G   Y++  G PP+   +    +  I   + K
Sbjct: 216 Y------------------DTKADIWSVGITAYEIATGNPPFCEMEALRAMQVI--SKSK 255

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLL-RGPFIKPVSVTHF-FIRDLI 830
               E   H  L+     + I  CL+ +P+ R T D LL    FIK    TH   +++LI
Sbjct: 256 PARLEGKNHDPLLK----EFIAMCLDEDPQERPTADKLLHESAFIKHYKNTHTSVLKELI 311

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/319 (27%), Positives = 145/319 (45%), Gaps = 33/319 (10%)

Query: 512 PPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALK----R 566
           P S+    YQ      ++  ++        ++G+G  + V K V  S  K +A+K    R
Sbjct: 167 PASSSKSKYQISMGHTELKGIHKYYSISDSIVGQGAFATVKKAVERSTGKTFAVKIIHKR 226

Query: 567 VSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLA 625
              D+FD     G K E+++L++L +  R+VKL D   ++   Y++ME     DL   +A
Sbjct: 227 KVMDKFD-----GVKRELDVLQKL-NHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVA 280

Query: 626 QRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG---ILKIIDFGIAN 682
               +  D    R   +++L+ V+ +HD GI H DLKP N +  +    ++KI DFG+A 
Sbjct: 281 AHGTVGEDAG--REITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAK 338

Query: 683 AVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGC 742
                  N + +T  GT  Y+APE +   N          E + NR       D+WS GC
Sbjct: 339 V---QNQNTFLNTFCGTLAYVAPEVIDGKN---------AEDKTNRDLYSSLVDMWSIGC 386

Query: 743 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPE 802
           ++Y ++ G  P+ G Q QN L   +    +  Y E       +   A + I   L  +P+
Sbjct: 387 LVYVILTGHLPFSG-QSQNELFKQIK---RGSYHEGPLKDYRISEEARNFIDCLLNVDPK 442

Query: 803 RRWTVDDLLRGPFIKPVSV 821
            R      L+ P++K   V
Sbjct: 443 ERMNAGKALQHPWMKMAYV 461

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 142/327 (43%), Gaps = 51/327 (15%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSN-NKIYALKRVSFDEF-DDTSIDGFKGE 583
           K Q I V    +EK+ LLG+G   KVY VR  + N+I+ALK +S  E      I     E
Sbjct: 309 KFQDITVEPQSFEKIRLLGQGDVGKVYLVRERDTNQIFALKVLSKHEMIKRKKIKRVLTE 368

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L    D   +V L         LY+ ME C   +  + L  R +     E  +++A 
Sbjct: 369 QEILA-TSDHPFIVTLYHSFQTEDFLYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYAS 427

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGI---ANAVPDHTV--NIYRDTQ 696
           E++  ++ +H  G ++ DLKP N +  + G + + DF +   A    D T+  + Y DT+
Sbjct: 428 EVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSRDPTMKDSTYLDTK 487

Query: 697 I-----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIY 745
           +           GT  Y+APE +    +T                     D W+ G ++Y
Sbjct: 488 VCSDGFRTNSFVGTEEYLAPEVIRGNGHTA------------------AVDWWTLGILVY 529

Query: 746 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERR- 804
           +M++G  P+ G         I+  +VK  +P    H   + +   D IK  L +N  +R 
Sbjct: 530 EMLFGCTPFKGDNSNETFSKILTEDVK--FP----HDKEISKHCKDLIKRLLNKNESKRL 583

Query: 805 ---WTVDDLLRGPFIKPVSVTHFFIRD 828
                  D+ R PF K V  +  F+R+
Sbjct: 584 GSKLGASDIKRHPFFKKVQWS--FLRN 608

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 127/286 (44%), Gaps = 40/286 (13%)

Query: 537 YEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y+ +  +G+G S  VY       N   A+K+++ ++     +     EI L+ +      
Sbjct: 666 YKSLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKEL--IINEI-LVMKASKHAN 722

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+VVME  +   L+ V+         I  V   ++E LK +Q +H  
Sbjct: 723 IVNFIDSYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAV---SRETLKGLQFLHSK 779

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    +  + +N+ R T +GTP +MAPE +    Y
Sbjct: 780 GVIHRDIKSDNILLSMTGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY 837

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPE 770
            P              KV    DIWS G +I +MI G PPY        L  I     PE
Sbjct: 838 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPE 879

Query: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           +K          D +       +  CL  +P+ R T  +LL  PFI
Sbjct: 880 LK--------DADSLSDDLKGFLGWCLHVDPDERATASELLSDPFI 917

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 139/296 (46%), Gaps = 48/296 (16%)

Query: 541 ELLGRGGSSKV-YKVRSSNNKIYALKRVSFDEFDDTSID--------------GFKGEIE 585
           E LG G + KV     SS  +  A+K +S   F++ + +              G + EI 
Sbjct: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANASDSALLTPDSLPYGIEREII 83

Query: 586 LLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEM 644
           ++K L +   V++L D       LY+V+E  +  +L  +L +R  +P + E +R+  Q +
Sbjct: 84  IMKLL-NHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN-EAIRFFRQ-I 140

Query: 645 LKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYM 703
           +  +   H  GIVH DLKP N +   K  +KI DFG+A      T +   +T  G+P+Y 
Sbjct: 141 IIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLETSCGSPHYA 197

Query: 704 APEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QN 761
           APE +  + Y                  G  +D+WSCG I++ ++ GR P+    G  +N
Sbjct: 198 APEIISGLPYH-----------------GLETDVWSCGIILFALLTGRLPFDEEDGNIRN 240

Query: 762 RLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            LL + + + ++         D + R A D I   L  +P++R    ++L+ P ++
Sbjct: 241 LLLKVQSGQFEM------PGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 145/312 (46%), Gaps = 48/312 (15%)

Query: 526  KRQIIQVNGS-----EYE-----KVELLGRGGSSKVYK-VRSSNNKIYALKRV------S 568
            ++Q++ +N S     EY+     K E++G+G    VY  +  +  ++ A+K+V      S
Sbjct: 1233 EKQMVSINKSKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSS 1292

Query: 569  FDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQR 627
             DE   +++D  K E+  LK L D   +V+ +  E    +  + +E      +  ++  R
Sbjct: 1293 QDEAIMSTVDAIKSEVSTLKDL-DHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLI--R 1349

Query: 628  ANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPD 686
                FD   +R+   ++L+ +  +H  GI+H D+K  N +  + G+ KI DFGI+    D
Sbjct: 1350 IYGRFDEPLIRHLNIQVLRGLAYLHARGILHRDMKADNLLLDQDGVCKISDFGISRKSKD 1409

Query: 687  HTVNIYRDTQI---GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCI 743
                IY ++ +   GT  +MAPE +        QG + +             DIWS GCI
Sbjct: 1410 ----IYSNSDMTMRGTVFWMAPEMVDT-----KQGYSAK------------VDIWSLGCI 1448

Query: 744  IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPER 803
            + +M  G+ P+  F+    +  I   +     PE T    L+     + + AC E +P++
Sbjct: 1449 VLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPEDTL--PLISAEGREFLDACFEIDPDK 1506

Query: 804  RWTVDDLLRGPF 815
            R T D+LL   F
Sbjct: 1507 RPTADELLYHTF 1518

>YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/Thr
           protein kinase that regulates the putative phospholipid
           translocases Lem3p-Dnf1p/Dnf2p; phosphorylates and
           inhibits upstream inhibitory kinase, Ypk1p; localizes to
           the cytoplasm, early endosome/TGN compartments, and
           plasma membrane
          Length = 893

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/321 (26%), Positives = 136/321 (42%), Gaps = 52/321 (16%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRSS-NNKIYALKRVSFDEF-DDTSIDGFKGE 583
           K Q I V    +EK+ LLG+G   KV+ VR    N++YALK +S DE      I     E
Sbjct: 485 KFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEMIKRNKIKRVLTE 544

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L    +   +V L     +   LY+ ME C   +  + L  R       +  R++A 
Sbjct: 545 QEILA-TSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCICEDDARFYAS 603

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYR-------- 693
           E+   ++ +H  G ++ DLKP N +  + G + + DF ++    D  V + +        
Sbjct: 604 EVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDSKVPVVKGSAQSTLV 663

Query: 694 DTQI-----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGC 742
           DT+I           GT  Y+APE +    +T                     D W+ G 
Sbjct: 664 DTKICSDGFRTNSFVGTEEYIAPEVIRGNGHT------------------AAVDWWTLGI 705

Query: 743 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPE 802
           +IY+M++G  P+ G         I+  EV   +P    + + + RT  D IK  L +N  
Sbjct: 706 LIYEMLFGFTPFKGDNTNETFTNILKNEVS--FP----NNNEISRTCKDLIKKLLTKNES 759

Query: 803 RRWTVD----DLLRGPFIKPV 819
           +R        D+ + PF K V
Sbjct: 760 KRLGCKMGAADVKKHPFFKKV 780

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 87/301 (28%), Positives = 135/301 (44%), Gaps = 36/301 (11%)

Query: 537 YEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y  +  +G+G S  VY       N   A+K+++ ++     +     EI L+ +    + 
Sbjct: 329 YRNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKEL--IINEI-LVMKGSKHSN 385

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+VVME  +   L+ V+         I  V    +E LK +Q +H  
Sbjct: 386 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLKGLQFLHSK 442

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    +  + VN+ R T +GTP +MAPE +    Y
Sbjct: 443 GVIHRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVNLKRTTMVGTPYWMAPEVVSRKEY 500

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 772
            P              KV    DIWS G +I +MI G PPY        L L   N   K
Sbjct: 501 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 542

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKN 832
           +  PE  +       T  + +  CL+ +PE R    +LL G FI   +  +  +  L+K 
Sbjct: 543 LKDPENLSD------TLKEFLGWCLKVDPEDRANAAELLSGTFISTYAEKNECLAPLVKL 596

Query: 833 A 833
           A
Sbjct: 597 A 597

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 97/357 (27%), Positives = 152/357 (42%), Gaps = 65/357 (18%)

Query: 508 IPLK-PPSTENGSYQTPQRKRQI-----------IQVNGSEYEKVELLGRGGSSKVYKVR 555
           I LK PPS   G    P+R R++           I V    +EK+ LLG+G   KVY VR
Sbjct: 285 IALKQPPSL--GDIVEPRRSRRLRTKSFGNKFQDITVEPQSFEKIRLLGQGDVGKVYLVR 342

Query: 556 SSN-NKIYALKRVSFDEF-DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVM 613
             + N+I+ALK ++  E      I     E E+L    D   +V L         LY+ M
Sbjct: 343 ERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILA-TSDHPFIVTLYHSFQTKDYLYLCM 401

Query: 614 E-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-G 671
           E C   +  + L  R +     E  +++A E++  ++ +H  G ++ DLKP N +  + G
Sbjct: 402 EYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSG 461

Query: 672 ILKIIDFGIA-----NAVPDHTVNIYRDTQI-----------GTPNYMAPEALVAMNYTP 715
            + + DF ++     +  P    + Y DT+I           GT  Y+APE +    +T 
Sbjct: 462 HVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVIRGNGHT- 520

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
                               D W+ G +IY+M++G  P+ G         I+  +VK  +
Sbjct: 521 -----------------AAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVK--F 561

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRW----TVDDLLRGPFIKPVSVTHFFIRD 828
           P    H   V +   D IK  L +N  +R        D+ R PF K V  +  F+R+
Sbjct: 562 P----HDKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWS--FLRN 612

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 116/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ +++R  + KI+A K V+       SI   K   +LL 
Sbjct: 87  LIKTRGRDYHRGHFLGEGGFARCFQIRDDSGKIFAAKTVA-----KISIKSEKTRKKLLS 141

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ ID   +   +Y+++E C +  L  +L +R ++  + E VR+   
Sbjct: 142 EIQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLT-EPE-VRFFTT 199

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F +   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 200 QICGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKY--TVCGTPN 257

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G +IY +I GRPP+
Sbjct: 258 YIAPEVLMGKH----SGHSYE------------VDIWSIGVMIYALIIGRPPF 294

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 140/303 (46%), Gaps = 38/303 (12%)

Query: 527 RQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEF-DDTSIDGFKGEI 584
           R +I+    ++   E+LG G  S V   RS+++ K YA+K ++ +       +     E 
Sbjct: 148 RHVIKKGIKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEK 207

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFVRYHAQE 643
             L+RL D   V+KL     +   LY ++E   + D   V+ +  ++    E   Y++ +
Sbjct: 208 NTLQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSL--SQECAVYYSAQ 265

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPD----HTVNIYRDTQ-- 696
           +L  +  +H  GIVH D+KP N +  K + +K+ DFG A  +       T N+   ++  
Sbjct: 266 ILDAIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSF 325

Query: 697 IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
           +GT  Y++PE L+  NY                 V    DIW+ GCI++QMI G+PP   
Sbjct: 326 VGTAEYVSPE-LLNDNY-----------------VDYKCDIWAFGCILFQMIAGKPP--- 364

Query: 757 FQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           F+  N  L      +K+ Y    T G   P    D IK  L ++PE+R     + +  F 
Sbjct: 365 FKATNEYLTFQK-VMKVQY--AFTAG--FPLVIRDLIKKILVKSPEQRLDASQIKKHHFF 419

Query: 817 KPV 819
           K V
Sbjct: 420 KDV 422

>Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON}
           (12601..15534) [2934 nt, 978 aa]
          Length = 977

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 148/321 (46%), Gaps = 48/321 (14%)

Query: 506 TTIP-LKPPSTENGSYQTPQRKRQIIQVN-GSEYEKVELLGRGGSSKVYK-VRSSNNKIY 562
           T IP L  PSTE  S +  Q    + Q     +Y+   ++G+G    VYK V    N++ 
Sbjct: 30  TAIPILGTPSTEVESIKETQEASAVKQSQPRIQYQLKAVIGKGSFGVVYKAVNRKTNQVV 89

Query: 563 ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLS 621
           A+K V++D  +D  ++    EI LLK L +   +VK          LY+++E C    L 
Sbjct: 90  AIKEVNYD--NDEELNDIMSEIHLLKNL-NHVNIVKYHGFIQKMDTLYIILEYCSRGSLK 146

Query: 622 QVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGI 680
           ++++    +P +IE  + + ++ L+ +  +H+ G++H D+K AN +     ++K+ DFG+
Sbjct: 147 KLISPNRGIP-EIE-AQSYIRQTLQGLSYLHEQGVIHRDIKSANLLLDSSNVVKLADFGV 204

Query: 681 ANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSC 740
           +  V + ++ +   T  G+ N+MAPE                 I  NR      SDIWS 
Sbjct: 205 STKVNNASMAM---TLAGSLNWMAPE-----------------IIGNR-GASTLSDIWSL 243

Query: 741 GCIIYQMIYGRPPYGGFQGQNRLLAIMN-----PEVKIVYPEKTTHGDLVPRTALDTIKA 795
           G  + +++ G PP+      N   AI N     PE K            V   A + +  
Sbjct: 244 GATVVELLTGNPPFHNLVDVNIYYAIENDTYLPPENK------------VSHVAANFLSC 291

Query: 796 CLERNPERRWTVDDLLRGPFI 816
           C ++N   R T   LL+  ++
Sbjct: 292 CFQKNMYLRPTAKQLLQHEWL 312

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 139/294 (47%), Gaps = 46/294 (15%)

Query: 541 ELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSID------------GFKGEIELL 587
           E LG G + KV    + +  K  A+K +S   F++ S              G + EI ++
Sbjct: 22  ETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGIEREIIIM 81

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K L +   V++L D    +  LY+V+E  +  +L  +L ++  +  + E +R+  Q ++ 
Sbjct: 82  KLL-NHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQ-EQEAIRFFRQ-III 138

Query: 647 CVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            +   H  GIVH DLKP N +   K  +KI DFG+A      T +   +T  G+P+Y AP
Sbjct: 139 GISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLETSCGSPHYAAP 195

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QNRL 763
           E +  + Y                  G  SD+WSCG I++ ++ GR P+    G  +N L
Sbjct: 196 EIVSGIPYH-----------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRNLL 238

Query: 764 LAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           L + + E ++   ++ +H       A D +   L  +PE+R    D+L+ P ++
Sbjct: 239 LKVQSGEFEMPSDDEISH------EAQDLLAKILTVDPEKRIRARDILKHPLLQ 286

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 131/286 (45%), Gaps = 32/286 (11%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S +++ E++G G    VYK   +  K +YA+K ++ D  D+  ++  + E++ L  ++  
Sbjct: 27  SVFKRTEVIGTGKFGVVYKGHHARTKQVYAIKVLNLDS-DEDEVEDVQREVQFLASMKQT 85

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             +       +    L++++E C    L  +L        D +++    +E+L  ++ +H
Sbjct: 86  PNITHYYGSYLKDTTLWIIIEYCAGGSLRTLLRPGK---IDEKYIGIIMREVLIALKYIH 142

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              ++H D+K AN +   +G +K+ DFG+A  +  +  ++ R T  GTP +MAPE ++  
Sbjct: 143 KDNVIHRDIKAANVLITNEGHVKLCDFGVAAQL--NQSSLKRQTMAGTPYWMAPEVIM-- 198

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
                      E      KV    DIWS G   Y++  G PPY   +    +  I   + 
Sbjct: 199 -----------EGVSYDTKV----DIWSLGITTYEIATGNPPYCDVEALRAMQLITKSK- 242

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
               P +       P    + I  CL+ +P+ R + DDLL+   IK
Sbjct: 243 ----PPRLEGRHYSPMLK-EFIALCLDEDPKERLSADDLLKSKLIK 283

>Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047W
           (REAL)
          Length = 897

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 89/350 (25%), Positives = 147/350 (42%), Gaps = 64/350 (18%)

Query: 508 IPLKPPSTENGSYQTPQRKRQI-----------IQVNGSEYEKVELLGRGGSSKVYKVRS 556
            P +PP  +   +Q P+R R++           I V    +EK+ LLG+G   KV+ VR 
Sbjct: 461 FPQEPP-PKISDFQEPRRSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVRE 519

Query: 557 S-NNKIYALKRVSFDEF-DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME 614
              N++YALK +S +E      I     E E+L    +   +V L     +   LY+ ME
Sbjct: 520 KKTNRVYALKVLSKEEMIKRNKIKRVLTEQEILA-TSNHPFIVTLYHSFQSEDYLYLCME 578

Query: 615 -CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GI 672
            C   +  + L  R       +  R++A E+   ++ +H  G ++ DLKP N +  + G 
Sbjct: 579 YCMGGEFFRALQTRETKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGH 638

Query: 673 LKIIDFGIANAVPDHTVNIYR--------DTQI-----------GTPNYMAPEALVAMNY 713
           + + DF ++    D  + + +        DT+I           GT  Y+APE +    +
Sbjct: 639 IMLSDFDLSIQAKDSKIPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGH 698

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
           T                     D W+ G +IY+M++G  P+ G         I+  EV  
Sbjct: 699 T------------------AAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVS- 739

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVD----DLLRGPFIKPV 819
            +P    + + + RT  D IK  L +N  +R        D+ + PF K V
Sbjct: 740 -FP----NNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFFKKV 784

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 129/284 (45%), Gaps = 34/284 (11%)

Query: 537 YEKVELLGRGGSSKV-YKVRSSNNKIYALKRVSFDEFDDTSIDG-FKGEIELLKRLEDQT 594
           Y+ V+ LG G   KV     S+  +  ALK ++      + + G  + EI  L RL    
Sbjct: 30  YQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGRIEREISYL-RLLRHP 88

Query: 595 RVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
            ++KL D   +   + +V+E  DH+L   + QR  M  + E  R+  Q+++  V+  H  
Sbjct: 89  HIIKLYDVIKSKDEIIMVIEYADHELFDYIVQREKMSEN-EGRRFF-QQIISAVEYCHRH 146

Query: 655 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            IVH DLKP N +  +   +KI DFG++N + D     +  T  G+PNY APE +    Y
Sbjct: 147 KIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGN---FLKTSCGSPNYAAPEVISGKLY 203

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
                             G   D+WSCG I+Y ++  R P+   +    L   +N  V  
Sbjct: 204 A-----------------GPEVDVWSCGVILYVLLCRRLPFDD-ESIPTLFKNINNGVYT 245

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           + P   + G      A   IK  L  NP  R T+ D+++ P+ K
Sbjct: 246 I-PNFLSEG------AASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 98.2 bits (243), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 134/294 (45%), Gaps = 46/294 (15%)

Query: 539  KVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEFDDT------SIDGFKGEIELLKRLE 591
            K E++G+G    VY  +  +  ++ A+K+V   ++         +++  + E+  LK L 
Sbjct: 1126 KGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNL- 1184

Query: 592  DQTRVVKLIDHE----MNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKC 647
            D   +V+ +  E    MN   L  V       L ++  +     FD   +++   ++L+ 
Sbjct: 1185 DHLNIVQYLGFEAKDHMNSLFLEYVAGGSVGSLIRMYGR-----FDEVMIKHLTTQVLRG 1239

Query: 648  VQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYM 703
            +  +H  GI+H D+K  N +   +G+ KI DFGI+    D    IY ++++   GT  +M
Sbjct: 1240 LSYLHSRGILHRDMKADNLLLDQEGVCKISDFGISRKSKD----IYSNSEMTMRGTVFWM 1295

Query: 704  APEAL-VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  A  Y+               KV    DIWS GC++ +M  G+ P+   +    
Sbjct: 1296 APEMVDTAQGYSA--------------KV----DIWSMGCVVLEMFAGKRPWSNLEVVAA 1337

Query: 763  LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
            +  I   +     PE T    L+ ++  D I AC + +PE R T D  L  PFI
Sbjct: 1338 MFKIGKSKSAPPIPEDTL--PLISQSGRDFIDACFQIDPEARPTADKQLSHPFI 1389

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 137/301 (45%), Gaps = 38/301 (12%)

Query: 527 RQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF-DDTSIDGFKGEI 584
           R +I+    +++  E+LG G  S V   RS  + K YA+K ++ +       +     E 
Sbjct: 153 RHVIKKGIKDFKFGEVLGDGSYSTVMLARSIDSGKKYAVKVLNKEYLIRQKKVKYVNIEK 212

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFVRYHAQE 643
             L+RL D   ++KL     +   LY ++E   + D   V+ +  ++  D     Y++ +
Sbjct: 213 NTLQRLNDGRGIIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKYGSLNQDCSV--YYSAQ 270

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAV-PDHTVNIYR-----DTQ 696
           +L  +  +H  G++H D+KP N +  K + +K+ DFG A  V  D T   Y       + 
Sbjct: 271 ILDAIDYLHQKGVIHRDIKPENILLDKDMKVKLTDFGTAKLVEKDETTQTYNLLERSKSF 330

Query: 697 IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
           +GT  Y++PE L+  NY                 V    DIW+ GCI++QMI G+PP   
Sbjct: 331 VGTAEYVSPE-LLNDNY-----------------VDYKCDIWAFGCILFQMIAGKPP--- 369

Query: 757 FQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           F+  N  L      +K+ Y    T G   P    D IK  L +NPE+R     + +  F 
Sbjct: 370 FKATNEYLTFQK-VMKVQY--AFTAG--FPLIIRDLIKQILVKNPEQRLDTLQVKKHHFF 424

Query: 817 K 817
           K
Sbjct: 425 K 425

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 90/337 (26%), Positives = 155/337 (45%), Gaps = 70/337 (20%)

Query: 511 KPPSTENGSYQTPQRKRQ-------------IIQVNGSEYEKVELLGRGGSSKVYKVRSS 557
           K P   N  ++ P +K++             +I+  G +Y +   LG GG ++ ++++  
Sbjct: 38  KRPDHNNDQHRQPAQKKKKEKLSALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQMKDD 97

Query: 558 NNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLE-----DQTRVVKLIDHEMNHGVLYVV 612
           + KI+A K V+       SI   K   +LL  ++         +V+ ID   +   +Y++
Sbjct: 98  SGKIFAAKTVA-----KISIKSEKTRKKLLSEIQIHKSMKHPNIVQFIDCFEDDTNVYIL 152

Query: 613 ME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG 671
           +E C +  L  +L +R  +  + E VRY   +++  ++ +H+  ++H DLK  N  F   
Sbjct: 153 LEICPNGSLMDLLKKRKVLT-EPE-VRYFTTQIVGAIKYMHNRRVIHRDLKLGNIFFDSN 210

Query: 672 I-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWK 730
             LKI DFG+A  + +     Y  T  GTPNY+APE L   +     G + +        
Sbjct: 211 YNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLAGKH----SGHSYE-------- 256

Query: 731 VGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLV-PR-- 787
                DIWS G +IY ++ G+PP   FQ +         EV I+Y E+   GD + PR  
Sbjct: 257 ----VDIWSIGVMIYALLIGKPP---FQAK---------EVNIIY-ERIKSGDYIFPREK 299

Query: 788 ----TALDTIKACLERNPERRWTVDDLL-----RGPF 815
                 +  I+  L  +P  R ++D+++     RG F
Sbjct: 300 PTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIF 336

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 141/284 (49%), Gaps = 24/284 (8%)

Query: 539 KVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVV 597
           K E++G+G  + V K V     K +A+K +S  +    +IDG   E+E+L+RL +  R+V
Sbjct: 190 KDEVVGQGAFAIVKKAVERKTGKTFAVKIISKRKVM-GNIDGVTRELEVLRRL-NHPRIV 247

Query: 598 KLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGI 656
           +L     +    Y++ME     DL   +A   ++  D    R   +++L+ V+ +H  GI
Sbjct: 248 RLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITKQVLEAVKYIHGMGI 305

Query: 657 VHSDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            H DLKP N +  +    ++KI DFG+A    + T   +  T  GT  Y+APE +     
Sbjct: 306 SHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGT---FMKTFCGTLAYVAPEVI----- 357

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
               G+  ++  QN+ K     D+WS GC++Y ++ G  P+ G   Q++L   ++   + 
Sbjct: 358 ---SGKNSEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPFSG-STQDQLYKQIS---RG 410

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            Y E       +   A + I + L+ NP+ R T +  L  P+IK
Sbjct: 411 SYHEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 bp,
           323 aa] {ON} Anc_8.482
          Length = 323

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 116/231 (50%), Gaps = 33/231 (14%)

Query: 535 SEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK +  S     ALK V  D  + T     + EI L+K L+ +
Sbjct: 6   SQFKQLEKLGNGTYATVYKGLNKSTGAFVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 64

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRA--NMP--FDIEFVRYHAQEMLKCVQ 649
             +V+L D       L +V E  D+DL + +  ++  N P   ++  V+Y   ++ + + 
Sbjct: 65  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSQSTGNTPRGLELNLVKYFQWQLFEGLA 123

Query: 650 VVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANA--VPDHTVNIYRDTQIGTPNYMAPE 706
             H+  I+H DLKP N +   KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 124 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 179

Query: 707 ALV-AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            L+ +  YT                     DIWSCGCI+ +MI G+  + G
Sbjct: 180 VLMGSRTYTTS------------------IDIWSCGCILAEMITGKALFPG 212

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 114/247 (46%), Gaps = 34/247 (13%)

Query: 573 DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMP 631
           D+++  G + EI ++K L     V+ L +   N   LY+V+E  D  +L   L  +  + 
Sbjct: 200 DNSNRYGIEREIVIMK-LVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLT 258

Query: 632 FDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPDHTV 689
            ++E VRY  Q +++ VQ  H   I H DLKP N +  K   ++KI DFG+A        
Sbjct: 259 -ELEAVRYFKQ-IIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAAL---QVS 313

Query: 690 NIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIY 749
           N    T  G+P+Y +PE ++   Y                  G PSD+WSCG I++ ++ 
Sbjct: 314 NTLLKTSCGSPHYASPEIVMGKTYN-----------------GGPSDVWSCGIILFALLT 356

Query: 750 GRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDD 809
           G  P+     +  L+ + N   ++         + + + A D I   L  NP+ R T + 
Sbjct: 357 GHLPFNDDSIKKLLIKVQNGRYQM--------PNYLSKDAKDLISRILLVNPKARLTTEQ 408

Query: 810 LLRGPFI 816
           +L  P I
Sbjct: 409 ILEHPLI 415

>TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.371
           YCR091W
          Length = 730

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 86/315 (27%), Positives = 133/315 (42%), Gaps = 53/315 (16%)

Query: 530 IQVNGSEYEKVELLGRGGSSKVYKVRSS-NNKIYALKRVSFDEF-DDTSIDGFKGEIELL 587
           I+V    +EKV LLG+G   KVY VR    NK++ALK +S  E      +     E E+L
Sbjct: 327 IKVGPKSFEKVRLLGQGDIGKVYLVREKKTNKLFALKILSKSEMIKRKKVRRILTEQEIL 386

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLK 646
               D   +V L         LY+ ME C   +  + L  R N        R++A E++ 
Sbjct: 387 A-TSDHPFIVTLYHTFQTKTYLYICMEYCMGGEFFRALQTRENKCISENAARFYASEVVA 445

Query: 647 CVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIA--------NAVPDHTVNIYRDTQ- 696
            ++ +H  G ++ DLKP N +  K G + + DF ++          +   T N Y DT+ 
Sbjct: 446 ALEYLHLLGFIYRDLKPENILLHKSGHIMLADFDLSIQSQSDSEPVIDSLTNNAYIDTKK 505

Query: 697 ----------IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQ 746
                     +GT  Y+APE +    +T                     D W+ G ++Y+
Sbjct: 506 ISEGFRTNSFVGTEEYIAPEVIRGNGHTT------------------AVDWWTLGILVYE 547

Query: 747 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRW- 805
           M+YG  P   F+G+N      N    I+  + +  G  + +T  D IK  L +N  +R  
Sbjct: 548 MLYGYSP---FKGRNTNETFSN----IIKEQVSFQGHDISKTGKDLIKKLLIKNEIKRLG 600

Query: 806 ---TVDDLLRGPFIK 817
                 D+   PF K
Sbjct: 601 SKQGAADIKSHPFFK 615

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 97.4 bits (241), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 85/295 (28%), Positives = 135/295 (45%), Gaps = 45/295 (15%)

Query: 541 ELLGRGGSSKV-YKVRSSNNKIYALKRVSFDEFD------DTSID---------GFKGEI 584
           E LG G + KV      S N+  A+K +S   F+      D+S+          G + EI
Sbjct: 24  ETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDSLPYGIEREI 83

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQE 643
            ++K L +   V++L D    +  LY+V+E     +L  +L +R  +P + E +R+  Q 
Sbjct: 84  IIMKLL-NHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP-EKEAIRFFRQ- 140

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNY 702
           ++  +   H  GIVH DLKP N +   K  +KI DFG+A      T +   +T  G+P+Y
Sbjct: 141 IVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ETEDKLLETSCGSPHY 197

Query: 703 MAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  + Y                  G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 198 AAPEIVSGIPYH-----------------GFASDVWSCGVILFALLTGRLPFDDEDGNIR 240

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            L +     +   P      D +   A D I   L  +PE+R    D+L+ P ++
Sbjct: 241 NLLLQVQSGRYEMP----GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 97.4 bits (241), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 131/291 (45%), Gaps = 38/291 (13%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEFDDT------SIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V   ++         +++  + E+  LK 
Sbjct: 1178 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKD 1237

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  + +  + +E      +  ++  R    FD   +R+   ++LK +
Sbjct: 1238 L-DHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGL 1294

Query: 649  QVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +  + GI KI DFGI+    D    IY ++ +   GT  +MA
Sbjct: 1295 AYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKD----IYSNSDMTMRGTVFWMA 1350

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GCI+ +M  G+ P+   +    + 
Sbjct: 1351 PEMVDT-----KQGYSAK------------VDIWSLGCIVLEMFAGKRPWSNLEVVAAMF 1393

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPF 815
             I   +     PE T    L+ +     + AC E NPE R T  +LL   F
Sbjct: 1394 KIGKSKSAPPIPEDTL--PLISQVGRSFLDACFEINPEERPTATELLSHQF 1442

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 116/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + KI+A K V+       SI   K   +LL 
Sbjct: 83  LIKTRGRDYHRGHFLGEGGFARCFQIKDESGKIFAAKTVA-----KISIKSEKTRKKLLS 137

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         VV+ ID   +   +Y+++E C +  L ++L +R  +  + E VRY   
Sbjct: 138 EIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVT-EPE-VRYFMT 195

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 196 QICGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKY--TVCGTPN 253

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G +IY ++ G+PP+
Sbjct: 254 YIAPEVLMGKH----SGHSYE------------VDIWSIGVMIYALLIGKPPF 290

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 83/313 (26%), Positives = 142/313 (45%), Gaps = 43/313 (13%)

Query: 522 TPQRKRQIIQVNGSEYEKVELLGRGG-SSKVYKVRSSNNKIYALKRVSFDEF-DDTSIDG 579
           T +  + ++++   +++  E LG G  SS V      + K YA+K +S +       +  
Sbjct: 110 TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKY 169

Query: 580 FKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVR 638
              E   L++L     + KL     +   LY ++E   H D   ++ +  ++  +    R
Sbjct: 170 VTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSL--NETCAR 227

Query: 639 YHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVN------- 690
           Y+A +++  V  +H+ GI+H D+KP N +  K + +K+ DFG A  +P+   N       
Sbjct: 228 YYASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPY 287

Query: 691 --IYRDTQ--IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQ 746
             +Y  ++  +GT  Y++PE L+  NYT  +                  DIW+ GCI+YQ
Sbjct: 288 FDLYAKSKSFVGTAEYVSPE-LLNDNYTDSR-----------------CDIWAFGCILYQ 329

Query: 747 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWT 806
           M+ G+PP   F+  N  L      +KI Y    T G   P+   D +K  L R+P  R T
Sbjct: 330 MLAGKPP---FKAANEYLTFQK-VMKIQYA--FTAG--FPQIVKDLVKKLLVRDPNDRLT 381

Query: 807 VDDLLRGPFIKPV 819
           +  +    F   V
Sbjct: 382 IKQIKAHLFFHEV 394

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 147/311 (47%), Gaps = 41/311 (13%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF-DDTSID 578
           QT +  +Q+I+   ++++  E LG G  S V    S  +NK YA+K ++ +       + 
Sbjct: 139 QTGKITKQVIKKGINDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVK 198

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFV 637
               E   L+RL++   ++ L     +   LY ++E   + DL  ++ +  ++  + +  
Sbjct: 199 YVNIEKNTLQRLKNTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSV--NEKCT 256

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYR--- 693
           +Y+A +++  +  +HD G++H DLKP N +  V   +K+ DFG A  +   + +  +   
Sbjct: 257 QYYAAQIIDALGFMHDKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDL 316

Query: 694 ----DTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIY 749
               ++ +GT  Y++PE L+  NY                 V    DIW+ GCI++QMI 
Sbjct: 317 LTRSNSFVGTAEYVSPE-LLNDNY-----------------VDFRCDIWAFGCILFQMIA 358

Query: 750 GRPPYGGFQGQNRLLAIMNP-EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVD 808
           G+PP   F+  N  L      +V+  +    T G   P T  D +K  L +NPERR  ++
Sbjct: 359 GKPP---FKANNEYLTFQKVMKVQFAF----TAG--FPMTVRDLVKNILIKNPERRLLIN 409

Query: 809 DLLRGPFIKPV 819
            +    F   V
Sbjct: 410 QIKAHQFFADV 420

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 85/286 (29%), Positives = 131/286 (45%), Gaps = 40/286 (13%)

Query: 537 YEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y  +  +G+G S  VY      +N+  A+K+++ ++     +     EI L+ +      
Sbjct: 611 YTNLVKIGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKEL--IINEI-LVMKGSRHPN 667

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+V+ME  +   L+ V+         I  V    +E L  +Q +H  
Sbjct: 668 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLSGLQFLHSK 724

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    +  + +N+ R T +GTP +MAPE +    Y
Sbjct: 725 GVLHRDIKSDNILLSISGDIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY 782

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPE 770
            P              KV    DIWS G +I +MI G PPY        L  I     PE
Sbjct: 783 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPE 824

Query: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           +K   PE  +    V R  LD    CL+ +PE+R +  DLL   FI
Sbjct: 825 LK--EPENLS---AVLRNFLD---WCLKVDPEQRASATDLLNDVFI 862

>NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON}
           Anc_6.371
          Length = 918

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 148/359 (41%), Gaps = 66/359 (18%)

Query: 508 IPLKPPSTENGSYQTPQRKRQI-----------IQVNGSEYEKVELLGRGGSSKVYKVRS 556
           IP +PP       + P+R R++           I V    +EK++LLG+G   KVY VR 
Sbjct: 480 IPSEPPRIP-AVEEEPKRSRRLRNKSFSNKFKDITVGPQSFEKIKLLGQGDVGKVYLVRE 538

Query: 557 S-NNKIYALKRVSFDEF-DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME 614
              N++YALK  S  E      I     E E+L    +   VV L     +   LY  ME
Sbjct: 539 KKTNRLYALKIFSKSEMIKRKKIKRILAEQEILA-TSNHPFVVTLYHSFQSEDYLYFCME 597

Query: 615 -CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GI 672
            C   +  + L  R       +  R++A E+   ++ +H  G ++ DLKP N +  K G 
Sbjct: 598 YCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHKSGH 657

Query: 673 LKIIDFGIANAVPDHTVNIYR--------DTQI-----------GTPNYMAPEALVAMNY 713
           + + DF ++    D  V + +        DT+I           GT  Y+APE +    +
Sbjct: 658 IMLSDFDLSVQAKDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGH 717

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
           T                     D W+ G +IY+M++G  P+ G         I+  +V  
Sbjct: 718 T------------------AAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDVS- 758

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERR----WTVDDLLRGPFIKPVSVTHFFIRD 828
            +P    + + + R   D IK  L +N  +R        D+ R PF K V  +  F+R+
Sbjct: 759 -FP----NNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWS--FLRN 810

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 136/302 (45%), Gaps = 38/302 (12%)

Query: 537 YEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y  +  +G+G S  VY       N   A+K+++ ++     +     EI ++K  + Q  
Sbjct: 623 YLNLTKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKEL--IINEILVMKGSKHQ-N 679

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+VVME  +   L+ V+         I  V    +E L+ +Q +H  
Sbjct: 680 IVNFIDSYVLKGDLWVVMEYMEGGSLTDVVTHCILTEAQIGAV---CRETLRGLQFLHSK 736

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    +  + +N+ R T +GTP +MAPE +    Y
Sbjct: 737 GVIHRDIKSDNILLSMNGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY 794

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 772
            P              KV    DIWS G +I +MI G PPY        L L   N   K
Sbjct: 795 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 836

Query: 773 IVYPEKTTHGDLVPRTALDTIKA-CLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIK 831
           +  PE       V    L +  A CL  NP+ R +  +LLR  FI   +  +  +  L+K
Sbjct: 837 LKEPE-------VLSPELKSFLAWCLNVNPDTRASATELLRDVFITQCADENESLAPLVK 889

Query: 832 NA 833
            A
Sbjct: 890 LA 891

>Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {ON}
           complement(45186..47825) [2640 nt, 880 aa]
          Length = 879

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 142/330 (43%), Gaps = 54/330 (16%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRSS-NNKIYALKRVSFDEF-DDTSIDGFKGE 583
           K Q I V+ + +EK+ LLG+G   KVY V+   +N++YALK  S  E      I     E
Sbjct: 470 KFQDIIVSPNSFEKIRLLGQGDVGKVYLVKEKKSNRLYALKIFSKAEMIKRKKIKRILAE 529

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L    D   +V L     +   LY+ ME C   +  + L  R       +  R++A 
Sbjct: 530 QEILA-TSDHPFIVNLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDSRFYAS 588

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYR-------- 693
           E++  ++ +H  G ++ DLKP N +  K G + + DF ++    D    + +        
Sbjct: 589 EVVAALEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSIQAKDAKDPVVKKFAQSTVV 648

Query: 694 DTQ-----------IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGC 742
           DT+           +GT  Y+APE +    +T                     D W+ G 
Sbjct: 649 DTKVCSDGFRTNSFVGTEEYIAPEVIRGNGHTA------------------AVDWWTLGI 690

Query: 743 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPE 802
           +IY+M++G  P+ G         ++  +V   +P    + + + RT  D IK  L +N  
Sbjct: 691 LIYEMLFGFTPFKGDNTNETFCNVLKNDVN--FP----NNNEISRTCKDLIKKLLAKNEA 744

Query: 803 RR----WTVDDLLRGPFIKPVSVTHFFIRD 828
           +R        D+ R PF K V  +  F+R+
Sbjct: 745 KRLGSKMGAADIKRHPFFKKVQWS--FLRN 772

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 140/311 (45%), Gaps = 39/311 (12%)

Query: 537  YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDD------TSIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V   ++        ++++  + E+  LK 
Sbjct: 1181 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1240

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  + +  + +E      +  ++  R    FD   +++   ++L+ +
Sbjct: 1241 L-DHLNIVQYLGFENKNSIYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGL 1297

Query: 649  QVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +  + GI KI DFGI+    D    IY ++ +   GT  +MA
Sbjct: 1298 AYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKD----IYSNSDMTMRGTVFWMA 1353

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GCI+ +M  G+ P+   +    + 
Sbjct: 1354 PEMVDT-----KQGYSAK------------VDIWSLGCIVLEMFAGKRPWSNLEVVAAMF 1396

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHF 824
             I   +     PE T    L+ R     + AC E +PE+R T   LL   F + V VT  
Sbjct: 1397 KIGKSKSAPPIPEDTL--PLITRVGRSFLDACFEIDPEKRPTATKLLSHQFSE-VDVTFD 1453

Query: 825  FIRDLIKNAVK 835
            F    +   +K
Sbjct: 1454 FKSTTLAKFIK 1464

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 135/290 (46%), Gaps = 24/290 (8%)

Query: 539 KVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVV 597
           K E++G+G  + V K V  S  K +A K +S  +    ++DG   E+E+L++L +  ++V
Sbjct: 195 KDEVVGQGAFATVKKAVERSTGKTFAAKIISKRKVMG-NMDGVTRELEVLRKL-NHPKIV 252

Query: 598 KLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGI 656
           +L     +    Y++ME     DL   +A   ++  D    R   +++L+ V+ +H  GI
Sbjct: 253 RLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQVLEGVKYIHSQGI 310

Query: 657 VHSDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            H DLKP N +  +    ++KI DFG+A    + T   +  T  GT  Y+APE +     
Sbjct: 311 SHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPEVIA---- 363

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
               G+   E  + R +     D+WS GC++Y ++ G  P+ G   +     I N     
Sbjct: 364 ----GKANAEENEKRNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQIKNGS--- 416

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTH 823
            Y E       +   A D I + L+ NP  R T    L  P+IK   V H
Sbjct: 417 -YHEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIKMGHVAH 465

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 145/318 (45%), Gaps = 46/318 (14%)

Query: 522 TPQRKRQIIQVNGSEYEKVELLGRGG-SSKVYKVRSSNNKIYALKRVSFDEF-DDTSIDG 579
           T +  + ++++   +++  E LG G  SS V      + K YA+K +S +       +  
Sbjct: 110 TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKY 169

Query: 580 FKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVR 638
              E   L++L     +++L     +   LY ++E   H D   ++ +  ++  + +  R
Sbjct: 170 VTVEKLALQKLNGTKGIIRLFFTFQDEASLYFLLEYASHGDFLGLIKKYGSL--NEKCAR 227

Query: 639 YHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVN------- 690
           Y+A +++  V  +H  GI+H D+KP N +  K + +K+ DFG A  +P+   N       
Sbjct: 228 YYASQIIDAVDSLHAIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPC 287

Query: 691 --IYRDTQ--IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQ 746
             +Y  ++  +GT  Y++PE L+  +YT  +                  DIW+ GCI+YQ
Sbjct: 288 FDLYARSKSFVGTAEYVSPE-LLNDSYTDSR-----------------CDIWAFGCILYQ 329

Query: 747 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWT 806
           M+ G+PP   F+  N  L      +KI Y    T G   P  A D +K  L R P  R T
Sbjct: 330 MVAGKPP---FKAANEYLTFQK-VMKIQY--AFTAG--FPLIAKDLVKKLLVREPNDRLT 381

Query: 807 VDDLLRGPFIKPVSVTHF 824
           V+ +    F   V   HF
Sbjct: 382 VEQIKAHVFFHGV---HF 396

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/343 (25%), Positives = 149/343 (43%), Gaps = 50/343 (14%)

Query: 518 GSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTS 576
           GS  TPQ            + + E++GRG    VYK      K +YA+K ++ D  +D  
Sbjct: 15  GSALTPQ-----------AFRRTEIVGRGKFGVVYKAYHVKTKQVYAIKVLNLDCPED-E 62

Query: 577 IDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIE 635
           ++  + E++ L  L+    + +     +    L+V+ME C    L  +L        D +
Sbjct: 63  VEDVQKEVQFLSSLKQVPNITQYYGSFLYETKLWVIMEYCAGGSLRTLLRPGK---IDEK 119

Query: 636 FVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRD 694
           ++    + +L  +  +H   ++H D+K AN +   G  +K+ DFG+A  +   T N  R 
Sbjct: 120 YLGVIVRNLLVALLYIHKDNVIHRDIKAANVLITNGGHVKLCDFGVAAQL--TTANHKRQ 177

Query: 695 TQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           T  GTP +MAPE ++   Y                     +DIWS G   Y++  G PPY
Sbjct: 178 TMAGTPYWMAPEVIMEGVY-----------------YNTKADIWSLGITTYEIATGNPPY 220

Query: 755 GGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGP 814
              +    +  I   +     P +    +  P    + I  CL+ +PE R T ++LL   
Sbjct: 221 CDVEALRAMQLITKSK-----PPRLEGRNYSPLLK-EFIALCLDEDPEARPTAEELLTTK 274

Query: 815 FIKP---VSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADD 854
            +K     SVT   +++LI   + +   +++ ++E V    DD
Sbjct: 275 LVKTHKGSSVT--ILKELISRYLLF--SEKHKNRESVMINLDD 313

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 117/242 (48%), Gaps = 31/242 (12%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L + T V++L D       LY+V+E  +  +L  +L +R  +P + E V
Sbjct: 85  GIEREIIIMKLL-NHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLPEN-EAV 142

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQ 696
           R+  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A      + +   +T 
Sbjct: 143 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETS 198

Query: 697 IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            G+P+Y APE +  + Y                  G  SD+WSCG I+Y ++ GR P+  
Sbjct: 199 CGSPHYAAPEIVSGLPYH-----------------GFESDVWSCGVILYALLTGRLPFDE 241

Query: 757 FQGQNRLLAIMNPEVKIVYPEKTTHG-DLVPRTALDTIKACLERNPERRWTVDDLLRGPF 815
             G  R L +     K+   E    G D +   A D I   L  +P+RR    ++L+ P 
Sbjct: 242 DNGNIRSLLL-----KVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPL 296

Query: 816 IK 817
           ++
Sbjct: 297 LQ 298

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 85/327 (25%), Positives = 148/327 (45%), Gaps = 44/327 (13%)

Query: 537  YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDD------TSIDGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V   ++        ++++  + E+  LK 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E    +  + +E      +  ++  R    FD   +++   ++LK +
Sbjct: 1235 L-DHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGL 1291

Query: 649  QVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +  + GI KI DFGI+    D    IY ++ +   GT  +MA
Sbjct: 1292 AYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKD----IYSNSDMTMRGTVFWMA 1347

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GCI+ +M  G+ P+   +    + 
Sbjct: 1348 PEMVDT-----KQGYSAK------------VDIWSLGCIVLEMFAGKRPWSNLEVVAAMF 1390

Query: 765  AIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHF 824
             I   +     PE T    L+ +     + AC E NPE+R T  +LL   F   V+VT  
Sbjct: 1391 KIGKSKSAPPIPEDTL--PLISQVGRGFLDACFEINPEKRPTATELLSHRF-SVVNVTFD 1447

Query: 825  F----IRDLIKNAVKYGSDQ-RYVSKE 846
            F    +   IK+  K  S + R  S+E
Sbjct: 1448 FKSTELAKFIKSNDKLNSSKLRITSQE 1474

>KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3.177
           YAR019C
          Length = 980

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 141/311 (45%), Gaps = 35/311 (11%)

Query: 509 PLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRV 567
           P+   + + GS    Q +    + N ++Y+  +++G+G    VYK V  S  ++ A+K +
Sbjct: 3   PMAATAVQGGSTGPHQERTTNGKGNSTKYQLNQVIGKGSYGIVYKAVNKSTKQVVAIKEI 62

Query: 568 SFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQ 626
           ++    D  ++    EI+LLK L     +VK          LY+++E   H  L  +L+ 
Sbjct: 63  NYTS--DEELNEIMIEIDLLKNLH-HINIVKYHGFIQKMSNLYIILEYAAHGSLKGLLSS 119

Query: 627 RANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVP 685
           R     D    + + ++ L  +  +H+ G++H D+K AN +      +K+ DFG++  V 
Sbjct: 120 RIGHLLDEAETKIYVRQTLDGLAYLHEQGVIHRDIKAANLLLDSTNTVKLADFGVSTKV- 178

Query: 686 DHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIY 745
               N    T  G+ N+MAPE +       ++G +              SDIWS G  I 
Sbjct: 179 ----NNTAKTLAGSLNWMAPEIVT------NKGASTL------------SDIWSLGATIV 216

Query: 746 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRW 805
           +++ G+PP+      N   A+ N   +  YP  +     +P  A   +  C ++N  +R 
Sbjct: 217 ELMTGKPPFHNLLDINIYYAMENDN-ECYYPPAS-----LPEGAKQFLALCFQKNMFKRP 270

Query: 806 TVDDLLRGPFI 816
           T   LL+  ++
Sbjct: 271 TAKSLLKHSWL 281

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 132/288 (45%), Gaps = 33/288 (11%)

Query: 537 YEKVELLGRGGSSKVYKV--RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           YE  E +G+G    VYK   +S+ N + A+K V+ +E DD  ID    EI  L  L    
Sbjct: 34  YEVQECVGKGNFGDVYKAIDKSTGNTV-AIKVVNLEETDD-EIDLLAQEIYFLAELH-SP 90

Query: 595 RVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +       +    +++VME CG    S +L          E V +  +E+L+ ++ +H 
Sbjct: 91  YITNYFSTFVEDVSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHS 150

Query: 654 TGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
              +H D+K AN +    G +K+ DFG++  +        RDT +GTP +MAPE +    
Sbjct: 151 QRKIHRDIKAANILLTDDGKVKLGDFGVSGQM---MATRRRDTFVGTPFWMAPEVIA--- 204

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
              +QG  E+            +DIWS G  +++++ G+PP         L++I  P  +
Sbjct: 205 -RSEQGYNEK------------ADIWSLGITVFELLKGQPPLSQHDPMKVLMSI--PSRR 249

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVS 820
              P K    D       + +  CL ++P +R T  +LL+  FI  V 
Sbjct: 250 ---PPKLE--DRYSHAIREFVSLCLNKDPAKRPTASELLKHRFIARVG 292

>Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR047W
           - Hypothetical ORF [contig 18] FULL
          Length = 868

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 94/383 (24%), Positives = 160/383 (41%), Gaps = 70/383 (18%)

Query: 482 IRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENG-------SYQTPQRKRQI----- 529
           +R+A + P   K+   +   +T ++     P +T +G       S   PQR R++     
Sbjct: 391 LRRATSEPNAAKIIDPQSSTNTQLSKGSHLPAATSSGASPDNAFSVSEPQRSRRLRNKSF 450

Query: 530 ------IQVNGSEYEKVELLGRGGSSKVYKVRSS-NNKIYALKRVSFDEF-DDTSIDGFK 581
                 + V    +EK++LLG+G   KVY V+    N++YALK  S +E      I    
Sbjct: 451 SSKFKEVIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRIL 510

Query: 582 GEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYH 640
            E E+L    +   +V L     +   LY+ ME C   +  + L  R     D +  R++
Sbjct: 511 AEQEILA-TSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFY 569

Query: 641 AQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYR------ 693
           + E++  ++ +H  G ++ DLKP N +  K G + + DF ++    D    + +      
Sbjct: 570 SSEVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDTKNPVVKGSAQSS 629

Query: 694 --DTQI-----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSC 740
             DT+I           GT  Y+APE +    +T                     D W+ 
Sbjct: 630 LLDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHT------------------AAVDWWTL 671

Query: 741 GCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERN 800
           G +IY+M++G  PY G         ++  EV   +P    + + V R   D I+  L ++
Sbjct: 672 GILIYEMLFGFTPYKGDNTNKTFSNVLKNEVS--FP----NNNEVSRNCKDLIRKLLIKS 725

Query: 801 PERR----WTVDDLLRGPFIKPV 819
             RR    +   D+ + PF K V
Sbjct: 726 ETRRLGSKFGASDIKKHPFFKKV 748

>TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {ON}
           Anc_3.177 YAR019C
          Length = 980

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 134/284 (47%), Gaps = 36/284 (12%)

Query: 536 EYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           +Y+   ++G+G    VYK +     +I A+K V++D  +D  ++    EI LLK L ++ 
Sbjct: 59  QYQLKGVIGKGSFGVVYKAINKKTAQIVAIKEVNYD--NDEELNDIMSEIHLLKNLNNR- 115

Query: 595 RVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +VK          LY+++E C    L ++++  +N        +   ++ L  +  +H+
Sbjct: 116 NIVKYHGFIQKMDTLYIILEYCSKGSLKKLIS--SNKGISEADAKMFIRQTLHGLVYLHE 173

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K AN +     ++K+ DFG++  V + T+ +   T  G+ N+MAPE      
Sbjct: 174 QGVIHRDIKAANLLLDSDNVVKLADFGVSTKVSNATMAM---TLAGSLNWMAPE------ 224

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
                      I  NR      SDIWS G  + +++ G PP+      N   AI N    
Sbjct: 225 -----------IIGNR-GASTLSDIWSLGATVVELLTGNPPFHNLIDVNIYYAIEN---D 269

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           I +P +    DLV +  LD +  C ++N   R T   LL+  ++
Sbjct: 270 IYFPPE----DLVSKLGLDFLSKCFQKNMYLRPTARQLLQHEWL 309

>TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6.371
           YCR091W
          Length = 889

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 159/363 (43%), Gaps = 60/363 (16%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF-DDTSIDGFKGE 583
           K Q I V+   +EK+ LLG+G   KVY VR  +++++YALK  S  E      I     E
Sbjct: 476 KFQDIVVSPQAFEKIRLLGQGDVGKVYLVREKASSRLYALKIFSKAEMIKRKKIKRVLVE 535

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L   E    +V L     +   LY+ ME C   +  + L  R       +  R++A 
Sbjct: 536 QEILATSE-HPFIVNLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYAA 594

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIA----------------NAVP 685
           E++  ++ +H  G ++ DLKP N +  K G + + DF ++                +AV 
Sbjct: 595 EVVAALEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSIQTTSSKEPVVKKLAQSAVV 654

Query: 686 DHTV---NIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGC 742
           D  +       ++ +GT  Y+APE +    +T                     D W+ G 
Sbjct: 655 DTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTA------------------AVDWWTLGI 696

Query: 743 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPE 802
           +IY+M++G  P+ G    +    I+  +V   +P    + + + R   D IK  L +N  
Sbjct: 697 LIYEMLFGFTPFKGDNTNDTFCNILKDDV--TFP----NNNEISRNCKDLIKKLLTKNEL 750

Query: 803 RRW----TVDDLLRGPFIKPVSVTHFFIRD----LIKNAVKYGSDQRYVS--KEKVEDLA 852
           +R        D+ R PF K V  +  F+R+    LI    + G D   +S  K+K +D++
Sbjct: 751 KRLGSKTGAADVKRHPFFKKVQWS--FLRNQDPPLIPVLSEDGCDFSKLSTNKKKSKDIS 808

Query: 853 DDV 855
           D +
Sbjct: 809 DAI 811

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 135/301 (44%), Gaps = 36/301 (11%)

Query: 537 YEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y  +  +G+G S  VY       N   A+K+++ ++     +     EI ++K  + +  
Sbjct: 655 YLNLTKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKEL--IINEIMVMKGSKHR-N 711

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+VVME  +   L+ V+         I  V    +E L  +Q +H  
Sbjct: 712 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLAGLQFLHSK 768

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    +  + +N+ R T +GTP +MAPE +    Y
Sbjct: 769 GVIHRDIKSDNILLSMTGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY 826

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEVK 772
            P              KV    DIWS G +I +MI G PPY        L L   N   K
Sbjct: 827 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 868

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKN 832
           +  P      D +     + +  CL   P++R +   LL+ PF+  V+  +  +  L+K 
Sbjct: 869 LKEP------DNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENSSLAPLVKL 922

Query: 833 A 833
           A
Sbjct: 923 A 923

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 120/243 (49%), Gaps = 33/243 (13%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L     V+ L D    +  LY+++E  +  +L  +L +R  +P + E +
Sbjct: 76  GIEREIIIMKLLR-HPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP-EKEAI 133

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQ 696
           R+  Q ++  +   H  GIVH DLKP N +    + +KI DFG+A      T +   +T 
Sbjct: 134 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAAL---ETKDKMLETS 189

Query: 697 IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            G+P+Y APE +  + Y                  G  SD+WSCG I++ ++ GR P+  
Sbjct: 190 CGSPHYAAPEIVSGVPYH-----------------GFQSDVWSCGVILFALLTGRLPFDE 232

Query: 757 FQG--QNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGP 814
             G  +N LL + + E ++  P+     D + + A D I   L  +PE+R    D+L+ P
Sbjct: 233 EDGNIRNLLLKVQSGEYEM--PD----DDEISKEAQDLIGRILTVDPEQRIKTRDILKHP 286

Query: 815 FIK 817
            ++
Sbjct: 287 LLQ 289

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 131/285 (45%), Gaps = 37/285 (12%)

Query: 537 YEKVELLGRGGSSKVYKVRSS--NNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           Y+ +  +G+G S  V+    S   N++ A+K+++  +     +     EI ++K    + 
Sbjct: 677 YKDLVKIGQGASGGVFTAHDSRDENRLVAIKQMNLQKQPKKEL--IINEIIVMKGSRHE- 733

Query: 595 RVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +V  ID  +  G L+VVME  +   L+ V+         I  V    +E L  +  +H 
Sbjct: 734 NIVNFIDSYLMKGDLWVVMEYMEGGSLTDVVTHCILTEGQIGTV---CKETLGGLAFLHS 790

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K  N +  + G +K+ DFG    +  + V++ R T +GTP +MAPE +    
Sbjct: 791 KGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVHLKRTTMVGTPYWMAPEVVSRKE 848

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEV 771
           Y P              KV    DIWS G +I +MI G PPY        L L   N   
Sbjct: 849 YGP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTP 890

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           ++  PE    G+++ +     +  CL  NPE R T  +LL  PFI
Sbjct: 891 QLKDPENL--GEILKK----FLDWCLTVNPEERATALELLSHPFI 929

>KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {ON}
           Anc_3.177 YAR019C
          Length = 936

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 139/302 (46%), Gaps = 37/302 (12%)

Query: 522 TPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGF 580
           TP ++      N   Y+  +++G+G    VYK +     ++ A+K + ++  +DT +   
Sbjct: 14  TPAQQTNERSTNSVSYQLKQVIGKGSYGIVYKAINRRTEQVVAIKELYYN--NDTELQDI 71

Query: 581 KGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRY 639
             EI+LLK L D   ++K          LY+++E   H  L  ++ QR     + +  R 
Sbjct: 72  MVEIDLLKNL-DHVNIIKYHGFIQKLSNLYIILEFASHGSLKNLMMQRPEKHLNEKETRI 130

Query: 640 HAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIG 698
           + ++ +  +  +H+ G++H D+K AN +      +K+ DFG++ +V +  +     T  G
Sbjct: 131 YIKQTINGLVYLHEQGVIHRDIKAANLLLDASNTIKLADFGVSTSVANSAM-----TLAG 185

Query: 699 TPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQ 758
           + N+MAPE +       ++G +              SDIWS G  I +++ G PP+    
Sbjct: 186 SLNWMAPEIIT------NKGAST------------LSDIWSLGATIIELLTGNPPFHKLM 227

Query: 759 GQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKP 818
             N   AI N     + PE       +     + +  C ++N  +R +   LL+ P++K 
Sbjct: 228 DINIYYAIENDV--FLPPEN------LSTNCQNILNLCFQKNMFKRPSAVSLLKHPWLKD 279

Query: 819 VS 820
           ++
Sbjct: 280 IT 281

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 132/284 (46%), Gaps = 41/284 (14%)

Query: 543 LGRGGSSKVYKVRS-SNNKIYALK-----RVSFDEFDDTSID-GFKGEIELLKRLEDQTR 595
           LG+G S +V   ++  + K+ A+K      V  ++   T++  G + EI ++K L     
Sbjct: 67  LGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMK-LITHPN 125

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           ++ L +   N   LY+V+E     +L   L  R  +P + E + Y  Q +++ V   H+ 
Sbjct: 126 IMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLP-EQEAIHYFKQ-IVQGVSYCHNF 183

Query: 655 GIVHSDLKPANFVFVKG--ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            I H DLKP N +  K    +KI DFG+A      T N   +T  G+P+Y +PE ++   
Sbjct: 184 NICHRDLKPENLLLDKKNKTVKIADFGMAAL---ETTNRLLETSCGSPHYASPEIVMGQK 240

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
           Y                  G PSD+WSCG I++ ++ G  P+     +  LL + +   +
Sbjct: 241 YH-----------------GSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQ 283

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           +  P        V + A D I   L  +PE+R TVD +L  P +
Sbjct: 284 M--PSN------VSKEAKDLISKILVVDPEKRITVDKILEHPLL 319

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 128/284 (45%), Gaps = 32/284 (11%)

Query: 537 YEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y++ +++G+G    VYK  S  + K++A+K ++ D  D   I   + EI+ L  L     
Sbjct: 6   YKRTKVIGKGKFGTVYKGHSIKSKKVFAIKVLNLD-CDINEIQDIQNEIKFLSLLRYAPN 64

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +       + +  ++++ME C    +  ++       F+  ++    +E+L  ++ +H  
Sbjct: 65  ITYYYHSYLINRKIWIIMEYCNGGSVRNLIKIGR---FNEIYISVILRELLYALEYIHHD 121

Query: 655 GIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            I+H D+K AN +  + G +K+ DFGIA  +        R T  GTP +MAPE ++    
Sbjct: 122 NIIHRDIKAANILINQNGGIKLCDFGIAAKLEFSKPK--RQTMAGTPYWMAPEVII---- 175

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
                  E  +   +      +DIWS G   Y++  G PPY  +     +  I     K+
Sbjct: 176 -------ESSLYDTK------ADIWSVGITAYEITTGNPPYCEYDATKAMQLI----TKL 218

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             P     G +  ++  + I  CL+ +P  R T   LL   FIK
Sbjct: 219 KPPR--LEGKMYSKSLKEFIALCLDEDPSERLTSTKLLETEFIK 260

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 116/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + KI+A K V+       SI   K   +LL 
Sbjct: 93  LIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVA-----KLSIKTEKTRKKLLS 147

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ ID   +   +Y+++E C +  L ++L +R  +  + E VR+   
Sbjct: 148 EIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLT-EPE-VRFFTT 205

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 206 QICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKY--TVCGTPN 263

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G +IY ++ G+PP+
Sbjct: 264 YIAPEVLMGKH----SGHSYE------------VDIWSIGVMIYALLIGKPPF 300

>CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {ON}
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047w or uniprot|P25341 Saccharomyces cerevisiae
           YCR091w KIN82
          Length = 895

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 136/324 (41%), Gaps = 52/324 (16%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRSS-NNKIYALKRVSFDEF-DDTSIDGFKGE 583
           K Q I V    +EK+ LLG+G   KVY V+    N++YALK  S  E      I     E
Sbjct: 486 KFQDITVGPQSFEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAE 545

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L    +   VV L     +   LY+ ME C   +  + L  R +     E  +++A 
Sbjct: 546 QEILA-TSNHPFVVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYAS 604

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYR-------- 693
           E+   ++ +H  G ++ DLKP N +  + G + + DF ++    D  V + +        
Sbjct: 605 EVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDAKVPVVKGNAQSTVV 664

Query: 694 DTQI-----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGC 742
           DT+I           GT  Y+APE +    +T                     D W+ G 
Sbjct: 665 DTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTA------------------AVDWWTLGI 706

Query: 743 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPE 802
           +IY+M++G  P+ G         I+  +V   +P    + + V R   D IK  L +N  
Sbjct: 707 LIYEMLFGFTPFKGENTNETFSNILKKDV--TFP----NNNEVSRNCKDLIKKLLIKNES 760

Query: 803 RR----WTVDDLLRGPFIKPVSVT 822
           +R        D+ + PF K V+ T
Sbjct: 761 KRLGSKMGAADIKKHPFFKKVNWT 784

>ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 941

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 138/305 (45%), Gaps = 43/305 (14%)

Query: 515 TENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFD 573
           +E    Q PQ++ QI      +Y+  +++G+G    VYK +     K+ A+K V ++  +
Sbjct: 19  SEQSVKQEPQKRNQI------QYQLKQVIGKGSYGVVYKAINRKTQKLVAIKEVHYE--N 70

Query: 574 DTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPF 632
           D  +     EI+LLK L +   +VK          LY+++E C    L   +++   +P 
Sbjct: 71  DDELTDIMSEIDLLKNL-NHINIVKYHGFIQKSHNLYIILEYCSHGSLKNYISRGNGLPE 129

Query: 633 DIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNI 691
                + + ++ L  +  +H+ G++H D+K AN +     ++K+ DFG++  V   T+ +
Sbjct: 130 SK--AKVYVKQTLNGLNYLHEQGVIHRDIKAANLLLDSNNVVKLADFGVSTKVNTMTMAM 187

Query: 692 YRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGR 751
              T  G+ N+MAPE                 I  NR      SDIWS G  + +++ G 
Sbjct: 188 ---TLAGSLNWMAPE-----------------IIGNR-GASTLSDIWSLGATVLEVLTGN 226

Query: 752 PPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLL 811
           PP+      N   AI N     + P        + + A D +  C ++N  +R T   LL
Sbjct: 227 PPFYNLVDINIYYAIEND--AFIPP------SFISKEAQDFLSTCFQKNMYQRPTAAQLL 278

Query: 812 RGPFI 816
           R  ++
Sbjct: 279 RHKWV 283

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 89/350 (25%), Positives = 158/350 (45%), Gaps = 51/350 (14%)

Query: 526  KRQIIQVNGS-----EYE-----KVELLGRGGSSKVY-KVRSSNNKIYALKRV------S 568
            ++Q++ +N S     EY+     K E++G+G    VY  +  +  ++ A+K+V      S
Sbjct: 1075 EKQLVAINKSKNSRGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSS 1134

Query: 569  FDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQR 627
             DE   ++++  + E+  LK L D   +V+ +  E    +  + +E      +  ++  R
Sbjct: 1135 QDENIISTVEALRSEVSTLKDL-DHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLI--R 1191

Query: 628  ANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPD 686
                FD   +R+   ++L+ +  +H  GI+H D+K  N +  + G+ KI DFGI+    D
Sbjct: 1192 MYGRFDEAMIRHLTIQVLRGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSND 1251

Query: 687  HTVNIYRDTQI---GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCI 743
                IY ++ +   GT  +MAPE +        QG + +             DIWS GC+
Sbjct: 1252 ----IYSNSDMTMRGTVFWMAPEMVDT-----KQGYSAK------------VDIWSLGCV 1290

Query: 744  IYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPER 803
            + +M  G+ P+   +    +  I   +     PE T    L+ +     + +C E +PE 
Sbjct: 1291 VLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTL--PLISQDGRQFLDSCFEIDPES 1348

Query: 804  RWTVDDLLRGPFIKPVSVTHFFIRDL---IKNAVKYGSDQRYVSKEKVED 850
            R T D LL   F K     +F   +L   IK+  K  S +  V+ + V D
Sbjct: 1349 RPTADKLLSHAFSKVYPSFNFKSTELCKFIKSNDKINSSKLRVASKDVND 1398

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 119/233 (51%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y + + LG GG ++ ++++  + KI+A K V+       SI   K   +LL 
Sbjct: 73  LIKTRGRDYHRGQFLGEGGFARCFQIKDDSGKIFAAKTVA-----KISIKSEKTRKKLLS 127

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++       T +V+ ID   ++  +Y+++E C +  L +++ +R  +  + E VR+   
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTIT-EPE-VRFFMT 185

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   +Q +H   ++H DLK  N  F +   LKI DFG+A  + +     +  T  GTPN
Sbjct: 186 QICGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKF--TICGTPN 243

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G ++Y ++ G+PP+
Sbjct: 244 YIAPEVLMGKH----SGHSYE------------VDIWSIGVMLYALLIGKPPF 280

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 89/312 (28%), Positives = 153/312 (49%), Gaps = 25/312 (8%)

Query: 517 NGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDT 575
           NGS +TP+     I  + S  +  E++G+G  + V K V  +  K YA+K ++  +    
Sbjct: 169 NGSRRTPESMLTGIYKDFSIQD--EVVGQGAFATVKKAVERTTGKTYAVKIINKRKVMG- 225

Query: 576 SIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDI 634
           ++DG   E+E+LKRL +  R+V L     ++   Y+VME     DL   +A    +  D 
Sbjct: 226 NLDGVTRELEVLKRL-NHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDA 284

Query: 635 EFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNI 691
              +  ++++L+ V+ +H  GI H DLKP N +  +    ++KI DFG+A    + T   
Sbjct: 285 G--KEISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT--- 339

Query: 692 YRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGR 751
           +  T  GT  Y+APE + +          E++ ++N +      D+WS GC++Y ++ G 
Sbjct: 340 FMKTFCGTLAYVAPEVIGS-----SSKYNEEDEERNEY--SSLVDMWSMGCLVYVILTGH 392

Query: 752 PPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLL 811
            P+ G   Q +L   ++   +  Y E       +   A D I + L+ +P  R T    L
Sbjct: 393 LPFSG-STQEQLYKQIS---RGSYHEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARAL 448

Query: 812 RGPFIKPVSVTH 823
             P+IK VS+ +
Sbjct: 449 EHPWIKMVSLNN 460

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 118/243 (48%), Gaps = 33/243 (13%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L + T V++L D    +  LY+V+E  +  +L  +L ++  +  + E V
Sbjct: 89  GIEREIIIMKLL-NHTNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLAEN-EAV 146

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQ 696
           R+  Q ++  +   H  GIVH DLKP N +   K  +KI DFG+A      T +   +T 
Sbjct: 147 RFFRQ-IIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGMAAL---ETEDKLLETS 202

Query: 697 IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            G+P+Y APE +  + Y                  G  +DIWSCG I++ ++ GR P+  
Sbjct: 203 CGSPHYAAPEIVSGLPYN-----------------GLETDIWSCGVILFALLTGRLPFDE 245

Query: 757 FQG--QNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGP 814
             G  +N LL +   E ++         D +   A D I   L  NP++R    ++L+ P
Sbjct: 246 EDGNIRNLLLKVQKGEFEM------PGSDELSLEAQDLIGKILTVNPKQRIKTREILKHP 299

Query: 815 FIK 817
            ++
Sbjct: 300 LLQ 302

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 143/316 (45%), Gaps = 67/316 (21%)

Query: 522 TPQRKRQIIQVNGSEYEKVELLGRGG-SSKVYKVRSSNNKIYALK--------------R 566
           T +  + ++++   +++  E LG G  SS V      + K YA+K               
Sbjct: 110 TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARESGKKYAVKVLSKEYLIRQKKVKY 169

Query: 567 VSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQ 626
           V+ ++     ++G KG I L    +D+  +  L+++  +   L ++ + G   L+++ A 
Sbjct: 170 VTVEKLALQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGS--LNEICA- 226

Query: 627 RANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVP 685
                      RY+A +++  V  +H  GI+H D+KP N +  K + +K+ DFG A  +P
Sbjct: 227 -----------RYYASQIIDAVDSLHSIGIIHRDIKPENILLDKDMKVKLTDFGTAKILP 275

Query: 686 DHTVN---------IYRDTQ--IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKP 734
           +   N         +Y  ++  +GT  Y++PE L+  +YT  +                 
Sbjct: 276 EQPSNAADGKPCFDLYAKSKSFVGTAEYVSPE-LLNDSYTDSR----------------- 317

Query: 735 SDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIK 794
            DIW+ GCI+YQM+ G+PP   F+  N  L      +KI Y    T G   P+   D +K
Sbjct: 318 CDIWAFGCILYQMLAGKPP---FKAANEYLTFQKV-MKIQYA--FTAG--FPQIVKDLVK 369

Query: 795 ACLERNPERRWTVDDL 810
             L R+P  R  ++ +
Sbjct: 370 KLLVRDPNDRLAIEQI 385

>ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weakly
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047W Putative protein kinase that when overexpressed
           interferes with pheromone-induced growth arrest
           localizes to the cytoplasm potential Cdc28p substrate
           and some similarities with YCR091W uniprot|P25341
           Saccharomyces cerevisiae YCR091W KIN82 Putative
           serine/threonine protein kinase, most similar to cyclic
           nucleotide-dependent protein kinase subfamily and the
           protein kinase C subfamily
          Length = 860

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 90/367 (24%), Positives = 151/367 (41%), Gaps = 65/367 (17%)

Query: 500 VKDTVITTIPLKPPSTENGSYQTPQRKRQI-----------IQVNGSEYEKVELLGRGGS 548
           V+ ++ ++ P K     +  Y+ P+R  ++           I+V    +EKV +LG+G  
Sbjct: 414 VQASIGSSSPSKASPQVSSDYEEPKRSSRLRTKSFSNKFHDIKVGPGSFEKVRILGQGDV 473

Query: 549 SKVYKVRSS-NNKIYALKRVSFDEF-DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNH 606
            KV+ VR   +NK+YALK  S  E      I     E E+L    +   +V L     + 
Sbjct: 474 GKVFLVREKVSNKLYALKIFSKAEMIKRKKIKRILAEQEILAS-SNHPFIVTLYHSFQSE 532

Query: 607 GVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPAN 665
             LY+ ME C   +  + L  R +     +  R++A E++  ++ +H  G ++ DLKP N
Sbjct: 533 DYLYLCMEYCMGGEFFRALQTRRSKCISEDDARFYASEVIAALEYLHLMGFIYRDLKPEN 592

Query: 666 FVFVK-GILKIIDFGIANAVPDHTVNIYRDTQ-------------------IGTPNYMAP 705
            +  K G + + DF ++    D    + + T                    +GT  Y+AP
Sbjct: 593 ILLHKSGHIMLSDFDLSIQAKDAKDPVAKGTAQSTIVDTKICSDGFRTNSFVGTEEYIAP 652

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 765
           E +    +T                     D W+ G +IY+M++G  P+           
Sbjct: 653 EVIRGNGHT------------------AAVDWWTLGILIYEMLFGCTPFKSSNTNETFCN 694

Query: 766 IMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERR----WTVDDLLRGPFIKPVSV 821
           I+  EV   +P     G    R+  D IK  L +N  +R        D+ R PF K V  
Sbjct: 695 ILKNEVN--FPNSNDIG----RSCKDLIKKLLIKNELKRLGSKMGAADIKRHPFFKKVQW 748

Query: 822 THFFIRD 828
           +  F+R+
Sbjct: 749 S--FLRN 753

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 133/292 (45%), Gaps = 26/292 (8%)

Query: 539 KVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVV 597
           K E++G+G  + V K +     K +A+K ++  +    ++DG   E+E+L+RL +  R+V
Sbjct: 190 KDEVVGQGAFATVKKAIERRTGKTHAVKIINKRKVMG-NMDGVTRELEVLRRL-NHPRIV 247

Query: 598 KLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGI 656
            L     +    Y+VME     DL   +A   ++  D    R   +++L+ V+ +H  GI
Sbjct: 248 SLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAG--REITRQVLEAVKYIHAMGI 305

Query: 657 VHSDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            H DLKP N +  +    ++KI DFG+A    + T   +  T  GT  Y+APE +   N 
Sbjct: 306 SHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGT---FMKTFCGTLAYVAPEVISGKNS 362

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
              +G           K     D+WS GC++Y ++ G  P+ G   Q     I       
Sbjct: 363 EEKEGN----------KYSSLVDMWSIGCLVYVILTGHLPFSGSTQQELYKQISAGS--- 409

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFF 825
            Y E       +   A D I++ L+ NP  R T +  L+ P+I+      F 
Sbjct: 410 -YHEGPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIRTADSQSFI 460

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 143/313 (45%), Gaps = 43/313 (13%)

Query: 522 TPQRKRQIIQVNGSEYEKVELLGRGG-SSKVYKVRSSNNKIYALKRVSFDEF-DDTSIDG 579
           T +  +Q++++   +++  E LG G  SS V      + K YA+K +S +       +  
Sbjct: 109 TGELTKQVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKY 168

Query: 580 FKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVR 638
              E   L++L     +++L     +   LY ++E   H D   ++ +  ++  + +  R
Sbjct: 169 VTVEKLALQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLALIKKYGSL--NEQCAR 226

Query: 639 YHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDH---------- 687
           Y+A +++  V  +H  GI+H D+KP N +  K + +K+ DFG A  +P+           
Sbjct: 227 YYASQIIDAVDSLHTIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPC 286

Query: 688 -TVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQ 746
             +N    + +GT  Y++PE L+  +YT  +                  DIW+ GCI++Q
Sbjct: 287 FDLNARSKSFVGTAEYVSPE-LLNDSYTDSR-----------------CDIWAFGCILFQ 328

Query: 747 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWT 806
           M+ G+PP   F+  N  L      +KI Y    T G   P+   D +K  L + P  R T
Sbjct: 329 MVAGKPP---FKASNEYLTFQKV-MKIQYA--FTAG--FPQIIKDLVKKLLVKEPNDRLT 380

Query: 807 VDDLLRGPFIKPV 819
           ++ +    F + V
Sbjct: 381 IEQIKAHIFFQTV 393

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 153/328 (46%), Gaps = 44/328 (13%)

Query: 539  KVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEFDD------TSIDGFKGEIELLKRLE 591
            K E++G+G    V+  +  +  ++ A+K+V    +        ++++  + E+  LK L 
Sbjct: 1184 KGEMIGKGSFGAVFLCLNVTTGEMMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKDL- 1242

Query: 592  DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQV 650
            D   +V+ +  E+   +  + +E      +  ++  R    FD + +++   ++L+ +  
Sbjct: 1243 DHLNIVQYLGFEVKDSIYSLFLEYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVLRGLSY 1300

Query: 651  VHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMAPE 706
            +H  GI+H D+K  N +  + G+ KI DFGI+    D    IY ++++   GT  +MAPE
Sbjct: 1301 LHSRGILHRDMKADNLLLDQDGVCKISDFGISRKSKD----IYSNSEMTMRGTVFWMAPE 1356

Query: 707  ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
             +        QG + +             DIWS GC++ +M  G+ P+   +    +  I
Sbjct: 1357 MVDT-----KQGYSAK------------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKI 1399

Query: 767  MNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFF- 825
               +     P+ T    L+ ++  D +  C + +PE R T D LL   F+K VS  + F 
Sbjct: 1400 GKSKSAPPIPDDTL--PLISQSGRDFLDQCFKIDPEERPTADKLLSHQFLK-VSSKYDFK 1456

Query: 826  ---IRDLIKNAVKYGSDQ-RYVSKEKVE 849
               + + IK+  K  S + R  S +KV+
Sbjct: 1457 STKLAEFIKSNDKLNSTKLRVGSHDKVQ 1484

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 140/308 (45%), Gaps = 49/308 (15%)

Query: 536  EYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
            +++K   +G G    VY  V      I A+K + F+  D  +I       ++   + D+ 
Sbjct: 1190 KWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFN--DRKTIK------QVFPSIRDEM 1241

Query: 595  RVVKLIDH---------EMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEM 644
             V+++++H         E++   + + ME C    L+ +LA       D    + ++ +M
Sbjct: 1242 TVLEMLNHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLAH--GRIEDEMVTQVYSLQM 1299

Query: 645  LKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDH---TVNIYR----DTQ 696
            L+ +  +H++G+ H D+KP N +    GI+K +DFG A  +  +    +N+ +    +  
Sbjct: 1300 LEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKM 1359

Query: 697  IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            IGTP YM+PEA+    Y                K G   DIWS GC+I +M+ GR P+  
Sbjct: 1360 IGTPMYMSPEAISGTGYG---------------KFGS-DDIWSLGCVILEMVTGRRPWAN 1403

Query: 757  FQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
               Q  ++  +      ++P K      + +  +  +  CL ++P +R T  +LL  P+I
Sbjct: 1404 LDNQWAIIYQVAAGQIPMFPSKNE----MSQAGIKFLSRCLIQDPNQRSTAVELLMDPWI 1459

Query: 817  KPVSVTHF 824
              +    F
Sbjct: 1460 IEIRTIAF 1467

>NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6.371
          Length = 886

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 137/326 (42%), Gaps = 54/326 (16%)

Query: 530 IQVNGSEYEKVELLGRGGSSKVYKVRSSN-NKIYALKRVSFDEF-DDTSIDGFKGEIELL 587
           I V+   +EK++LLGRG   KVY V+  N N++YALK  S  E      I     E E+L
Sbjct: 470 ITVSPQSFEKIKLLGRGDVGKVYLVKEKNTNRLYALKIFSKAEMIKRKKIKRVLAEQEIL 529

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLK 646
               +   +V L         +Y  ME C   +  + L  R       E  +++A E+  
Sbjct: 530 A-TSNHPFIVTLYHSFQTEDYVYFCMEYCMGGEFFRALQTRKTKCICEEDAKFYASEVTA 588

Query: 647 CVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYR--------DTQI 697
            ++ +H  G ++ DLKP N +  K G + + DF ++    D  + + +        DT+I
Sbjct: 589 ALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKIPVMKGMDESTIIDTKI 648

Query: 698 -----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQ 746
                      GT  Y+APE +    +T                     D W+ G +IY+
Sbjct: 649 VSDGFRTNSFVGTEEYIAPEVIRGNGHTA------------------AVDWWTLGILIYE 690

Query: 747 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERR-- 804
           M++G  P+ G         I+  +V   +P    + + + R   D IK  L +N  +R  
Sbjct: 691 MLFGMTPFKGSNSNETFSNILKNDVS--FP----NNNDISRNCKDLIKKLLCKNENKRLG 744

Query: 805 --WTVDDLLRGPFIKPVSVTHFFIRD 828
                 D+ R PF + V  +  F+R+
Sbjct: 745 SKLGAADIKRHPFFRKVQWS--FLRN 768

>Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa]
           {ON} complement(128841..130379) [1539 nt, 513 aa]
          Length = 512

 Score = 93.2 bits (230), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 95/366 (25%), Positives = 160/366 (43%), Gaps = 77/366 (21%)

Query: 490 AVKKVEIIEPVKDTVIT--TIPLKPPSTENGSYQTPQR-KRQIIQVNGSEYEKVELLGRG 546
           A++K ++I P   + I   TI   P S E          KR  +  +  +++ V +LG+G
Sbjct: 65  ALEKFQVITPANSSKIKIPTIGTSPTSLEKSENLIESCIKRSSLSRDLYDFKPVRVLGKG 124

Query: 547 GSSKVYKVR-SSNNKIYALKRVSFDEF-----------DDTSIDGF--KGEIELLKRLE- 591
              KV  V+  S +K+YA+K++   E            DD ++D    K + +L KRLE 
Sbjct: 125 AYGKVILVKDKSTHKLYAMKQLKKAEIIIDNSNKEVDSDDDNLDNILTKSDSDLSKRLER 184

Query: 592 -----------DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRY 639
                      +   +VKL     +   LY++++     +L   L +   +  D   V +
Sbjct: 185 TFAEKTILSDLEHPNIVKLFYAFHDESKLYLLLQYIPGGELFFHLKEHGTLQEDT--VAF 242

Query: 640 HAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQ-- 696
           +  E+   ++ +H  GIV+ DLKP N +   +G L + DFG++    +   ++  D +  
Sbjct: 243 YTAEISCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKIAVEQNEDVGEDHEAE 302

Query: 697 ----------IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQ 746
                     IGTP Y APE L  + Y+           QN        D +S GC+IY 
Sbjct: 303 GENITELYSIIGTPEYCAPEILQGLPYS-----------QN-------CDWYSLGCLIYD 344

Query: 747 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIK----ACLERNPE 802
           M+ G+PPY G          +N ++ +   +K   G  +P    D +K    A L++  +
Sbjct: 345 MLIGKPPYTG----------VNHKIILNKIQKDKQGPKLPYYLSDGMKDVLGALLKKESK 394

Query: 803 RRWTVD 808
           +RW VD
Sbjct: 395 KRWDVD 400

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 135/295 (45%), Gaps = 45/295 (15%)

Query: 541 ELLGRGGSSKV-YKVRSSNNKIYALKRVSFDEFD------DTSID---------GFKGEI 584
           E LG G + KV      + N+  A+K +S   F+      +TS+          G + EI
Sbjct: 26  ETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSLPYGIEREI 85

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQE 643
            ++K L     V+ L D    +  LY+++E  +  +L  +L ++  +P + E VR+  Q 
Sbjct: 86  IIMKLLR-HANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP-EKEAVRFFRQ- 142

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNY 702
           ++  +   H  GIVH DLKP N +   K  +KI DFG+A      T +   +T  G+P+Y
Sbjct: 143 IIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ETEDKLLETSCGSPHY 199

Query: 703 MAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNR 762
            APE +  + Y                  G  SD+WSCG I++ ++ GR P+    G  R
Sbjct: 200 AAPEIVSGIPYH-----------------GFESDVWSCGVILFALLTGRLPFDEEDGNIR 242

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            L +     +   P+     D + R A D I   L  +P +R    ++L+ P ++
Sbjct: 243 NLLLKVQSGQFEMPD----DDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 134/292 (45%), Gaps = 42/292 (14%)

Query: 541 ELLGRGGSSKVYKVRSS-NNKIYALKRVSFDEFD------------DTSIDGFKGEIELL 587
           E LG G + KV   +++   +I A+K +S   F+            D    G + EI ++
Sbjct: 23  ETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGIEREIIIM 82

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K L +   V++L D       LY+V+E  +  +L  +L QR  +P + E VR+  Q ++ 
Sbjct: 83  KLL-NHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPEN-EAVRFFRQ-III 139

Query: 647 CVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   +T  G+P+Y AP
Sbjct: 140 GISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAP 196

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 765
           E +  + Y                  G  SD+WSCG I+Y ++ GR P+    G  R L 
Sbjct: 197 EIVSGLPYH-----------------GFESDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239

Query: 766 IMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           +     K   P +    D +   A D I   L   PE+R    ++L+ P ++
Sbjct: 240 LKVQSGKYEIPGE----DEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287

>TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3.338
           YPR054W
          Length = 430

 Score = 92.4 bits (228), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 150/333 (45%), Gaps = 28/333 (8%)

Query: 537 YEKVELLGRGGSSKVYKVR----SSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLED 592
           YE V++LG+G    V  VR    ++NN + A+K+++   + +  I     E++ +K    
Sbjct: 60  YEVVQVLGKGSYGIVCSVRDLNSNTNNALLAVKKITNIFYKEILIKRAIRELKFIKYFRG 119

Query: 593 QTRVVKLIDHEMN----HGVLYVVMECGDHDLSQVLAQRANMPFDIEF-VRYHAQEMLKC 647
              +V L+D ++     +  LY   E  D+DL++V+     +    EF ++Y   ++L  
Sbjct: 120 HKNIVSLLDVDIVLDAPYDGLYCYQELIDYDLAKVVHSSVLLT---EFHIKYFFYQILCG 176

Query: 648 VQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPE 706
           ++ +H   ++H DLKP N +  + G LKI DFG+A  +   TV    + Q  T   +   
Sbjct: 177 LKYIHSADVLHRDLKPGNILCTLNGTLKICDFGLARGI-SQTVLQKANRQNSTNEPVQYY 235

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
            L   NY   +     E+  +  +  K  DIWSCGCI+ +  YGR P   F G++ +  I
Sbjct: 236 NLDITNYVATRWYRAPELILSHNEYDKSIDIWSCGCILAEF-YGRKPV--FMGKDAMHQI 292

Query: 767 MNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFI 826
                 I  P K          +     + +    ++ W+         + P +      
Sbjct: 293 FEIIKVIGSPSKELLETYGSSKSWTVYNSNMINYKKKEWSE--------VYPHATAQ--A 342

Query: 827 RDLIKNAVKYGSDQRYVSKEKVED-LADDVWNR 858
            DL++N +K+ S  RY  +E +E     DV N+
Sbjct: 343 TDLMENLMKWVSKDRYTVEEAIEHPFLSDVRNK 375

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 137/302 (45%), Gaps = 37/302 (12%)

Query: 527 RQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEF-DDTSIDGFKGEI 584
           + II+    +++  E+LG G  S V    S+++ K YA+K ++ +       +     E 
Sbjct: 172 QHIIKKGIKDFKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEK 231

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFVRYHAQE 643
             L+RL +   V+KL     +   LY ++E   + D   V+ +  ++  + E  RY+  +
Sbjct: 232 NTLQRLNNSRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSL--NEECCRYYGAQ 289

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAV---PDHTVNIYRDTQ--I 697
           ML  +  +H  G+VH D+KP N +  + + +K+ DFG A  +        N+ + ++  +
Sbjct: 290 MLDAIDFIHKNGVVHRDIKPENILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSFV 349

Query: 698 GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 757
           GT  Y++PE L                  N   V    DIW+ GCI+YQMI G+PP   F
Sbjct: 350 GTAEYVSPELL------------------NDNCVNYKCDIWAFGCILYQMIAGKPP---F 388

Query: 758 QGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           +  N  L      +K+ Y    T G   P    D +K  L ++PE R     +    F K
Sbjct: 389 KATNEYLTFQK-VMKVQY--AFTAG--FPLVIRDLVKQLLVKSPEARLNASQVKSHHFFK 443

Query: 818 PV 819
            V
Sbjct: 444 SV 445

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 94.4 bits (233), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 137/295 (46%), Gaps = 47/295 (15%)

Query: 541 ELLGRGGSSKV-YKVRSSNNKIYALKRVSFDEFD-------------DTSIDGFKGEIEL 586
           E LG G + KV      S N+  A+K +S   F              D+   G + EI +
Sbjct: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGNNSSMVSSTPDSLSYGIEREIII 82

Query: 587 LKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEML 645
           +K L +   V++L D    +  LY+V+E  +  +L  +L ++  +P + E +R+  Q ++
Sbjct: 83  MKLL-NHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPEN-EAIRFFRQ-II 139

Query: 646 KCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMA 704
             +   H  GIVH DLKP N +    + +KI DFG+A      T +   +T  G+P+Y A
Sbjct: 140 IGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL---ETEDKLLETSCGSPHYAA 196

Query: 705 PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG--QNR 762
           PE +  + Y                  G  +D+WSCG I++ ++ GR P+    G  +N 
Sbjct: 197 PEIVSGLPYH-----------------GLETDVWSCGVILFALLTGRLPFDEEDGNIRNL 239

Query: 763 LLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           LL +   E ++         D + + A D +   L  +PE+R    ++L+ P ++
Sbjct: 240 LLKVQKGEFEM------PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 118/229 (51%), Gaps = 24/229 (10%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVS-FDEFDDTSIDGFKGEIELL 587
           +I+  G +Y +   LG GG ++ +++R  + K++A K V+      + +      EI++ 
Sbjct: 137 LIKTRGRDYHRGHFLGEGGFARCFQIRDDSGKLFAAKTVAKLSIKTEKTRKKLLSEIQIH 196

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K ++ Q  +V+ ID   +   +Y+++E C +  L ++L +R  +  + E VR+   ++  
Sbjct: 197 KSMKHQN-IVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLT-EPE-VRFFTTQICG 253

Query: 647 CVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            ++ +H   ++H DLK  N  F +   LKI DFG+A  + +     +  T  GTPNY+AP
Sbjct: 254 AIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKF--TVCGTPNYIAP 311

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           E L+  +     G + +             D+WS G ++Y ++ G+PP+
Sbjct: 312 EVLMGKH----SGHSYE------------VDVWSIGVMVYALLVGKPPF 344

>SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} similar
           to uniprot|P27636 Saccharomyces cerevisiae YAR019C CDC15
           Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p
          Length = 912

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 133/308 (43%), Gaps = 40/308 (12%)

Query: 512 PPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFD 570
           P +  + S             N + Y   +++G+G    VYK V     K  A+K + +D
Sbjct: 15  PATATDASTALATPSSATTTTNKTHYALKQVIGKGAYGIVYKAVNRQTRKEVAIKVIEYD 74

Query: 571 EFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRAN 629
             ++  ++    EI+LLK L     +VK          L +++E C    L  V  Q   
Sbjct: 75  --NEEELNDHMLEIDLLKNLR-HPNIVKYHGFIQKRHQLCILLEYCSRGSLRDVFKQH-- 129

Query: 630 MPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHT 688
            P D +  R + Q+ L+ +Q +H  G++H D+K AN +   +  +K+ DFG++       
Sbjct: 130 -PIDEQQARVYVQQTLQGLQYLHSQGVIHRDIKAANLLLDAQNTVKLADFGVST-----R 183

Query: 689 VNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMI 748
           VN    T  G+PN+M+PE ++    T                    SD+WS G  + +++
Sbjct: 184 VNSLAMTYAGSPNWMSPEVMLGKGAT------------------TVSDVWSLGATVVEIL 225

Query: 749 YGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVD 808
            G PP+     +    AI+N    + YP        + R   D I  C ++N  +R +  
Sbjct: 226 TGNPPFHNLVNEAACYAIVN---DVYYPPA-----WLSRPCCDFIHRCFQKNMFKRPSAT 277

Query: 809 DLLRGPFI 816
           +LL+  ++
Sbjct: 278 ELLKHAWV 285

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 133/292 (45%), Gaps = 42/292 (14%)

Query: 541 ELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFD------------DTSIDGFKGEIELL 587
           E LG G + KV   ++    +I A+K +S   F+            D    G + EI ++
Sbjct: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K L +   V++L D       LY+V+E  +  +L  +L +R  +P + E VR+  Q ++ 
Sbjct: 84  KLL-NHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPEN-EAVRFFRQ-III 140

Query: 647 CVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   +T  G+P+Y AP
Sbjct: 141 GISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAP 197

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 765
           E +  + Y                  G  SD+WSCG I+Y ++ GR P+    G  R L 
Sbjct: 198 EIVSGLPYH-----------------GFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL 240

Query: 766 IMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           +     +   P+K    D +   A D I   L  +P  R    ++L+ P +K
Sbjct: 241 LKVQSGEFEMPDK----DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 92.4 bits (228), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 141/308 (45%), Gaps = 66/308 (21%)

Query: 536 EYEKVELLGRGGSSKVYKVRSSN-NKIYALKR------------VSFDEFDDTS----ID 578
           +++ + +LG+G  SKV  V+  + NK+YA+K+            V  D  D T+    I+
Sbjct: 113 DFKPIRVLGKGAYSKVVLVKDHHSNKLYAMKQLKKAEILINEKEVREDSEDPTTLQKRIE 172

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFV 637
               E  +L +LE    VVKL     +H  LY++++     +L   L +R  +  D + V
Sbjct: 173 RTFAERIILSKLE-HPNVVKLFYSFHDHSKLYLILQYIPGGELFFHLKERGTL--DEDTV 229

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTV------- 689
            ++A E+   ++ +HD GIV+ DLKP N +   +G L + DFG++    D+         
Sbjct: 230 AFYAAEISVALKFLHDNGIVYRDLKPENCLLSQRGHLVLTDFGLSKEAVDNVSDNESTEL 289

Query: 690 ----NIYR-DTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCII 744
               +IY   + IGTP Y APE L  + Y                   K  D +S GC++
Sbjct: 290 NSPEDIYTLHSIIGTPEYAAPEILQGLPY------------------NKNCDWYSLGCLL 331

Query: 745 YQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIK----ACLERN 800
           + M+ G+PPY G           N +V +   +K   G  +P    D +K      L+++
Sbjct: 332 FDMLVGKPPYTG----------TNHKVILNKIQKDKQGPRIPFYLSDGMKDMLNWLLKKD 381

Query: 801 PERRWTVD 808
             +RW VD
Sbjct: 382 KTKRWDVD 389

>Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON}
           complement(6075..7199) [1125 nt, 375 aa]
          Length = 374

 Score = 90.9 bits (224), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 139/325 (42%), Gaps = 63/325 (19%)

Query: 535 SEYEKVELLGRGGSSKVYKV--RSSNNKIYALKRVSFDEFDDTS-IDGFKGEIELLKRLE 591
           S Y+ V+L+G G    V     + S  K+ A+K++    F  T  +     E++LLK   
Sbjct: 11  SHYQLVDLIGEGAYGTVCSAVHKPSGTKV-AIKKIQ--PFGKTMFVTRTLRELKLLKYFH 67

Query: 592 DQTRVVKLIDHEM-----NHGVLYVVMECGDHDLSQVLAQ--RANMPFDIEFVRYHAQEM 644
           +   ++ ++D        N   +Y+V E  + DL +V+    R N P   + ++Y   ++
Sbjct: 68  NHENIISILDKVRPISIDNLNAVYIVQELMETDLQKVIVNNNRKNTPLSDDHIQYFTYQV 127

Query: 645 LKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPD-----HTVNIYRDTQIG 698
           L+ ++ +H   ++H DLKP+N +      LKI DFG++  +        T+  +    + 
Sbjct: 128 LRALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLASSSDSKETLVGFMTEYVA 187

Query: 699 TPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQ 758
           T  Y APE ++          T QE            DIWSCGCI+ +M+ G+P + G  
Sbjct: 188 TRWYRAPEIML----------TFQE-------YTTAMDIWSCGCILAEMVSGKPLFPGRD 230

Query: 759 GQNRLLAIM------------------------NPEVKIVYPEKTTHG---DLVPRTALD 791
             ++L  I+                        N   K   P +   G   D +    LD
Sbjct: 231 YHHQLWLILEVLGTPSYDDFEQIKSKRAKEYIANLPFKSRLPWEMVLGREKDTLNPGILD 290

Query: 792 TIKACLERNPERRWTVDDLLRGPFI 816
            ++  L  NP +R + +D L  P++
Sbjct: 291 LLEKMLTFNPHKRISAEDALNHPYL 315

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 117/229 (51%), Gaps = 24/229 (10%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVS-FDEFDDTSIDGFKGEIELL 587
           +I+  G +Y +   LG GG ++ ++++  + KI+A K V+      + +      EI++ 
Sbjct: 74  LIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKSEKTRKKLLSEIQIH 133

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K ++ Q  VV+ ID   +   +Y+++E C +  L  +L +R  +  + E VR+   ++  
Sbjct: 134 KSMKHQN-VVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLT-EPE-VRFFTTQICG 190

Query: 647 CVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            ++ +H   ++H DLK  N  F +   LKI DFG+A  + +     Y  T  GTPNY+AP
Sbjct: 191 AIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAP 248

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           E L+  +     G + +             DIWS G ++Y ++ G+PP+
Sbjct: 249 EVLMGKH----SGHSYE------------VDIWSIGVMLYALLIGKPPF 281

>SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 368

 Score = 90.9 bits (224), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 137/320 (42%), Gaps = 53/320 (16%)

Query: 535 SEYEKVELLGRGG----SSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRL 590
           + Y+ V+L+G G      S V+K   +   I  ++  S   F   ++     E++LLK  
Sbjct: 11  AHYQLVDLIGEGAYGTVCSAVHKPSGTKVAIKKIQPFSKPLFVTRTL----RELKLLKFF 66

Query: 591 EDQTRVVKLID-----HEMNHGVLYVVMECGDHDLSQVLAQ---RANMPFDIEFVRYHAQ 642
            D   ++ ++D            +Y+V E  + DL +++A     +  P   + ++Y   
Sbjct: 67  HDHENIISVLDIVRPTSLAKFDAVYLVQELMETDLHRIIANSNGHSGTPLSDDHIQYFVY 126

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           +ML+ ++ +H   ++H DLKP+N +      LK+ DFG+A  +   + +  R+  +G   
Sbjct: 127 QMLRALKAMHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSSNS--RENLVG--- 181

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 761
           +M           P+   T QE            DIWSCGCI+ +MI G+P + G    +
Sbjct: 182 FMTEYVATRWYRAPEIMLTFQEYTTAM-------DIWSCGCILAEMITGKPLFPGRDYHH 234

Query: 762 RLLAIM------------------------NPEVKIVYPEKTTHGDLVPRTALDTIKACL 797
           +L  I+                        N  ++   P K   G  V   A+D +   L
Sbjct: 235 QLWLILEVLGTPSYQDFEQIKSKRAKEYIANLPLRPRVPWKIVLGQHVNPDAIDLLDKML 294

Query: 798 ERNPERRWTVDDLLRGPFIK 817
             NP++R    + L+ P++K
Sbjct: 295 TFNPDKRIGASEALKHPYLK 314

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 116/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + +I+A K V+       SI   K   +LL 
Sbjct: 74  LIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVA-----KASIKSEKTRKKLLS 128

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ ID   +   +Y+++E C +  L ++L +R  +  + E VR+   
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLT-EPE-VRFFTT 186

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F     LKI DFG+A  + + +   Y  T  GTPN
Sbjct: 187 QICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPN 244

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G ++Y ++ G+PP+
Sbjct: 245 YIAPEVLMGKH----SGHSFE------------VDIWSLGVMLYALLIGKPPF 281

>Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047W
           (REAL)
          Length = 905

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 136/330 (41%), Gaps = 61/330 (18%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDE----------FDD 574
           K Q I V    +EK+ LLG+G   KV+ VR    N++YALK +S DE            +
Sbjct: 488 KFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEMIKRNKIKRVLTE 547

Query: 575 TSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFD 633
                   E E+L    +   +V L     +   LY+ ME C   +  + L  R      
Sbjct: 548 NQTCSVLTEQEILA-TSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRETKCIC 606

Query: 634 IEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIY 692
            E  +++A E+   ++ +H  G ++ DLKP N +  + G + + DF ++    D  + + 
Sbjct: 607 EEDAKFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDSKIPVV 666

Query: 693 R--------DTQI-----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGK 733
           +        DT+I           GT  Y+APE +    +T                   
Sbjct: 667 KGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHT------------------A 708

Query: 734 PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTI 793
             D W+ G ++Y+M++G  P+ G         I+  EV   +P    + + + RT  D I
Sbjct: 709 AVDWWTLGILVYEMLFGFTPFKGDNTNETFTNILKNEVS--FP----NNNEISRTCKDLI 762

Query: 794 KACLERNPERRWTVD----DLLRGPFIKPV 819
           K  L +N  +R        D+ + PF K V
Sbjct: 763 KKLLTKNESKRLGCKMGAADVKKHPFFKKV 792

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 131/285 (45%), Gaps = 36/285 (12%)

Query: 536 EYEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           +Y  +  +G+G S  VY   +  +N++ A+K++  ++     +     EI ++K      
Sbjct: 516 QYANLTKIGQGASGGVYTANQVKSNELVAIKQMDLEKQPKKEL--ILNEIIVMKE-SRHN 572

Query: 595 RVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            VV  I+  ++ G L++VME  +   L+ V+         I  V    +E L+ ++ +H 
Sbjct: 573 NVVNFINAHLSKGNLWIVMEYMEGGSLTDVVTHCLLSEGQIGAV---CRETLEGLKFLHS 629

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K  N +  +KG +K+ DFG    + D  +++ R T +GTP +MAPE +    
Sbjct: 630 KGVIHRDIKSDNVLLSMKGDIKLTDFGFCAQIND--IDLNRTTMVGTPYWMAPEVVSRKE 687

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEV 771
           Y P              KV    DIWS G +I +MI G PPY        L L   N   
Sbjct: 688 YGP--------------KV----DIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTP 729

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           K+  PE  +    V    LD    CL   PE R +  +LL   F+
Sbjct: 730 KLKEPENLSD---VFSNFLD---RCLRVEPEERASAIELLADEFV 768

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 116/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + +I+A K V+       SI   K   +LL 
Sbjct: 74  LIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVA-----KASIKSEKTRKKLLS 128

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ ID   +   +Y+++E C +  L ++L +R  +  + E VR+   
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLT-EPE-VRFFTT 186

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F     LKI DFG+A  + + +   Y  T  GTPN
Sbjct: 187 QICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPN 244

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G ++Y ++ G+PP+
Sbjct: 245 YIAPEVLMGKH----SGHSFE------------VDIWSLGVMLYALLIGKPPF 281

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 139/303 (45%), Gaps = 41/303 (13%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF-DDTSID 578
           +T Q  +Q+I+    +++  E++G G  S V    S  + K YA+K ++ +       + 
Sbjct: 154 ETGQTTKQVIKKGIKDFKFGEMIGDGAYSTVLLATSIDSGKKYAVKVLNKEYLIRQKKVK 213

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFV 637
               E   L+RL +   +++L     +   LY ++E   + D   V+ +  ++  + E  
Sbjct: 214 YVNIEKIALQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDFLSVMKKYGSL--NEECA 271

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHT-------- 688
            Y+  ++L  +  +H  GI+H D+KP N +  K + +KI DFG A  + + T        
Sbjct: 272 CYYGAQILDAIGFMHTRGIIHRDIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKTSY 331

Query: 689 -VNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQM 747
            +     + +GT  Y++PE L+  NY+  +                  DIW+ GCI+YQM
Sbjct: 332 ELLTRSKSFVGTAEYVSPE-LLNDNYSDSR-----------------CDIWAFGCILYQM 373

Query: 748 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTV 807
           I G+PP   F+  N  L      +K+ Y    T G   P    D IK  L + PE+R T+
Sbjct: 374 IAGKPP---FKATNEYLTFQK-VMKVQYA--FTAG--FPTIIRDLIKRILLKVPEQRLTI 425

Query: 808 DDL 810
             +
Sbjct: 426 GQI 428

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 115/243 (47%), Gaps = 36/243 (14%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L     V+ L++   N   LY+V+E  D  +L   L  +  +  + E V
Sbjct: 172 GIEREIVIMK-LISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLS-EPEAV 229

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG--ILKIIDFGIAN-AVPDHTVNIYRD 694
            Y  Q +++ V   H   I H DLKP N +  K   ++KI DFG+A   +P+  +    +
Sbjct: 230 HYFTQ-IIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNKLL----E 284

Query: 695 TQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           T  G+P+Y +PE ++   Y                  G PSD+WSCG I++ ++ G  P+
Sbjct: 285 TSCGSPHYASPEIVMGKPYH-----------------GGPSDVWSCGIILFALLTGHLPF 327

Query: 755 GGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGP 814
                +  LL +     ++  P   T+       A D I   L  NPE+R T++++L  P
Sbjct: 328 NDDNIKKLLLKVQAGRFQL--PPYLTND------AKDLITRILVTNPEKRLTINEILNHP 379

Query: 815 FIK 817
            IK
Sbjct: 380 LIK 382

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 137/303 (45%), Gaps = 40/303 (13%)

Query: 537 YEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
           Y  +  +G+G S  VY     S N+  A+K+++ ++     +     EI L+ +      
Sbjct: 627 YTNLVKIGQGASGGVYIANDVSTNESIAIKQMNLEKQPKKEL--IINEI-LVMKGSKHPN 683

Query: 596 VVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           +V  ID  +  G L+V+ME  +   L+ V+         I  V    +E L  +Q +H  
Sbjct: 684 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLSGLQFLHSK 740

Query: 655 GIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
           G++H D+K  N +  + G +K+ DFG    V + T  + R T +GTP +MAPE +    Y
Sbjct: 741 GVLHRDIKSDNILLSINGNIKLTDFGFCAQVNETT--LKRTTMVGTPYWMAPEVVSRKEY 798

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPE 770
            P              KV    DIWS G +I +MI G PPY        L  I     PE
Sbjct: 799 GP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPE 840

Query: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLI 830
           +K    E+    D++ +  LD    CL  NP++R +  +LL   FI   +  +  +  L+
Sbjct: 841 LK----EREKLSDVL-KHFLD---WCLSVNPDQRASATELLEDVFITEYADANESLAPLV 892

Query: 831 KNA 833
           K A
Sbjct: 893 KLA 895

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 114/233 (48%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + K++A K V+       SI   K   +LL 
Sbjct: 65  LIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKVFAAKTVA-----KISIKSEKTRKKLLS 119

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+  D   +   +Y+++E C +  L  +L QR  +  + E VR+   
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLT-EPE-VRFFTT 177

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           +++  ++ +H   I+H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 178 QIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TICGTPN 235

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L   +     G + +             DIWS G +IY ++ G+PP+
Sbjct: 236 YIAPEVLTGKH----TGHSFE------------VDIWSIGVMIYALLIGKPPF 272

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 119/229 (51%), Gaps = 24/229 (10%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFD-DTSIDGFKGEIELL 587
           +I+  G +Y + + LG GG ++ ++++  + KI+A K V+      + +      EI++ 
Sbjct: 134 LIKTRGRDYRRGQFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTRRKLLSEIQIH 193

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVM-ECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K ++ Q  +V+ +D   +H  +Y+++  C +  L ++L +R  +  + E VR+   ++  
Sbjct: 194 KSMKHQN-IVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILT-EPE-VRFFTVQICG 250

Query: 647 CVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            ++ +H   ++H DLK  N  F +   LKI DFG+A  + +     Y  T  GTPNY+AP
Sbjct: 251 AIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAP 308

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           E L+  +     G + +             DIWS G +I+ ++ G+PP+
Sbjct: 309 EVLLGKH----SGHSYE------------VDIWSIGVMIFALLIGKPPF 341

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 116/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + +I+A K V+       SI   K   +LL 
Sbjct: 74  LIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVA-----KASIKSEKTRKKLLS 128

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ +D   +   +Y+++E C +  L ++L +R  +  + E VR+   
Sbjct: 129 EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLT-EPE-VRFFTT 186

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F     LKI DFG+A  + + +   Y  T  GTPN
Sbjct: 187 QICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPN 244

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G ++Y ++ G+PP+
Sbjct: 245 YIAPEVLMGKH----SGHSFE------------VDIWSLGVMLYALLIGKPPF 281

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 114/241 (47%), Gaps = 29/241 (12%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L +   V++L D       LY+V+E  +  +L  +L +R  +P + E V
Sbjct: 72  GIEREIIIMKLL-NHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLP-ENEAV 129

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQ 696
           R+  Q ++  +   H  GIVH DLKP N +   K  +K+ DFG+A      + +   +T 
Sbjct: 130 RFFRQ-IIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAAL---ESKDKLLETS 185

Query: 697 IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            G+P+Y APE +  + Y                  G  SD+WSCG I+Y ++ GR P+  
Sbjct: 186 CGSPHYAAPEIVSGLPYH-----------------GFESDVWSCGVILYALLTGRLPFDE 228

Query: 757 FQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
             G  R L +     K   P      D +   A D I   L  +PE+R    ++L+ P +
Sbjct: 229 EDGNIRNLLLKVQSGKFEMP----GDDEISSEAQDLIARILTVDPEQRIKTREILKHPLL 284

Query: 817 K 817
           +
Sbjct: 285 R 285

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 110/241 (45%), Gaps = 34/241 (14%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L     V+ L +   N   LY+V+E  D  +L   L  R  +  + E V
Sbjct: 162 GIEREIVIMK-LISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSRGRL-CEREAV 219

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK--GILKIIDFGIANAVPDHTVNIYRDT 695
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A        N    T
Sbjct: 220 HYFKQ-IIQGVSYCHAFNICHRDLKPENLLLDKKNSTIKIADFGMAAL---EVSNKLLQT 275

Query: 696 QIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 755
             G+P+Y +PE ++   Y                  G PSD+WSCG I++ ++ G  P+ 
Sbjct: 276 SCGSPHYASPEIVMGKQYH-----------------GGPSDVWSCGIILFALLTGHLPFN 318

Query: 756 GFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPF 815
               +  LL + + + ++  P+       + + A D I   L  NP +R T +++LR P 
Sbjct: 319 DDSIKKLLLKVQSGKYQM--PQN------LSKEAQDLIAKILTVNPAKRLTTEEILRHPL 370

Query: 816 I 816
           I
Sbjct: 371 I 371

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 126/296 (42%), Gaps = 53/296 (17%)

Query: 541 ELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E LG G + KV   +        A+K +S   F+     G  G + L   +E +  ++KL
Sbjct: 25  ETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNHGSV-LPYNIEREIVIMKL 83

Query: 600 IDHEMNHGV---------LYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKC-- 647
           + H    G+         LY+++E  +  +L  +L  R  +P          +E +KC  
Sbjct: 84  LSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALP---------EREAMKCFR 134

Query: 648 -----VQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
                V   H  GIVH DLKP N +      +K+ DFG+A    D  +    +T  G+P+
Sbjct: 135 QIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAAL---LETSCGSPH 191

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 761
           Y APE +  + Y                  G  SD+WSCG I++ ++ GR P+    G  
Sbjct: 192 YAAPEIVSGLPYE-----------------GFSSDVWSCGVILFALLTGRLPFDEENGNI 234

Query: 762 RLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           R L +     +   P+ T     + + A D I   L  +P +R  + D+L  P +K
Sbjct: 235 RTLLLKVQRGQFEMPDDTE----ISKDAQDLISKILVVDPAQRIKIRDILSHPLLK 286

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 115/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  +  I+A K V+       SI   K   +LL 
Sbjct: 74  LIKTRGKDYHRGHFLGEGGFARCFQIKDDSGDIFAAKTVA-----KASIKSEKTRKKLLS 128

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ ID   +   +Y+++E C +  L ++L +R  +  + E VR+   
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLS-EPE-VRFFTT 186

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F     LKI DFG+A  + + +   Y  T  GTPN
Sbjct: 187 QICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPN 244

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G ++Y ++ G+PP+
Sbjct: 245 YIAPEVLMGKH----SGHSFE------------VDIWSLGVMLYALLIGKPPF 281

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 114/233 (48%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++  + KI+A K V+       SI   K   +LL 
Sbjct: 65  LIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKIFAAKTVA-----KISIKSEKTRKKLLS 119

Query: 589 RLEDQT-----RVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+  D   +   +Y+++E C +  L  +L QR  +  + E VR+   
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLT-EPE-VRFFTT 177

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           +++  ++ +H   I+H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 178 QIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TICGTPN 235

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L   +     G + +             D+WS G +IY ++ G+PP+
Sbjct: 236 YIAPEVLTGKH----TGHSFE------------VDVWSIGVMIYALLIGKPPF 272

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 140/318 (44%), Gaps = 68/318 (21%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALK-----------RVS 568
           +T Q K++II+   ++++  E++G G  S V  V+S   NK +A+K           +V 
Sbjct: 243 KTGQLKKEIIKKGINDFKFGEVIGDGSYSTVNLVKSKETNKTFAIKILNKKYLIKQKKVK 302

Query: 569 FDEFDDTSI----DGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVL 624
           +   +  ++    +   G I+L    +D+  +  L+++  N  +L ++ + G  D +  +
Sbjct: 303 YVNIEKIALQKLNNSINGIIKLYCTFQDEANLYFLLEYASNGDLLTLLKKYGSFDETSTI 362

Query: 625 AQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANA 683
                         Y   +++  +  +H  GI+H D+KP N +  K   +K+ DFG A  
Sbjct: 363 --------------YFTAQIIDSIHYIHSMGIIHRDIKPENILLTKDFKIKLTDFGTAKI 408

Query: 684 VPDHT---------VNIYRDTQ--IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVG 732
           +              N+   ++  +GT  Y++PE L+  +YT  +               
Sbjct: 409 LDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPE-LLTDSYTDSR--------------- 452

Query: 733 KPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDT 792
              DIW+ GCI++Q+I G+PP   F+  N  L      +K+ Y    T G   P    D 
Sbjct: 453 --CDIWAFGCILFQLIAGKPP---FKATNEYLTFQKI-IKLQYA--FTAG--FPTILRDL 502

Query: 793 IKACLERNPERRWTVDDL 810
           IK  L +NP  R T+  +
Sbjct: 503 IKKILIKNPNNRLTIHQI 520

>CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa]
           {ON} highly similar to uniprot|P12688 Saccharomyces
           cerevisiae YKL126w Serine/threonine-protein kinase
          Length = 703

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 134/302 (44%), Gaps = 38/302 (12%)

Query: 536 EYEKVELLGRGGSSKVYKVRSSNNK-IYALKRVSFDEFDDTS-IDGFKGEIELLKRLEDQ 593
           +++ ++++G+G   KV +VR  + K IYALK +        S +     E  +L R+ D 
Sbjct: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARI-DC 427

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
             +V L     +   LY+V+ C +        QR    FD+   R++A E+L  +  +H 
Sbjct: 428 PFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGR-FDLSRSRFYAAELLCALDTLHK 486

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANA-VPDHTVNIYRDTQIGTPNYMAPEALVAM 711
             +++ DLKP N +   +G + + DFG+    + D       DT  GTP Y+APE L+  
Sbjct: 487 MDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKT---DTFCGTPEYLAPELLLGQ 543

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y+                  K  D W+ G ++Y+M+ G PPY           I+  + 
Sbjct: 544 GYS------------------KVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKIL--QD 583

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRW---TVDDLLRGPFIKPVSVTHFFIRD 828
            +V+P      D   R A D +   L R+P+RR      D++   PF   +S     ++ 
Sbjct: 584 PLVFP------DGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKG 637

Query: 829 LI 830
            I
Sbjct: 638 YI 639

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 116/229 (50%), Gaps = 24/229 (10%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVS-FDEFDDTSIDGFKGEIELL 587
           +I+  G +Y +   LG GG ++ ++++  + KI+A K V+      + +      EI++ 
Sbjct: 84  LIKTRGRDYRRGHFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIH 143

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K ++    +V  +D   +   +Y+++E C +  L  ++ +R  +  + E VR+   ++  
Sbjct: 144 KSMK-HPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLT-EPE-VRFFTTQICG 200

Query: 647 CVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            V+ +H   ++H DLK  N  F K   LK+ DFG+A  + ++    Y  T  GTPNY+AP
Sbjct: 201 AVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKY--TVCGTPNYIAP 258

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           E L+  +     G + +             DIWS G +IY ++ G+PP+
Sbjct: 259 EVLMGKH----AGHSFE------------VDIWSIGVMIYALLVGKPPF 291

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 141/289 (48%), Gaps = 24/289 (8%)

Query: 539 KVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVV 597
           K E++G+G  + V K V  S  K +A+K ++  +    ++DG   E+++L++L D  R+V
Sbjct: 195 KDEVVGQGAFAIVKKAVERSTGKTFAVKIINKRKVMG-NMDGVTRELDVLRKL-DHPRIV 252

Query: 598 KLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGI 656
           +L     +    Y++ME     DL   +A   ++  D    R   +++L+ V+ +H  GI
Sbjct: 253 RLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVKYIHLQGI 310

Query: 657 VHSDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            H DLKP N +  +    ++KI DFG+A    + T   +  T  GT  Y+APE +     
Sbjct: 311 SHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPEVI----- 362

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
               G+   E  ++R +     D+WS GC++Y ++ G  P+ G   Q++L   +    + 
Sbjct: 363 ---GGKNSAEENEDRIEYSSLVDMWSIGCLVYVILTGHLPFSG-STQDQLYKQI---CRG 415

Query: 774 VYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVT 822
            Y E       +   A D I + L+ +P +R T    L  P+IK  + T
Sbjct: 416 SYHEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIKMGTYT 464

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 126/288 (43%), Gaps = 36/288 (12%)

Query: 535 SEYEKVELLGRGGSSKVYKV-RSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S +++ E++GRG    VYK       ++YA+K ++ D  +D  ++  + EI+ L  L+  
Sbjct: 14  SLFKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTED-EVEDIRKEIQFLSSLKQT 72

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIE--FVRYHAQEMLKCVQV 650
             +       +    L+V+ME C    L  +L      P  IE  ++    +E+L  +  
Sbjct: 73  PNITHYYGSYLIDTKLWVIMEYCAGGSLRTLL-----RPGIIEEKYIGVIMREILVALIS 127

Query: 651 VHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALV 709
           +H   ++H D+K AN +    G +K+ DFG+A  +    +   R T  GTP +MAPE ++
Sbjct: 128 IHRDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIM 185

Query: 710 AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 769
              Y   +                  DIWS G   Y++  G PPY   +    +  I   
Sbjct: 186 EGVYYDTK-----------------VDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKS 228

Query: 770 EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
           +     P +   G    +   + I  CL+ +P+ R   ++L +   IK
Sbjct: 229 K-----PPR-LEGREYSQPLKEFIALCLDEDPKERPYAEELFKSKLIK 270

>KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3.92
           YDR490C
          Length = 1095

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 141/315 (44%), Gaps = 44/315 (13%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEF-DDTSID 578
           +T +R R++++    ++   + +G G  S V    S ++ + YA+K ++ +       + 
Sbjct: 131 RTGERTRRVVKRGIKDFAFGDTIGDGAYSTVVLATSKDSGRKYAVKMLNKEYLIRQKKVK 190

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFV 637
               E   L+R+ D   VV+L     +   LY ++E   + D   ++ +  ++  D    
Sbjct: 191 YVNIEKNALQRVNDSPMVVRLFFTFQDEASLYFLLEFAPNGDFLSLMKKFGSLNEDA--A 248

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAV------------ 684
           +Y++ +++  +  +H  GIVH D+KP N +  K   +KI DFG A  +            
Sbjct: 249 KYYSAQIIDAIGFLHSRGIVHRDMKPENILLDKNWKIKITDFGTAKILEKTAQQEAGGSG 308

Query: 685 PDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCII 744
           P++ +     + +GT  Y++PE L                  N   V    DIW+ GCI+
Sbjct: 309 PEYNLLTRSKSFVGTAEYVSPELL------------------NDSFVDYRCDIWAFGCIV 350

Query: 745 YQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERR 804
           YQM+ G+PP   F+  N  L      +K+ Y    T G   P    D +K  L ++ ++R
Sbjct: 351 YQMLAGKPP---FKATNEYLTFQK-VMKVQY--AFTAG--FPLVIRDLVKRILVKDLDKR 402

Query: 805 WTVDDLLRGPFIKPV 819
            TV  + R  F K V
Sbjct: 403 LTVQQIQRHHFFKGV 417

>NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446
          Length = 684

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 135/304 (44%), Gaps = 42/304 (13%)

Query: 536 EYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEFDDTS-IDGFKGEIELLKRLEDQ 593
           +++ ++++G+G   KV +VR  +  KIYALK +        S +     E  +L R+ D 
Sbjct: 350 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARI-DC 408

Query: 594 TRVVKLIDHEMNHGVLYVVMEC-GDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             +V L     +   LY+V+ C    +L   L +     FD+   R++A E+L  ++ +H
Sbjct: 409 PFIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGR--FDLSRSRFYAAELLCALETLH 466

Query: 653 DTGIVHSDLKPANFVF-VKGILKIIDFGIA--NAVPDHTVNIYRDTQIGTPNYMAPEALV 709
           +  +++ DLKP N +   +G + + DFG+   N   D       DT  GTP Y+APE L+
Sbjct: 467 NLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT----DTFCGTPEYLAPELLL 522

Query: 710 AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 769
              YT                  K  D W+ G ++Y+M+ G PPY           I+  
Sbjct: 523 GQGYT------------------KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQD 564

Query: 770 EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTV---DDLLRGPFIKPVSVTHFFI 826
            ++  +P      D   R A D +   L R+P RR      D++   PF   +S     +
Sbjct: 565 PLR--FP------DGFDRDAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFSQLSWKRLLM 616

Query: 827 RDLI 830
           +  I
Sbjct: 617 KGYI 620

>KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.371
           YCR091W
          Length = 786

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 150/366 (40%), Gaps = 71/366 (19%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF-DDTSIDGFKGE 583
           K Q I+V+   +EK+ LLG+G   KVY V+  ++N++YALK ++  E      I     E
Sbjct: 357 KFQDIRVSPQSFEKIRLLGQGDVGKVYLVKEKASNRLYALKILTKGEMIKRKKIKRILTE 416

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L    +   +V L         LY+ ME C   +  + L  R +        R++A 
Sbjct: 417 QEILAS-SNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKSKCISEGDARFYAS 475

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPD--------------- 686
           E+   ++ +H  G ++ DLKP N +  K G + + DF ++    D               
Sbjct: 476 EVTAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVQANDSGKVKTPMIITPPSS 535

Query: 687 ------HTVNIYRDTQ-----------IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRW 729
                    N   DT+           +GT  Y+APE +    +T               
Sbjct: 536 SSSGKRSRSNTMIDTKVFSDGFRTNSFVGTEEYIAPEVIRGNGHTA-------------- 581

Query: 730 KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTA 789
                 D W+ G +IY+M++G  P+ G         I+  EV   +P    + + V R  
Sbjct: 582 ----AVDWWTLGILIYEMLFGFTPFKGSNTNETFCNILKNEV--TFP----NNNDVSRNC 631

Query: 790 LDTIKACLERNPERR----WTVDDLLRGPFIKPVSVTHFFIRD----LIKNAVKYGSDQR 841
            D IK  L +N ++R        D+ R PF K V  +  F+R+    LI    + G D  
Sbjct: 632 KDLIKKLLCKNEQKRLGSKMGAADIKRHPFFKKVQWS--FLRNQEPPLIPVLTENGYDFT 689

Query: 842 YVSKEK 847
            +SK K
Sbjct: 690 KLSKNK 695

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 140/318 (44%), Gaps = 49/318 (15%)

Query: 522 TPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF-DDTSIDG 579
           T +  RQ+++    +++  E LG G  S V    S  + K YA+K +S +       +  
Sbjct: 152 TGKTTRQVVKKGIKDFKFGETLGDGSYSTVMLATSKESGKKYAVKVLSKEYLIRQKKVKY 211

Query: 580 FKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFVR 638
              E   L+RL +   +VKL     +   LY ++E   + D   ++ +  ++  D     
Sbjct: 212 VNIEKNALQRLNNSRGIVKLYFTFQDESSLYFLLEYAPNGDFLSIMKKYGSLNEDCAC-- 269

Query: 639 YHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIA-------NAVPDHTVN 690
           Y++ +++  +  +H  GIVH D+KP N +  K   +K+ DFG A       N    + + 
Sbjct: 270 YYSAQIIDAIDFLHSKGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLL 329

Query: 691 IYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYG 750
               + +GT  Y++PE L+  NY                 V    DIW+ GCI++QMI G
Sbjct: 330 SRSKSFVGTAEYVSPE-LLNDNY-----------------VDYRCDIWAFGCILFQMIAG 371

Query: 751 RPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDL 810
           +PP   F+  N  L      +K+ Y    T G   P    D +K  L + P +R T+   
Sbjct: 372 KPP---FKATNEYLTFQK-VMKVQY--AFTAG--FPLVVRDLVKGILIKQPAQRLTI--- 420

Query: 811 LRGPFIKPVSVTHFFIRD 828
              P IK    +H F +D
Sbjct: 421 ---PQIK----SHHFFKD 431

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 114/233 (48%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++    + KI+A K V+       SI   K   +LL 
Sbjct: 75  LIKTRGRDYHRGHFLGEGGFARCFQFNDDSGKIFAAKTVA-----KLSIKSEKTRRKLLS 129

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+ ID   +   +Y+++E C +  L  +L +R ++  + E VR+   
Sbjct: 130 EIQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLT-EPE-VRFFTT 187

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   ++ +H   ++H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 188 QICGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKY--TVCGTPN 245

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L+  +     G + +             DIWS G ++Y ++ G+PP+
Sbjct: 246 YIAPEVLMGKH----TGHSYE------------VDIWSIGVMLYALLIGKPPF 282

>TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON}
            Anc_6.371 YCR091W
          Length = 1248

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/359 (24%), Positives = 151/359 (42%), Gaps = 66/359 (18%)

Query: 508  IPLKPPSTENGSYQTPQRKRQI-----------IQVNGSEYEKVELLGRGGSSKVYKVRS 556
            IP++PP   +  ++ P+R  ++           I V  + +EK+ LLG+G   KVY V+ 
Sbjct: 813  IPIEPPKFVDD-FEEPKRSNRLRTKSFSNKFKDITVGPTSFEKIRLLGQGDVGKVYLVKE 871

Query: 557  -SNNKIYALKRVSFDEF-DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME 614
             S +++YALK  +  +      I     E E+L    +   +V L     +   LY+ +E
Sbjct: 872  KSTSRLYALKIFNKSQMIKRKKIKRVLAEQEILAS-SNHPFIVTLYHSFQSEDYLYLCIE 930

Query: 615  -CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG-- 671
             C   +  + L  R +     +  R++A E+   ++ +H  G ++ DLKP N +  K   
Sbjct: 931  YCMGGEFFRALQTRRSKCISEDAARFYASEVTAALEYLHLMGYIYRDLKPENILLHKSGH 990

Query: 672  -ILKIIDFGIANAVPDHTV------NIYRDTQI-----------GTPNYMAPEALVAMNY 713
             +L   D  I + V  + V      +   DT+I           GT  Y+APE +    +
Sbjct: 991  IMLSDFDLSIQSKVAKNPVVKKFNQSSLVDTKICSEGFRTNSFVGTEEYIAPEVIRGNGH 1050

Query: 714  TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI 773
            T                     D W+ G +IY+M++G  P+ G         I+  EV  
Sbjct: 1051 TA------------------AVDWWTLGILIYEMLFGFTPFKGDSTNETFSNILKNEVS- 1091

Query: 774  VYPEKTTHGDLVPRTALDTIKACLERNPERR----WTVDDLLRGPFIKPVSVTHFFIRD 828
             +P    + + + R   D IK  L +N  +R        D+ R PF K V  +  F+R+
Sbjct: 1092 -FP----NNNDITRNCKDVIKKLLTKNENKRLGSKMGAADIKRHPFFKKVQWS--FLRN 1143

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 137/285 (48%), Gaps = 24/285 (8%)

Query: 541 ELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E++G+G  + V K V  +  K +A+K ++  +    ++DG   E+E+L+RL +  R+V L
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMG-NVDGVTRELEVLRRL-NHPRIVSL 278

Query: 600 IDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
                +    Y++ME     DL   +A   ++  D    R   +++L+ V+ +H+ GI H
Sbjct: 279 KGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVRYIHEQGISH 336

Query: 659 SDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTP 715
            DLKP N +  +    ++KI DFG+A  + D+T   +  T  GT  Y+APE +   N  P
Sbjct: 337 RDLKPDNILIEQDDPVLVKITDFGLAK-IQDNTT--FMKTFCGTLAYVAPEVIGGKN--P 391

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
           +       +  +        D+WS GC++Y ++ G  P+ G   +     I N      Y
Sbjct: 392 EGNGANGNLYSSL------VDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGS----Y 441

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVS 820
            E       +   A D I + L+ NP  R T +  L+ P++ P +
Sbjct: 442 HEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCT 486

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 137/299 (45%), Gaps = 43/299 (14%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEF-DDTSIDGFKGEIELL 587
           +I+  G +Y +   LG GG ++ ++++  + K++A K V+      + + +    EI++ 
Sbjct: 90  LIKSKGKDYYRGHFLGEGGFARCFQMKDDDGKVFAAKTVAKISIKSEKARNKLLSEIQIH 149

Query: 588 KRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLK 646
           K +  Q  +V  ID   +   +Y+++E C +  L  +L +R  +  + E VR+   ++  
Sbjct: 150 KNMRHQN-IVHFIDCFEDDINVYILLEICPNGSLMDLLKRRKILT-EPE-VRFFTTQICG 206

Query: 647 CVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP 705
            +  +H   I+H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPNY+AP
Sbjct: 207 ALDHMHSRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAIINNENERKY--TICGTPNYIAP 264

Query: 706 EALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLA 765
           E ++         +                DIWS G +I+ MI G+PP   FQ +     
Sbjct: 265 EVIMGGKQIGHSFEV---------------DIWSLGVMIFAMITGKPP---FQAK----- 301

Query: 766 IMNPEVKIVYPEKTTHGD-------LVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
               EV  +Y ++  H +        V +     I+  L  NP  R T+ ++L   + K
Sbjct: 302 ----EVSTIY-DRIKHCNYSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEILNYNWFK 355

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 116/233 (49%), Gaps = 32/233 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+  G +Y +   LG GG ++ ++++    K++A K V+       SI   K   +LL 
Sbjct: 82  LIKTRGRDYHRGHFLGEGGFARCFQMKDDKGKVFAAKTVA-----KLSIKSEKTRRKLLS 136

Query: 589 RLE-----DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++         +V+  D   +   +Y+++E C +  + ++L QR ++  + E VR+   
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLT-EPE-VRFCMI 194

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           +++  ++ +H   ++H DLK  N  F K   LKI DFG+A  + +     Y  T  GTPN
Sbjct: 195 QIIGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKY--TICGTPN 252

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           Y+APE L   +     G + +             DIWS G ++Y +++G+PP+
Sbjct: 253 YIAPEVLTGKH----TGHSYE------------VDIWSIGVMLYALLFGKPPF 289

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 127/284 (44%), Gaps = 28/284 (9%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           S ++  E +GRG    VYK   +  K Y   +V   E+ D  ID    EI  L  L+   
Sbjct: 14  SLFDIKECVGRGNFGDVYKAIDNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELKSD- 72

Query: 595 RVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            ++  I   M    +++VM+ CG    S ++          E V +  + +L  +Q +H+
Sbjct: 73  YIINYITTIMEDVSMWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHE 132

Query: 654 TGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
              +H D+K AN +    G +K+ DFG++  +      + RDT +GTP +MAPE +   N
Sbjct: 133 QKKIHRDIKAANILLTDDGQVKLGDFGVSGQIK---ATLKRDTFVGTPYWMAPEVI---N 186

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
              + G  E+             DIWS G   Y+++ G PP   +      + +M   VK
Sbjct: 187 KEINNGYDEK------------VDIWSLGITTYELLKGVPPLSKYDP----VKVMTSLVK 230

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
              P+   HG     T    I  CL ++P+ R  V +LL+  FI
Sbjct: 231 RKPPK--LHGPYNDFTK-SFISFCLIKDPKLRPNVQNLLKTDFI 271

>KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 519

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 91/339 (26%), Positives = 157/339 (46%), Gaps = 79/339 (23%)

Query: 515 TENGSYQTPQRKRQIIQVNG----SEYEKVELLGRGGSSKVYKVRSSN-NKIYALKRVSF 569
           + N SY +P     ++Q +G     +++ + +LGRG   KV  VR S+ +++YA+K++  
Sbjct: 102 SNNSSYCSPS----VLQKHGMRSLEDFKPIRVLGRGAYGKVLLVRDSHTHRLYAMKQLKK 157

Query: 570 DEF----------DDTSIDGFKGEIE-------LLKRLEDQTRVVKLIDHEMNHGVLYVV 612
            E           ++T  D  +  +E       +L +LE    +VKL     +H  LY+V
Sbjct: 158 AEILIHEDKSSDTEETKDDALEKRLERTFAERIILSQLE-HPNIVKLFYSFHDHHKLYLV 216

Query: 613 ME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VK 670
           ++     +L   L ++  +  D   V ++A E+   ++ +H+ GIV+ DLKP N +   +
Sbjct: 217 LQFIPGGELFYHLKEQGTL--DENTVTFYAAEISCALKFLHERGIVYRDLKPENCLLDER 274

Query: 671 GILKIIDFGIA-----------------NAVPDHT---VN-IYRDTQIGTPNYMAPEALV 709
           G L + DFG++                 +A+  H+   VN +Y  + IGTP Y APE L 
Sbjct: 275 GHLVLTDFGLSKKSAADSDTPERSDIDGDALNSHSGEPVNKLY--SIIGTPEYCAPEILE 332

Query: 710 AMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP 769
              YT           QN        D +S GC+++ M+ G+PPY G   +  L  I+  
Sbjct: 333 GKPYT-----------QN-------CDWYSLGCLVFDMLIGKPPYTGVNHKVILGKILKD 374

Query: 770 EVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVD 808
           +   + P   + G        D + A L+++  +RW VD
Sbjct: 375 KTPKI-PSYLSEG------MKDYLGALLKKDVTKRWDVD 406

>CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} similar
           to uniprot|P14681 Saccharomyces cerevisiae YGR040w KSS1
          Length = 398

 Score = 89.0 bits (219), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/334 (23%), Positives = 140/334 (41%), Gaps = 66/334 (19%)

Query: 536 EYEKVELLGRGGSSKVYKVRS--SNNKIYALKRVSF------------------DEFDDT 575
           EY+ V+L+G G    V       + NK+ A+KR+ F                  DE D+ 
Sbjct: 12  EYKLVDLVGEGSYGIVCSATHLPTGNKV-AIKRIRFPDSPPSDDGQGVPRLEEDDEHDNI 70

Query: 576 SIDGFKG---EIELLKRLEDQTRVVKLID-----HEMNHGVLYVVMECGDHDLSQVLAQR 627
           +         EI++L    +   ++ + +       +N   +Y+V E  + DLS++LA  
Sbjct: 71  AKVALIRTIREIKILSHFNNHENIITIFEKIKPMQSINFKEIYLVQELMETDLSRILASS 130

Query: 628 ANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAV-P 685
             +  D   ++Y   ++L+ ++ +H   ++H DLKP+N +      LKI DFG+A    P
Sbjct: 131 NTLTVD--HIQYFLYQILRALKAIHSAKVIHRDLKPSNILLNSNCDLKICDFGLARTYDP 188

Query: 686 DHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIY 745
           D   +      +G              Y   +     EI  N        DIWSCGC++ 
Sbjct: 189 DDDASTMNGNNVG----------FLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLA 238

Query: 746 QMIYGRPPYGGFQGQNRLLAIMN------PE-VKIV--------------YPEKTTHGDL 784
           +M++ +P + G    ++LL I++      PE ++ +              +P+K     L
Sbjct: 239 EMLFRKPIFPGKDYHHQLLLILDTLGTPSPEDIEAINYGRAKEYILSLPHFPKKDWSQLL 298

Query: 785 VP--RTALDTIKACLERNPERRWTVDDLLRGPFI 816
                  LD +   +  NP+RR T +  L  PF+
Sbjct: 299 GTDNEMLLDILDKLMIFNPKRRITAEQALEHPFL 332

>ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 452

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 140/297 (47%), Gaps = 54/297 (18%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSS-NNKIYALKR-------VSFDEFDDTS--IDGFKGEI 584
           ++++ V +LG+G   KV  V+    +K+YA+K+       +  DE  D S  ++    E 
Sbjct: 77  ADFKPVRVLGKGAYGKVVLVKDERTSKLYAMKQLQKAEIIIENDESQDVSKRVERIFAER 136

Query: 585 ELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQE 643
            +L +L D   VVKL     ++  LY++++     +L   L +R  +  D +   ++A E
Sbjct: 137 TILSQL-DHPNVVKLFYTFHDNSRLYLLLQYIPGGELFYHLKERGTL--DEDTAAFYAAE 193

Query: 644 MLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPD--HTVNIYRDTQ---- 696
           +   ++ +H+ GIV+ DLKP N +    G L + DFG++    D  ++++   D      
Sbjct: 194 ISCALKFLHEKGIVYRDLKPENCLLDADGHLVLTDFGLSKKSVDDNNSLSAPEDVSVLHS 253

Query: 697 -IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 755
            IGTP Y APE L    YT                  +  D +S GC++Y M+ G+PPY 
Sbjct: 254 IIGTPEYCAPEILKGEPYT------------------RNCDWYSLGCLVYDMLVGKPPYT 295

Query: 756 GFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIK----ACLERNPERRWTVD 808
           G          +N +V +   +K   G  +P    D +K    A L+++  +RW VD
Sbjct: 296 G----------VNHKVILNKIQKEKQGPRLPYYLSDGMKDWLGALLKKDCNKRWDVD 342

>TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {ON}
           Anc_3.177 YAR019C
          Length = 913

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 140/313 (44%), Gaps = 56/313 (17%)

Query: 512 PPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFD 570
           PP T +   Q  QRK Q+      +Y+  +++G+G    VYK +     ++ A+K V++D
Sbjct: 20  PPVTLS---QQRQRKNQV------QYQLKQVIGKGSYGIVYKAINRKTEQMVAIKEVTYD 70

Query: 571 EFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRAN 629
             DD  +     EI+LLK L +   +VK          LY+++E C    L  V+++   
Sbjct: 71  --DDEELTDIMSEIDLLKNL-NHMNIVKYHGFIKKSHNLYIILEYCSRGSLKNVISRGKG 127

Query: 630 MPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHT 688
           +P      +   ++ L  +  +H+ G++H D+K AN +     ++K+ DFG++  V   T
Sbjct: 128 IPESK--AKVFIKQTLNGLHYLHEQGVIHRDIKAANLLLDSNSVVKLADFGVSTKVNTMT 185

Query: 689 VNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMI 748
           + +   T  G+ N+MAPE                 I  NR      SDIWS G  + +++
Sbjct: 186 MAM---TLAGSLNWMAPE-----------------IIGNR-GASTLSDIWSLGATVLELL 224

Query: 749 YGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTAL-----DTIKACLERNPER 803
            G PP+      N   AI N                +P T+L     + +  C ++N   
Sbjct: 225 TGHPPFHNLVDINIYYAIENDT-------------FIPPTSLSQDAQEFLARCFQKNMYM 271

Query: 804 RWTVDDLLRGPFI 816
           R T  +LL+  ++
Sbjct: 272 RPTAAELLKHKWL 284

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 130/280 (46%), Gaps = 37/280 (13%)

Query: 543 LGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSI--DGFKGEIELLKRLEDQTRVVKL 599
           LG+G S +V   ++    K+ A+K V   +   T     G + EI ++K L     V+ L
Sbjct: 64  LGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMK-LISHPNVMGL 122

Query: 600 IDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
            +   N   L++V+E  D  +L   L  R  +P + E + Y  Q +++     H   I H
Sbjct: 123 YEVWENKLELFLVLEYVDGGELFDYLVSRGRLP-EKEAIHYFRQ-IIEGTAYCHGFNICH 180

Query: 659 SDLKPANFVFVKG--ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPD 716
            DLKP N +  K    +KI DFG+A      T N   +T  G+P+Y +PE ++  NY   
Sbjct: 181 RDLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLETSCGSPHYASPEIVMGKNYN-- 235

Query: 717 QGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYP 776
                          G PSD+WSCG I++ ++ G  P+     +  LL +   + ++  P
Sbjct: 236 ---------------GGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQM--P 278

Query: 777 EKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           +  + G      A D I   L  +P++R +++++L  P +
Sbjct: 279 QSVSSG------AQDLISRILVVDPDKRISINEILAHPLL 312

>TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON}
           Anc_6.371 YCR091W
          Length = 837

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 136/337 (40%), Gaps = 63/337 (18%)

Query: 521 QTPQRKRQI-----------IQVNGSEYEKVELLGRGGSSKVYKVRSS-NNKIYALKRVS 568
           + P+R R++           I V    +EKV LLG+G   KVY V+    N++YALK  S
Sbjct: 412 EEPKRSRRLRNKSFSNKFRDITVGPQSFEKVRLLGQGDVGKVYLVKEKRTNRLYALKIFS 471

Query: 569 FDEF-DDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQ 626
             E      I     E E+L    +   +V L     +   LY+ ME C   +  + L  
Sbjct: 472 KAEMIKRKKIKRILAEQEILA-TSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQT 530

Query: 627 RANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVP 685
           R       +  R++A E+   ++ +H  G ++ DLKP N +  K G + + DF ++    
Sbjct: 531 RKTKCISEDDARFYASEVTAALEYLHLMGCIYRDLKPENILLHKSGHIMLSDFDLSIQAK 590

Query: 686 DHTVNIYR--------DTQI-----------GTPNYMAPEALVAMNYTPDQGQTEQEIQQ 726
           D    + +        DT+I           GT  Y+APE +    +T            
Sbjct: 591 DAKNPVVKGSAQSTLVDTKICSNGFRTNSFVGTEEYIAPEVIRGNGHTA----------- 639

Query: 727 NRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVP 786
                    D W+ G + Y+M++G  P+ G         I+  EV   +P    + + + 
Sbjct: 640 -------AVDWWTLGILTYEMLFGFTPFKGDNTNETFCNILKSEV--TFP----NNNEIS 686

Query: 787 RTALDTIKACLERNPER----RWTVDDLLRGPFIKPV 819
           R   D IK  L +N  +    R    D+ R PF K +
Sbjct: 687 RACKDLIKKLLTKNESKRLGSRMGAADIKRHPFFKKM 723

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 135/294 (45%), Gaps = 40/294 (13%)

Query: 537  YEKVELLGRGGSSKVY-KVRSSNNKIYALKRVSFDEF---DDTSI---DGFKGEIELLKR 589
            + K E++G+G    VY  +  +  ++ A+K+V   +F   D+T++   +    E+  LK 
Sbjct: 1124 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKD 1183

Query: 590  LEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
            L D   +V+ +  E  + +  + +E      +  ++  R    FD + +R+   ++L+ +
Sbjct: 1184 L-DHLNIVQYLGFENKNCIYSLFLEYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLEGL 1240

Query: 649  QVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYRDTQI---GTPNYMA 704
              +H  GI+H D+K  N +    G+ KI DFGI+      + NIY ++++   GT  +MA
Sbjct: 1241 AYLHLRGILHRDMKADNLLLDNDGVCKISDFGISR----KSNNIYSNSEMTMRGTVFWMA 1296

Query: 705  PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
            PE +        QG + +             DIWS GC++ +M  G+ P+   +    + 
Sbjct: 1297 PEMVDTT-----QGYSAK------------VDIWSLGCVVLEMFAGKRPWSNLEVVAAMF 1339

Query: 765  AIMNPEVKIVYPEKTT-HGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             I   +     PE T  H     R  LD    C   +PE R T D LL  PF +
Sbjct: 1340 QIGKSKSAPPIPEDTLPHISQDGRAFLDD---CFMIDPEERPTADTLLSHPFCQ 1390

>TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056
           bp, 351 aa] {ON} Anc_8.490 YPL042C
          Length = 351

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 121/270 (44%), Gaps = 61/270 (22%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S+++++E LG G  + VYK  +    +Y ALK V  D  + T     + EI L+K L+  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRA------------------------- 628
             +V+L D       L +V E  D DL + +  R+                         
Sbjct: 63  NNIVRLYDVIHTENKLTLVFEYMDKDLKKFMDARSLAHANQLNANANQNINSGNPMGNNG 122

Query: 629 -----NMPFDIEF--VRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGI 680
                  P  +E   V+Y   ++L+ V   H+  I+H DLKP N +   KG LK+ DFG+
Sbjct: 123 NSNSKTQPIGLELNLVKYFQWQLLEGVAYCHENKILHRDLKPQNLLIDNKGQLKLGDFGL 182

Query: 681 ANA--VPDHTVNIYRDTQIGTPNYMAPEALV-AMNYTPDQGQTEQEIQQNRWKVGKPSDI 737
           A A  +P +T +    +++ T  Y AP+ L+ + NY+                     D+
Sbjct: 183 ARAFGIPVNTFS----SEVVTLWYRAPDVLMGSRNYSTS------------------IDM 220

Query: 738 WSCGCIIYQMIYGRPPYGGFQGQNRLLAIM 767
           WSCGCI+ +MI G+P + G   + +L  I 
Sbjct: 221 WSCGCILAEMIAGKPLFPGTNDEEQLKLIF 250

>TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {ON}
           Anc_4.184 YGR040W
          Length = 366

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 85/368 (23%), Positives = 158/368 (42%), Gaps = 67/368 (18%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVSFDEFDDTS-IDGFKGEIELLKRLED 592
           S+Y+ + L+G G    V         I+ A+K++    F  T  +     EI+LL+   D
Sbjct: 11  SQYQLLALVGEGAYGTVCSAIHKPTGIHVAIKKIQ--PFSKTMFVTRTLREIKLLRYFHD 68

Query: 593 QTRVVKLIDH-------EMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEML 645
              ++ ++D        +MN   +Y+V E  + DL +++   A  P   + ++Y   ++L
Sbjct: 69  HENIISILDMIRPTTIDKMN--AVYLVQELMETDLQRIINSHAANPLSDDHIQYFTYQIL 126

Query: 646 KCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMA 704
           + ++ +H   ++H DLKP+N +      LK+ DFG++  +   + +  R+T +G   +M 
Sbjct: 127 RALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDS--RETLVG---FMT 181

Query: 705 PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
                   Y   +     EI     +     DIWSCGCI+ +++ G+P + G    ++L 
Sbjct: 182 -------EYVATRWYRAPEIMLTFREYTTAMDIWSCGCILAELVSGKPLFPGRDYHHQLW 234

Query: 765 AIM------------------------NPEVKIVYPEKTTHG--DLVPRTALDTIKACLE 798
            I+                        N  +K   P +   G  +L P+  LD +   L 
Sbjct: 235 LILEVTGSPSYEDVECIKSARAKSYIANLPMKPKMPWEIALGKQNLNPQM-LDLLDRMLT 293

Query: 799 RNPERRWTVDDLLRGPFIK------------PVSVTHFFIRDLIKNAVKYGSDQRYVSKE 846
            NP +R +  D L  P++             P+++   F R  I N +K  +D   +S E
Sbjct: 294 FNPNKRISAADALTHPYLSTYHDPEDEPEYPPLNLEDEFWR--IDNEIKKPNDDSEISME 351

Query: 847 KVEDLADD 854
            ++ +  D
Sbjct: 352 TLKQMLYD 359

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 140/310 (45%), Gaps = 68/310 (21%)

Query: 525 RKRQIIQVNGSEYEKVELLGRGGSSKVYKV--RSSNNKIYALK-----------RVSFDE 571
           R++ II+    +++  ++LG G  S+V+    ++ ++K YA+K           +V +  
Sbjct: 106 RRQTIIRKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVN 165

Query: 572 FDDTSIDGFK---GEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRA 628
            + T++   K   G I L    +D+  +  L+++  N   L ++ + G            
Sbjct: 166 IEKTALQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGT----------- 214

Query: 629 NMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIA------ 681
               + E   Y++ +++  +  +H  GI+H D+KP N +    + +K+ DFG A      
Sbjct: 215 ---LNEECTIYYSAQIIDAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKK 271

Query: 682 ---NAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIW 738
              N  P + +     + +GT  Y++PE L++ NYT              +K     DIW
Sbjct: 272 SDKNGKPHYNLLTRSSSFVGTAEYVSPE-LLSDNYT-------------DYKC----DIW 313

Query: 739 SCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP-EVKIVYPEKTTHGDLVPRTALDTIKACL 797
           + GC++YQMI G+PP   F+  N  L      +V+  +    T G   P    D +K  L
Sbjct: 314 AFGCLVYQMIAGKPP---FKATNEYLTFQKVMKVQFAF----TAG--FPTIIRDLVKNIL 364

Query: 798 ERNPERRWTV 807
            + PE+R T+
Sbjct: 365 VKQPEKRLTI 374

>NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON} 
          Length = 1119

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 140/297 (47%), Gaps = 46/297 (15%)

Query: 524 QRKRQIIQVNGSEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKG 582
           QRK + +Q     Y+  +++G+G    VYK +    +++ A+K +++   DD  ++    
Sbjct: 51  QRKNKSVQ-----YQLKKVIGQGSYGVVYKAINKKTSQLVAIKEINYHNNDD--LNEIMS 103

Query: 583 EIELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEF-VRYH 640
           EI+LLK L + T +VK          LY+++E C    L  +++    +P   EF  + +
Sbjct: 104 EIDLLKNL-NHTNIVKYHGFIQKSSSLYIILEFCSLGSLKNMISSGHGIP---EFNAKTY 159

Query: 641 AQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGT 699
            ++ L  +  +H+ G++H D+K AN +   + I+K+ DFG++  V +  +     T  G+
Sbjct: 160 IKQTLNGLNYLHNQGVIHRDIKAANLLLNAERIVKLADFGVSTRVTNTAM-----TLAGS 214

Query: 700 PNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQG 759
            N+M+PE L       ++G +              SDIWS G  + +++ G PP+     
Sbjct: 215 LNWMSPEIL------GNRGASTL------------SDIWSLGSTVVELLTGDPPFSKLTN 256

Query: 760 QNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
                AI N     + P+  ++         D +  C ++N  +R T   LL  P+I
Sbjct: 257 TTISYAIENDNY--IPPDSMSY------EVKDFLSKCFQKNMYKRPTALVLLNHPWI 305

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 147/320 (45%), Gaps = 50/320 (15%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEF-DDTSID 578
           +T Q  +++I+    +++  + LG G  S V    + ++ K YA+K +S +       + 
Sbjct: 154 KTGQTTKEVIKKGIKDFKFGDTLGDGSYSTVMVATARDSGKKYAVKVLSKEYLIRQKKVK 213

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFV 637
               E   L+RL +   +++L     +   LY ++E   + D   ++ +  ++  + E  
Sbjct: 214 YVNIEKNALQRLNNSRGIIRLYFTFQDEASLYFLLEYAPNGDFLSIMKKYGSL--NEECT 271

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAV------PDHTVN 690
            Y++ +++  ++ +H  GI+H D+KP N +  K + +K+ DFG A  +         T +
Sbjct: 272 CYYSAQIIDAIKFLHQRGIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQASGETYD 331

Query: 691 IYRDTQ--IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMI 748
           ++  ++  +GT  Y++PE L                  + W V    DIW+ GCI++QMI
Sbjct: 332 LHTRSKSFVGTAEYVSPELL-----------------NDNW-VDYRCDIWAFGCIVFQMI 373

Query: 749 YGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVD 808
            G+PP   F+  N  L      +K+ Y    T G   P    D +K  L R P++R ++ 
Sbjct: 374 AGKPP---FKATNEYLTFQK-VMKVQY--AFTAG--FPVVVRDLVKRILLRQPDQRLSIP 425

Query: 809 DLLRGPFIKPVSVTHFFIRD 828
            + R          H+F RD
Sbjct: 426 QIER----------HYFYRD 435

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 142/309 (45%), Gaps = 55/309 (17%)

Query: 537  YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSID----GFKGEIELLKRLE 591
            ++K + +G G   +VY  V     ++ A+K +     D  S++      K E+ +L+ L 
Sbjct: 1208 WQKRKFVGGGTFGEVYSAVNLDTGEVLAVKEIKIQ--DSKSMEKIFPSIKEEMNVLEMLS 1265

Query: 592  DQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFV-RYHAQEMLKCVQ 649
                +V+    E++   + + ME C    L+ +L        + E V + +  ++L+ + 
Sbjct: 1266 -HPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEHGR---IEDEMVTQVYTLQLLEGLA 1321

Query: 650  VVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAV------------PDHT-------- 688
             +H++GIVH D+KP N +    GI+K +DFG A  +            PD          
Sbjct: 1322 YLHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREMPDENDDENGKVV 1381

Query: 689  -VNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQM 747
              N + D  IGTP YMAPEA+     +P +G    +            DIW+ GC++ +M
Sbjct: 1382 GRNNFNDI-IGTPMYMAPEAITG---SPKKGHLGAD------------DIWALGCVVLEM 1425

Query: 748  IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTV 807
            I G+ P+     +    AIM        P+  T+ ++ P   +  +K CL++NP +R + 
Sbjct: 1426 ITGKRPWANLDNE---WAIMYHVAAGQIPQLPTNDEVSP-AGMHFLKRCLKQNPAQRASA 1481

Query: 808  DDLLRGPFI 816
             +LL  P+I
Sbjct: 1482 VELLMDPWI 1490

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 151/352 (42%), Gaps = 56/352 (15%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEF--DDTSID 578
           ++ + ++ II+    +++   ++G G  S V    S + K     +V   E+      + 
Sbjct: 163 ESSKAQKNIIKKGIKDFKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVK 222

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFV 637
               E   L++L +   VV+L     +   LY ++E   + D   ++ +  ++  D    
Sbjct: 223 YVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSL--DETCA 280

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKI--IDFGIA-------NAV--PD 686
           RY+A +++  +  +H  GI+H D+KP N + + G +KI   DFG A       N+V  P+
Sbjct: 281 RYYAAQIIDAIDYLHSNGIIHRDIKPEN-ILLDGEMKIKLTDFGTAKLLNPTNNSVSKPE 339

Query: 687 HTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQ 746
           + ++    + +GT  Y++PE L                  N        DIW+ GCI++Q
Sbjct: 340 YDLSTRSKSFVGTAEYVSPELL------------------NDSFTDYRCDIWAFGCILFQ 381

Query: 747 MIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWT 806
           MI G+PP   F+  N  L      +K+ Y    T G   P    D +K  L +N +RR T
Sbjct: 382 MIAGKPP---FKATNEYLTFQK-VMKVQYA--FTPG--FPLIIRDLVKKILVKNLDRRLT 433

Query: 807 VDDLLRGPFIK-------------PVSVTHFFIRDLIKNAVKYGSDQRYVSK 845
           +  +    F K             P  +  + I      A+  GSD++ V K
Sbjct: 434 ISQIKEHHFFKDLNFKDGSVWSKTPPEIKPYKINAKSMQAMPSGSDRKLVKK 485

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 114/243 (46%), Gaps = 36/243 (14%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L   T V+ L +   N   LY+V+E  D  +L   L  +  +P + E +
Sbjct: 160 GIEREIVIMK-LISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLP-EREAI 217

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG--ILKIIDFGIAN-AVPDHTVNIYRD 694
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A   +P+  +     
Sbjct: 218 HYFKQ-IVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLL----K 272

Query: 695 TQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           T  G+P+Y +PE ++   Y                  G PSD+WSCG +++ ++ G  P+
Sbjct: 273 TSCGSPHYASPEIVMGRPYH-----------------GGPSDVWSCGIVLFALLTGHLPF 315

Query: 755 GGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGP 814
                +  LL + + + ++  P        +   A D I   L  +PE+R T  ++L+ P
Sbjct: 316 NDDNIKKLLLKVQSGKYQM--PSN------LSSEARDLISKILVIDPEKRITTQEILKHP 367

Query: 815 FIK 817
            IK
Sbjct: 368 LIK 370

>KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]
           {ON} similar to uniprot|P38070 Saccharomyces cerevisiae
           YBR028C Hypothetical ORF
          Length = 556

 Score = 89.7 bits (221), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 141/337 (41%), Gaps = 61/337 (18%)

Query: 540 VELLGRGGSSKVYKVRSS-NNKIYALKR-------VSFDEFDDTSIDGFKGEIE------ 585
           +  LG G   KV  V+ S ++K+YA+K+       +S D  +  +    +  IE      
Sbjct: 173 IRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIERTFAER 232

Query: 586 -LLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEM 644
            +L +LE    V        NH +  V+      +L   L ++  +  D   V ++A E+
Sbjct: 233 TILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTL--DEGTVAFYAAEL 290

Query: 645 LKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIAN-------AVPDHTVNIYR-DT 695
              ++ +H  GIV+ DLKP N +   +G L + DFG++        A P+   N+ +  +
Sbjct: 291 SCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVNQLYS 350

Query: 696 QIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 755
            IGTP Y APE L    YT           QN        D +S GC++Y M+ G+PP+ 
Sbjct: 351 IIGTPEYCAPEILAGEPYT-----------QN-------CDWYSLGCLVYDMLIGKPPFT 392

Query: 756 GFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLR--G 813
           G   +  L  I   +     P   + G        D + A L ++P +RW VD      G
Sbjct: 393 GVNHKIILNKIKQEKTGARIPSYLSDG------FKDYLGALLRKDPTKRWDVDKYWAQDG 446

Query: 814 PFIKPVS---------VTHFFIRDLIKNAVKYGSDQR 841
           P  K            + HF  R +I   +  G  Q+
Sbjct: 447 PKTKKKKAGQAKTTNYIGHFIFRKIIWKQLLSGDLQK 483

>Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON}
            similar to Ashbya gossypii AER264C
          Length = 1541

 Score = 90.9 bits (224), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 134/308 (43%), Gaps = 50/308 (16%)

Query: 537  YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTR 595
            ++K   +G G    VY  V      I A+K + F +         K   ++   ++D+  
Sbjct: 1244 WQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIRFHDR--------KSMRQVFPSIKDEMT 1295

Query: 596  VVKLIDH---------EMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEML 645
            V+++++H         E++   + + ME C    L+ +L        D    + ++ ++L
Sbjct: 1296 VLEMLNHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEH--GRIEDEMVTQVYSLQLL 1353

Query: 646  KCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYR--------DTQ 696
            + +  +H++G+ H D+KP N +    GI+K +DFG A  +  +   +          D  
Sbjct: 1354 EGLAYLHESGVHHRDIKPENILLDFNGIIKYVDFGAAKLIATNGSKVLTEDNGRDSTDKM 1413

Query: 697  IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
            IGTP YM+PE++ A  Y                K G   DIWS GC++ +M+ GR P+  
Sbjct: 1414 IGTPMYMSPESISASGYG---------------KFGS-DDIWSLGCVVLEMVTGRRPWAN 1457

Query: 757  FQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
               Q    AIM        P   T  ++ P T +  +  CL ++P  R +  +LL  P+I
Sbjct: 1458 LDNQ---WAIMYQVAAGQIPSFPTKHEMSP-TGIKFLSRCLIQDPNMRSSAVELLMDPWI 1513

Query: 817  KPVSVTHF 824
              +    F
Sbjct: 1514 VEIRNIAF 1521

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 131/301 (43%), Gaps = 48/301 (15%)

Query: 543 LGRGGSSKVYKVRSSNNKI-YALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLID 601
           +G+G S  VY     N +   A+K+++F++     +     EI L+ +      +V  ID
Sbjct: 571 IGQGASGGVYTATDVNTEASVAIKKMNFEKQPKKEL--IVNEI-LVMKASRHENIVNFID 627

Query: 602 HEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSD 660
               +G L+V+ME      L+ V+         I  V    +E L  ++ +H  G++H D
Sbjct: 628 SYFLNGNLWVIMEYMKGGSLTDVVTHCILTEQQISTV---TRETLNGLRFLHSKGVIHRD 684

Query: 661 LKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQ 719
           +K  N +  + G +K+ DFG    +  + +N+ R T +GTP +MAPE +    Y P    
Sbjct: 685 IKSDNVLLSLSGDIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEYGP---- 738

Query: 720 TEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM---NPEVKIVYP 776
                     KV    DIWS G +I +MI G PPY        L  I     PE+K    
Sbjct: 739 ----------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELK---- 780

Query: 777 EKTTHGDLVPRTALDTIKA----CLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKN 832
                    P +  + +KA    CL+ +P  R +  +LL   FI   S     +  L+K 
Sbjct: 781 --------DPDSLSECLKAFLDWCLKVDPHERASATELLNDRFIVEFSEKTETLSPLVKL 832

Query: 833 A 833
           A
Sbjct: 833 A 833

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 140/285 (49%), Gaps = 20/285 (7%)

Query: 541 ELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E++G G  + V K V  +  K +A+K ++  +    ++DG   E+E+L++L +  R+V L
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVG-NMDGVSRELEVLQKL-NHPRIVSL 249

Query: 600 IDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
                +    Y+VME     DL   +A  A+     E  R  ++++L+ +Q +H  GI H
Sbjct: 250 KAFYEDEANYYMVMEFISGGDLMDFVA--AHGAVGEEAGREISRQILEAIQYIHSKGISH 307

Query: 659 SDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTP 715
            DLKP N +  +    ++KI DFG+A    + ++     T  GT  Y+APE  V   +T 
Sbjct: 308 RDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSI---MKTFCGTLAYVAPE--VIGGFTG 362

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
             G+ E E ++  +      D+WS GC+++ ++ G  P+ G   Q +L   +    K  Y
Sbjct: 363 ATGEEETEEERIEY--SSLVDMWSMGCLVFVILTGHLPFSG-STQEQLYEQIR---KGSY 416

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVS 820
            E       +   A D I   L+ +  +R TVDD L  P+IK  S
Sbjct: 417 HEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCS 461

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 136/282 (48%), Gaps = 24/282 (8%)

Query: 541 ELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E++G+G  + V K V  S  + +A+K ++  +    ++ G   E+E+L++L D  R+V+L
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKRKVM-GNLSGVTRELEILRKL-DHPRIVRL 258

Query: 600 IDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
                +    Y+VME     DL   +A   ++  D    R   +++L+ V  +H+ GI H
Sbjct: 259 KGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVAYMHEKGISH 316

Query: 659 SDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTP 715
            D+KP N +  +    ++KI DFG+A    + T   +  T  GT  Y+APE +   N   
Sbjct: 317 RDIKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPEVISGKN--- 370

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
               TE +   +R +     D+WS GC++Y ++    P+ G   Q  L   +N   +  Y
Sbjct: 371 --AATEND---DRIEYSSLVDMWSIGCLVYVILTAHLPFSG-STQQELYEQIN---RGSY 421

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            E       V   A D I++ ++ +P  R T  D L+  +IK
Sbjct: 422 HEGPLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/343 (24%), Positives = 141/343 (41%), Gaps = 88/343 (25%)

Query: 536 EYEKVELLGRGGSSKVYKVRSSN--NKIYALKRVSFDEFDDTSI-DGFKGEIELLKRLED 592
           EY   + +G+G  + VY+  S+   N   A+K V   +  +  I +  + EI +LK+L +
Sbjct: 131 EYILEKEIGKGSFAVVYRGYSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-N 189

Query: 593 QTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQR----ANMPF--------------- 632
              +V LID + N     ++ME C   DL+ ++ +R     N P                
Sbjct: 190 HKHIVNLIDCQRNKNDFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPNPDC 249

Query: 633 ---DIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF--------------------- 668
              +I FV  + Q++   ++ +    ++H D+KP N +                      
Sbjct: 250 NGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQTFKKLGYIGI 309

Query: 669 -VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQN 727
               ILKI DFG A  +P+ ++    +T  G+P YMAPE L                  N
Sbjct: 310 SCLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL------------------N 348

Query: 728 RWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPR 787
             K    +D+WS G ++Y+M+YG+PP+        L  I      I +P           
Sbjct: 349 YQKYNAKADLWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFP----------- 397

Query: 788 TALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLI 830
                  + +E + + ++ +  LL+   IK +S   FF  +LI
Sbjct: 398 -------SYIEIDDDMKFLISRLLKFDPIKRMSFQEFFENNLI 433

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 129/284 (45%), Gaps = 41/284 (14%)

Query: 543 LGRGGSSKVYKVRS-SNNKIYALK-----RVSFDEFDDTSID-GFKGEIELLKRLEDQTR 595
           LG+G S +V   ++    K+ A+K      V  +    TS+  G + EI ++K L     
Sbjct: 70  LGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLTSLPYGIEREIIIMK-LISHPN 128

Query: 596 VVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
           V+ L +   N   LY+V+E     +L   L  R  +P + E V Y  Q +++ V   H  
Sbjct: 129 VMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLP-EQEAVHYFKQ-IVQGVSYCHHF 186

Query: 655 GIVHSDLKPANFVFVKGIL--KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            I H DLKP N +  K  L  KI DFG+A      T +   +T  G+P+Y +PE ++   
Sbjct: 187 NICHRDLKPENLLLDKKNLSVKIADFGMAAL---ETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
           Y                  G PSD+WSCG I++ ++ G  P+     +  LL + + + +
Sbjct: 244 YH-----------------GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQ 286

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
           +  P+       +   A D I   L  +P  R T+D++L  P +
Sbjct: 287 M--PQN------ISNEAKDLIAKILIVDPAMRITIDEVLEHPLL 322

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 138/330 (41%), Gaps = 54/330 (16%)

Query: 526 KRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF-DDTSIDGFKGE 583
           K + ++V    +EK+ +LG+G   KV+ VR    N++YALK  +  E      +     E
Sbjct: 425 KFEDVKVGPQSFEKIRMLGQGDVGKVFLVREKETNRLYALKVFTKREMIKRKKVQRILTE 484

Query: 584 IELLKRLEDQTRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            E+L    +   VV L         +Y+ ME C   +  + L  R       +  R++A 
Sbjct: 485 QEILA-TSNHPFVVTLYHSFQTEDYVYLCMEYCMGGEFFRALQTRKAKSISEDDARFYAS 543

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGIANAVPDHTVNIYR-------- 693
           E+   ++ +H  G ++ DLKP N +  K G + + DF ++    D    + R        
Sbjct: 544 EVTAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMV 603

Query: 694 DTQ-----------IGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGC 742
           DT+           +GT  Y+APE +    +T                     D W+ G 
Sbjct: 604 DTKVFSEGFRTNSFVGTEEYIAPEVIRGNGHT------------------AAVDWWTLGI 645

Query: 743 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPE 802
           +IY+M++G  P+ G         I+  EV   +PE   H + + R   D I+  L +N  
Sbjct: 646 LIYEMLFGCTPFKGENTNETFCNILKNEV--TFPE---HHE-ISRHCKDLIRKLLSKNES 699

Query: 803 RR----WTVDDLLRGPFIKPVSVTHFFIRD 828
           +R        D+ R PF K V  +  F+R+
Sbjct: 700 KRLGSKMGAADIKRHPFFKKVQWS--FLRN 727

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/338 (26%), Positives = 152/338 (44%), Gaps = 56/338 (16%)

Query: 523 PQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRV-----------SFD 570
           P  KR+++      YE ++ LG G   KV   R     ++ A+K V           SF 
Sbjct: 131 PVSKRKVLNT----YEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKFFSFK 186

Query: 571 EFDDTSIDGFKGEIELLKRLEDQTRVVKLID--HEMNHGVLYVVME-CGDHDLS----QV 623
           +   T  D  K EI ++K+   +  VVKLI+   ++    +Y+V+E C   ++       
Sbjct: 187 KPGKTENDKIKREIAIMKKCHHK-HVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPPDC 245

Query: 624 LAQRAN--MPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVK-GILKIIDFGI 680
           L   A    P   +F R   + ++  ++ +H  GI+H D+KPAN +  + GI+KI DFG+
Sbjct: 246 LETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISDFGV 305

Query: 681 ANAVPDHTVNIYRDT--------QIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVG 732
           + A     V+   +T          GTP + APE  +  +         ++ Q +R ++ 
Sbjct: 306 SLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAF-------EKYQLDREELF 358

Query: 733 KPS------DIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKI-VYPEKTTHGDLV 785
           K S      DIW+ G  +Y +++G  P+           I+N  VK   Y +   +  ++
Sbjct: 359 KGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVL 418

Query: 786 PRT-------ALDTIKACLERNPERRWTVDDLLRGPFI 816
             T       A D +   LE+NP +R  ++++ R PF+
Sbjct: 419 QMTEEAEYEAAKDLLTRLLEKNPIKRINIEEIKRHPFV 456

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 36/243 (14%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L     V+ L +   N   LY+V+E  D  +L   L  +  +P + E +
Sbjct: 160 GIEREIVIMK-LISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLP-EREAI 217

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG--ILKIIDFGIAN-AVPDHTVNIYRD 694
            Y  Q +++ V   H   I H DLKP N +  K    +KI DFG+A   +P+  +     
Sbjct: 218 HYFKQ-IVEGVSFCHSFNICHRDLKPENLLLDKKNRKIKIADFGMAALELPNKLLK---- 272

Query: 695 TQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
           T  G+P+Y +PE ++   Y                  G PSD+WSCG +++ ++ G  P+
Sbjct: 273 TSCGSPHYASPEIVMGRPYH-----------------GGPSDVWSCGIVLFALLTGHLPF 315

Query: 755 GGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGP 814
                +  LL + + + ++           +   A D I   L  NPE+R T  ++L  P
Sbjct: 316 NDDNIKKLLLKVQSGKYQMPMN--------LSAEARDLISKILVINPEKRITTQEILNHP 367

Query: 815 FIK 817
            IK
Sbjct: 368 LIK 370

>TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.425
           YKL139W
          Length = 485

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 116/240 (48%), Gaps = 40/240 (16%)

Query: 533 NGSEYEKVELLGRGGSSKVYKVRSS-NNKIYALKRVSFDE----FDDTSIDGFKGEIELL 587
           + S YE++  +G G   KVYK RS+   KI ALKR+  +     F  TSI     EI+LL
Sbjct: 147 DSSVYERILQVGEGTYGKVYKARSTVTGKIVALKRLRLEGEREGFPITSIR----EIKLL 202

Query: 588 KRLEDQTRVVKLIDHEM--NHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEML 645
           +  +     V  ++  M  +   +Y++ E  D+DLS +L  +  +  D    ++  +++L
Sbjct: 203 QSFDHPN--VSTLNEIMVESQKTVYMIFEYADNDLSGLLLNK-QIDIDAAQCKHIFEQLL 259

Query: 646 KCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMA 704
           + ++ +H  GI+H D+K +N +   KG L+I DFG+A  V   +    R   + T  Y  
Sbjct: 260 RGMEYLHGNGILHRDIKGSNILIDNKGQLRITDFGLARKVKAESDYTNR---VITLWYRP 316

Query: 705 PEALVA-MNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 763
           PE L+   NY P+                   D+W CGC++ ++         FQGQN L
Sbjct: 317 PELLLGTTNYGPE------------------VDMWGCGCVLVELFN---KVAIFQGQNEL 355

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 124/289 (42%), Gaps = 39/289 (13%)

Query: 541 ELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLI 600
           E LG G + +V   +          +V      DT   G    + L   +E +  V+KL+
Sbjct: 17  ETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXLALPYNIEREIVVMKLL 76

Query: 601 DH----------EMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQ 649
            H          E N+  LY+++E  +  +L  +L  R  +P + E V+   Q ++  + 
Sbjct: 77  SHPNVLSLYDVWETNNN-LYLILEYAEKGELFNLLVDRGPLP-EKEAVKCFRQ-IIIAIS 133

Query: 650 VVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEAL 708
             H  GIVH DLKP N +      +KI DFG+A    D  +    +T  G+P+Y APE +
Sbjct: 134 YCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARL---LETSCGSPHYAAPEIV 190

Query: 709 VAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMN 768
             + Y                  G  SD+WSCG I++ ++ GR P+    G  R L +  
Sbjct: 191 SGLPYR-----------------GFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKV 233

Query: 769 PEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
              +   P+ T     + + A + I   L  +P +R    D+L  P +K
Sbjct: 234 QRGQFEMPDATE----ISKDAQNLISRILVVDPTQRMKTRDILTHPLLK 278

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 109/245 (44%), Gaps = 42/245 (17%)

Query: 579 GFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFV 637
           G + EI ++K L     V+ L +   N   L++V+E  D  +L   L  +  +P + E V
Sbjct: 161 GIEREIVIMK-LISHRNVMGLFEVWENKNDLFLVLEYVDGGELFDYLVSKGKLP-EWEAV 218

Query: 638 RYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKG--ILKIIDFGIANAVPDHTVNIYRDT 695
            Y  Q +++ V   H   I H DLKP N +  K   I+KI DFG+A        N   +T
Sbjct: 219 HYFKQ-IIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGMAAL---ELPNKLLET 274

Query: 696 QIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYG 755
             G+P+Y +PE ++   Y                  G PSD+WSCG I++ ++ G  P+ 
Sbjct: 275 SCGSPHYASPEIVMGKPYH-----------------GGPSDVWSCGIILFALLTGHLPFN 317

Query: 756 GFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRT----ALDTIKACLERNPERRWTVDDLL 811
               +  LL + +   ++            PR     A D I   L  NP +R  + D+L
Sbjct: 318 DDNIRKLLLKVQSGRFRL------------PRNISLEAQDLIAKILVVNPRQRIKISDIL 365

Query: 812 RGPFI 816
           + P I
Sbjct: 366 KHPLI 370

>ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 366

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 116/243 (47%), Gaps = 26/243 (10%)

Query: 535 SEYEKVELLGRGGSSKVYKVRSSNNKIY-ALKRVS-FDEFDDTSIDGFKGEIELLKRLED 592
           S+Y+ V L+G G    V         IY A+K++  F +  +  +     EI+LL    D
Sbjct: 11  SQYQLVALIGEGAYGTVCSAIHKPTGIYVAIKKIQPFSK--NMFVTRTLREIKLLSYFHD 68

Query: 593 QTRVVKLIDH-------EMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEML 645
              ++ ++D        +MN   +Y+V E  + DL ++++  +  P   + ++Y   ++L
Sbjct: 69  HENIISILDKVRPTSIDKMN--AVYLVQELMETDLQRIISNISTNPLSDDHIQYFTYQIL 126

Query: 646 KCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMA 704
           + ++ +H   ++H DLKP+N +      LK+ DFG++  +   + +  R+T +G   +M 
Sbjct: 127 RALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDS--RETLVG---FMT 181

Query: 705 PEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLL 764
                     P+   T QE            DIWSCGCI+ +++ G+P + G    ++L 
Sbjct: 182 EYVATRWYRAPEIMLTFQE-------YTTAMDIWSCGCILAELVSGKPLFPGRDYHHQLW 234

Query: 765 AIM 767
            I+
Sbjct: 235 LIL 237

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 151/336 (44%), Gaps = 50/336 (14%)

Query: 537 YEKVELLGRGGSSKV---YKVRSSNNKIYALKRVSFDEFDDTSIDG-FKGEIELLKRLED 592
           Y+ V+ LG G   KV   Y + ++N K+ ALK ++      + + G  + EI  L RL  
Sbjct: 45  YQIVKTLGEGSFGKVKLAYHI-TTNQKV-ALKIINKKVLAKSDMQGRIEREISYL-RLLR 101

Query: 593 QTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
              ++KL D   +   + +V+E   ++L   + QR  M    +  R   Q+++  V+  H
Sbjct: 102 HPHIIKLYDVIKSKDEIIIVIEFASNELFDYIIQRDKMSE--QEARRFFQQIISAVEYCH 159

Query: 653 DTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              IVH DLKP N +  + + +KI DFG++N + D     +  T  G+PNY APE +   
Sbjct: 160 RHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGK 216

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y                  G   D+WSCG I+Y M+  R P+             +  +
Sbjct: 217 LYA-----------------GPEVDVWSCGVILYVMLCRRLPFD------------DESI 247

Query: 772 KIVYPEKTTHGDLVPR----TALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIR 827
            +++   +    ++P+     A + IK  L  NP  R ++ ++ +  + + V +    I 
Sbjct: 248 PVLFKNISNGVYILPKFLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ-VDLPDHLIP 306

Query: 828 DLIK--NAVKY-GSDQRYVSKEKVEDLADDVWNRLS 860
           D +K  N   + G     +   + E++ DD+ N LS
Sbjct: 307 DYLKGGNGDDFEGKGNDAMEDNQPEEIDDDLVNALS 342

>KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.446
           YMR104C
          Length = 677

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 148/335 (44%), Gaps = 48/335 (14%)

Query: 536 EYEKVELLGRGGSSKVYKVRSSNN-KIYALKRVSFDEFDDTS-IDGFKGEIELLKRLEDQ 593
           +++ ++++G+G   KV +VR  +  KIYALK +        S +     E  +L R+ D 
Sbjct: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARV-DC 401

Query: 594 TRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
             +V L     +   LY+V+ C +        QR    FD+   R++A E+L  ++ +H 
Sbjct: 402 PFIVPLKFSFQSPEKLYLVLACINGGELFYHLQREGR-FDLSRSRFYAAELLCALETLHK 460

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIA--NAVPDHTVNIYRDTQIGTPNYMAPEALVA 710
             +++ DLKP N +   +G + + DFG+   N   D       DT  GTP Y+APE L+ 
Sbjct: 461 FDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT----DTFCGTPEYLAPELLLG 516

Query: 711 MNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 770
             YT                  K  D W+ G ++Y+M+ G PPY           I+   
Sbjct: 517 QGYT------------------KVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEP 558

Query: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTV---DDLLRGPFIKPVSVTHFFIR 827
           ++  +P      D   + A D +   L R+P RR  +   D++   PF   ++     ++
Sbjct: 559 LR--FP------DGFDKDAKDLLIGLLSRDPTRRLGLNGADEIKNHPFFSQLNWKRLLMK 610

Query: 828 DLI-------KNAVKYGS-DQRYVSKEKVEDLADD 854
             I        NA+   + DQ +  ++ ++ + D+
Sbjct: 611 GYIPPYKPSVSNAMDTSNFDQEFTQEKPIDSVVDE 645

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 128/294 (43%), Gaps = 46/294 (15%)

Query: 541 ELLGRGGSSKVYKVRSSNNKI-YALKRVSFDEF-DDTSIDGFKGEIELLKRLEDQTRVVK 598
           E+LG G  S V    S ++K  YA+K ++ +       +     E   L+R+ +   +VK
Sbjct: 183 EMLGDGAYSTVMLATSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 599 LIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIV 657
           L     +   LY ++E C + D   ++ +  ++  +     Y++ +++  +  +H  GI+
Sbjct: 243 LFFTFQDESSLYFLLEYCPNGDFLSLMKKYGSL--NETVACYYSAQVIDAIDYLHTNGII 300

Query: 658 HSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIY-----RDTQIGTPNYMAPEALVAM 711
           H D+KP N +  K   +K+ DFG A  +   T N +       + +GT  Y+APE L   
Sbjct: 301 HRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFVGTAEYVAPELL--- 357

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
                          N   V    D+W+ GCI+YQMI G+PP   F+  N  L      +
Sbjct: 358 ---------------NDSFVDYRCDVWAFGCILYQMIAGKPP---FKATNEYLTFQKV-M 398

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFF 825
           K+ Y    T G   P    D +K  L         V DL + P I  +   HFF
Sbjct: 399 KVQYA--FTAG--FPLIIRDLVKKIL---------VKDLNQRPSISQIEKHHFF 439

>CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa]
           {ON} similar to uniprot|P12688 Saccharomyces cerevisiae
           YKL126w or uniprot|P18961 Saccharomyces cerevisiae
           YMR104c ser/thr-specific protein kinases
          Length = 704

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 133/306 (43%), Gaps = 49/306 (16%)

Query: 503 TVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNN-KI 561
           T+  T+  KP      SY  P        V   ++E + +LG+G   KV +VR  +  KI
Sbjct: 357 TINLTVDFKP------SYSKP--------VGIDDFELLTVLGKGSYGKVMQVRKKDTQKI 402

Query: 562 YALK--RVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHD 619
           YALK  R S+       I     E  +L R+E    +V L         LY+V+ C +  
Sbjct: 403 YALKAIRKSYIVAKSEVIHTL-AERTILARVE-CPFIVPLKFTFQTPEKLYLVLACINGG 460

Query: 620 LSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKIIDF 678
                 QR  + FDI   R++A E+L  +  +H   +V+ DLKP N +   +G + + DF
Sbjct: 461 ELFHHLQREGI-FDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDF 519

Query: 679 GIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIW 738
           G+     +   N    T  GTP Y+APE L+   YT                  K  D W
Sbjct: 520 GLCKL--NMKDNEKTSTFCGTPEYLAPEVLLGKGYT------------------KVVDWW 559

Query: 739 SCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLE 798
           + G ++Y+M+ G PPY           I+  +  +++P      D +   A D +K  L 
Sbjct: 560 TLGVLLYEMLTGLPPYYDENVSEMYKKIL--KSPLIFP------DGMDPDAKDLLKRLLN 611

Query: 799 RNPERR 804
           R+P RR
Sbjct: 612 RDPNRR 617

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 103/221 (46%), Gaps = 26/221 (11%)

Query: 537 YEKVELLGRGGSSKV-YKVRSSNNKIYALKRVSFDEFDDTSIDG-FKGEIELLKRLEDQT 594
           Y+ ++ LG G   KV      + N+  ALK ++      + + G  + EI  L RL    
Sbjct: 42  YQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGRIEREISYL-RLLRHP 100

Query: 595 RVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDT 654
            ++KL D   +   + +V+E  DH+L   + QR  M  +    R   Q+++  V+  H  
Sbjct: 101 HIIKLYDVIKSKEDIIMVIEYADHELFDYIVQRDKMSEN--EARKFFQQIISAVEYCHRH 158

Query: 655 GIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNY 713
            IVH DLKP N +  + + +KI DFG++N + D     +  T  G+PNY APE +    Y
Sbjct: 159 KIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 215

Query: 714 TPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY 754
                             G   D+WSCG I+Y M+  R P+
Sbjct: 216 A-----------------GPEVDVWSCGVILYVMLCRRLPF 239

>NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559)
           [2241 bp, 746 aa] {ON} Anc_2.352 YDL101C
          Length = 746

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 138/320 (43%), Gaps = 48/320 (15%)

Query: 514 STENGSYQTPQRKRQIIQVNGSE--------------YEKVELLGRGGSSKVYKVRSSNN 559
           S E    +TP+R   I Q    E              Y K++ +G G S  VY       
Sbjct: 432 SQEKSIQRTPKRPEDIFQTKIYEKLCLTCSLRNPNERYRKLKRIGEGASGIVYTAYEIGT 491

Query: 560 KI-YALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDH 618
            I  A+K++  D      +     E+ +LK  +    ++  I+  + H  L++VME  D 
Sbjct: 492 DISVAIKQI--DLKIQPRLQMIWTEMLVLKEYQ-HPNIINFINSYLLHDTLWIVMEYMDG 548

Query: 619 -DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKII 676
             L+ +++     P + E +    +E L  +  +H  GIVH D+K  N +  + G +KI 
Sbjct: 549 GSLADIVSFFT--PTE-EQMATICRETLFGLNFLHSRGIVHRDIKSDNILLSMNGDIKIT 605

Query: 677 DFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSD 736
           DFG    + +   N  R T +GTP +MAPE + +  Y P              KV    D
Sbjct: 606 DFGFCGQLTES--NTKRTTMVGTPYWMAPEVIASKEYGP--------------KV----D 645

Query: 737 IWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKAC 796
           +WS G +I +MI G PPY   +   R L ++    K +  E    G ++     + +  C
Sbjct: 646 VWSLGIMIIEMIEGEPPY-LHETPVRALYLITTNGKPILKEPEKVGPVLK----NFMDEC 700

Query: 797 LERNPERRWTVDDLLRGPFI 816
           L  +PE R +   LL+  FI
Sbjct: 701 LRVDPEARLSTPQLLKHEFI 720

>Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {ON}
            YCR073C (REAL)
          Length = 1340

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 137/307 (44%), Gaps = 40/307 (13%)

Query: 537  YEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTS--IDGFKGEIELLKRLEDQ 593
            ++K   +G G   KVY  +   N +I A+K ++  + +         K E+ +L+ L + 
Sbjct: 1033 WQKRSFIGGGAFGKVYSAINLENGEILAVKEINIHDTNTMKKVFPLIKEEMTVLEML-NH 1091

Query: 594  TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
              +V+    E++   + + ME C    L+  L     +  D    + +  E+L+ +  +H
Sbjct: 1092 PNIVQYYGVEVHRDKVNIFMEYCEGGSLASCLLDHGRIE-DEMVTQVYTLELLEGLAYLH 1150

Query: 653  DTGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDT--------------QI 697
             +G+VH D+KP N +    GI+K +DFG A  V + +    ++                +
Sbjct: 1151 RSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVESSTRALQNETSQEIEAEPNPINGMM 1210

Query: 698  GTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGF 757
            GTP YMAPEA+     +  +G           K+G   DIW+ GC++ +M  GR P+   
Sbjct: 1211 GTPMYMAPEAISG---SAIKG-----------KLG-ADDIWALGCVVLEMATGRRPWSNL 1255

Query: 758  QGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
              +    AIM        P+  +  ++ P      ++ CL ++P RR T  +LL  P++ 
Sbjct: 1256 DNE---WAIMYHVAAGYIPQLPSKDEITP-AGRAFLERCLVQDPTRRATAVELLTDPWMI 1311

Query: 818  PVSVTHF 824
             +    F
Sbjct: 1312 QIREVAF 1318

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/324 (24%), Positives = 137/324 (42%), Gaps = 64/324 (19%)

Query: 521 QTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSN----------NKIYAL--KRVS 568
           +T +  RQ+I+    +++  E LG G  S V    S +          NK Y +  K+V 
Sbjct: 186 ETGKITRQVIKKGIKDFKFGEALGDGSYSTVVLATSVDSGKKYAAKILNKEYLIRQKKVK 245

Query: 569 FDEFDDTSIDGFK-----GEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQV 623
           +   +  ++         G I+L    +D+  +  L+++  N   L ++ + G       
Sbjct: 246 YVNIEKNTLQRLNSNHVPGIIKLFFTFQDEANLYFLLEYAPNGDFLSIMKKYGS------ 299

Query: 624 LAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIA- 681
                    + E  RY+  ++L  +  +H  GI+H D+KP N +  K + +K+ DFG A 
Sbjct: 300 --------LNEECARYYGAQILNGIYFLHRHGIIHRDIKPENILLDKSMKVKLTDFGTAK 351

Query: 682 -----NAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSD 736
                +   ++ +     + +GT  Y++PE L                  + W V    D
Sbjct: 352 LLNRKDGTEEYDLTTRSKSFVGTAEYVSPELL-----------------NDSW-VDHKCD 393

Query: 737 IWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKAC 796
           IW+ GCI++QMI G+PP   F+  N  L      +K+ Y    T G   P    D +K  
Sbjct: 394 IWAFGCILFQMIAGKPP---FKATNEYLTFQK-VMKVQY--AFTAG--FPMVVRDLVKQI 445

Query: 797 LERNPERRWTVDDLLRGPFIKPVS 820
           L + PE R T+  + +  F   ++
Sbjct: 446 LVKKPEHRLTIPQIEKHLFFSDIN 469

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 115/235 (48%), Gaps = 32/235 (13%)

Query: 529 IIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLK 588
           +I+ N  +Y + E LG GG ++ + ++      +A K VS       SI   + + +LL 
Sbjct: 85  VIKDNSKKYFRRECLGEGGFARCFHIKDDVGISFACKIVS-----KKSIKTERTKFKLLS 139

Query: 589 RLEDQ-----TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQ 642
            ++       + +VK +D   +   +Y+++E C +  L  +L +R  +  + E V++   
Sbjct: 140 EIQIHQNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILT-EAE-VKFMTT 197

Query: 643 EMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPN 701
           ++   +  +H   I+H DLK  N  F K   +KI DFG+A  + + +   Y  T  GTPN
Sbjct: 198 QVCGAINYMHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKY--TMCGTPN 255

Query: 702 YMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 756
           Y+APE +++       G + +            +DIWS G +IY M+ G+PP+  
Sbjct: 256 YIAPEVILS----KQIGHSFE------------ADIWSLGIMIYAMVLGKPPFQA 294

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 144/323 (44%), Gaps = 51/323 (15%)

Query: 535 SEYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQ 593
           S Y   + +GRG    VYK     + K+ A+K V+  E  D  I+    EI  L  L+  
Sbjct: 15  SLYSIKQCVGRGNFGDVYKACEKVSGKVVAVKVVNL-EHTDEDINLLAQEIFFLAELK-S 72

Query: 594 TRVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
             +   I        ++++ME CG    + +L    N         Y  +E+LK ++ +H
Sbjct: 73  PYITNYITTMTEDVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLH 132

Query: 653 DTGIVHSDLKPANFVFV-KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
           +   +H D+K AN +   +G +K+ DFG++  +      + R T +GTP +MAPE +   
Sbjct: 133 EQKKIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATLKRGTFVGTPFWMAPEVV--- 186

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNP-E 770
             + D    +++           +DIWS G  +Y+++ G PP          L   +P +
Sbjct: 187 --SKDSDGYDEK-----------ADIWSLGITVYELLKGSPP----------LYKCDPMK 223

Query: 771 VKIVYPEK---TTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIR 827
           V +  P++     HG      A   + +CL +NP+ R +  +LL   F     VT+  I 
Sbjct: 224 VMVNLPKRKPPVLHGHY-SSAAKHFVASCLVKNPKNRPSAVELLNSEF-----VTNLQIS 277

Query: 828 DLIKNAVKYGSDQRYVSKEKVED 850
           DL        SD  +V K+K +D
Sbjct: 278 DL-------KSDVEFVKKKKSKD 293

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 140/290 (48%), Gaps = 26/290 (8%)

Query: 541 ELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E++G+G  + V K V  S  K +A+K +S  +    +++G   E+E+L++L D  R+V+L
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMG-NMEGVSRELEVLQQL-DHPRIVRL 256

Query: 600 IDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
                +    Y+VME     DL   +A  A+     E  +  ++++L+ V+ +H  GI H
Sbjct: 257 KGFYEDKDSYYMVMEFVSGGDLMDFVA--AHGAVGEEAGKEISRQILEAVKYIHSKGISH 314

Query: 659 SDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTP 715
            DLKP N +  +    ++KI DFG+A    + +   +  T  GT  Y+APE +       
Sbjct: 315 RDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS---FMKTFCGTLAYVAPEVI------G 365

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
            +G+T +E    R +     D+WS GC++Y ++ G  P+ G   Q +L   ++   +  Y
Sbjct: 366 GKGETNEE----RNEYSSLVDMWSMGCLVYVILTGHLPFSG-STQEQLYKQIS---RGSY 417

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFF 825
            E       +   A   I + L+ NP  R T    L  P+IK    +  F
Sbjct: 418 HEGPLKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIKMAQYSQSF 467

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 134/302 (44%), Gaps = 36/302 (11%)

Query: 536 EYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           +Y  +  +G+G S  VY       N   A+K+++ ++     +     EI ++K      
Sbjct: 660 KYASLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKEL--IINEILVMKG-SKHP 716

Query: 595 RVVKLIDHEMNHGVLYVVMECGDH-DLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +V  ID  +  G L+V+ME  +   L+ V+         I  V    +E L  ++ +H 
Sbjct: 717 NIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLSGLKFLHS 773

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K  N +  ++G +K+ DFG    +  + +N+ R T +GTP +MAPE +    
Sbjct: 774 KGVLHRDIKSDNILLSMEGDIKLTDFGFCAQI--NELNLKRTTMVGTPYWMAPEVVSRKE 831

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL-LAIMNPEV 771
           Y P              KV    DIWS G +I +MI G PPY        L L   N   
Sbjct: 832 YGP--------------KV----DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTP 873

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIK 831
           K+  PE  +      +  LD    CL   PE R +  DLL   +I  ++  +  +  L+K
Sbjct: 874 KLKEPENLSS---YLKKFLD---WCLCVEPEERASATDLLHDEYITEIAEANSTLAPLVK 927

Query: 832 NA 833
            A
Sbjct: 928 LA 929

>KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]
           {ON} similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054W SMK1 Mitogen-activated protein kinase required
           for spore morphogenesis that is expressed as a middle
           sporulation-specific gene
          Length = 439

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 142/320 (44%), Gaps = 55/320 (17%)

Query: 537 YEKVELLGRGGSSKVYKVRSSNNKIY----ALKRVSFDEFDDTSIDGFKGEIELLKRLED 592
           YE +++LG+G    V       N  +    A+K+V+     +  +     E++ +   + 
Sbjct: 73  YEILQVLGKGSYGTVVSAVDKGNPTHEVQLAIKKVTSIFTREILLKRAIRELKFMSYFKG 132

Query: 593 QTRVVKLIDHEMN----HGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCV 648
              +V LID E+     +  LY   E  D+DL++V+   +N+ F    +++   ++L  +
Sbjct: 133 HRNIVSLIDLEIVNEEPYSGLYCYQELVDYDLARVI--HSNVLFSEFHIKHFLYQILCGM 190

Query: 649 QVVHDTGIVHSDLKPANFVF-VKGILKIIDFGIANAV-PDHTVNIYRDTQIGTPNYMAPE 706
           + +H   ++H DLKP N +  + G +KI DFG+A  + P  TV        G  N++   
Sbjct: 191 KYIHSADVIHRDLKPGNILCSITGEIKICDFGLARGISPSFTV------AGGISNHIT-- 242

Query: 707 ALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAI 766
                NY   +     E+  +  +  K  D+W+ GCI+ +  YGR P   F G + L  +
Sbjct: 243 -----NYVATRWYRAPELILSHKRYSKSVDMWAVGCILAEF-YGRKPV--FMGNDSLHQV 294

Query: 767 MNPEVKIVYP------------------------EKTTHGDLVPRT---ALDTIKACLER 799
           M  +  +  P                        +KT   ++ P     A+D ++  ++ 
Sbjct: 295 MEIQKILGTPKQIVIRTYGSSRCYDIFSTSKPQYKKTPWCEIFPYASSEAVDLMERLIDW 354

Query: 800 NPERRWTVDDLLRGPFIKPV 819
           NPE R TV++ L  PF++ V
Sbjct: 355 NPEARLTVEEALDHPFLQQV 374

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 136/282 (48%), Gaps = 21/282 (7%)

Query: 541 ELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKL 599
           E++G+G  + V K +  +  K +A+K +S  +    ++DG   E+E+L++L +  R+V+L
Sbjct: 202 EVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIG-NMDGVTRELEVLQKL-NHPRIVRL 259

Query: 600 IDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVH 658
                +    Y+VME     DL   +A    +  D    R  ++++L  V+ +H  GI H
Sbjct: 260 KGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAG--REISRQILTAVKYIHSMGISH 317

Query: 659 SDLKPANFVFVKG---ILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTP 715
            DLKP N +  +    ++KI DFG+A    + +   +  T  GT  Y+APE +   + + 
Sbjct: 318 RDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS---FMKTFCGTLAYVAPEVIRGKDSSA 374

Query: 716 DQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 775
              + E+     R +     D+WS GC++Y ++ G  P+ G   Q++L   +    +  Y
Sbjct: 375 SPDEYEE-----RNEYSSLVDMWSMGCLVYVILTGHLPFSG-STQDQLYKQIG---RGSY 425

Query: 776 PEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
            E       +   A D I + L+ +P  R T    L  P+IK
Sbjct: 426 HEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIK 467

>Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {ON}
           YBR028C - Hypothetical ORF [contig 184] FULL
          Length = 515

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/371 (25%), Positives = 160/371 (43%), Gaps = 72/371 (19%)

Query: 515 TENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSN-NKIYALKRVSFDEF- 572
           +E  SY  P    +       ++  V +LGRG   KV  V+ S+ +++YA+K++   E  
Sbjct: 103 SERSSYCAPSVFDKHGTRTLEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEIL 162

Query: 573 --DDTSIDGFKGEIELLKRLE------------DQTRVVKLIDHEMNHGVLYVVME-CGD 617
             D +S +G + +  L KRLE            +   +VKL     +H  LY++++    
Sbjct: 163 IHDGSSEEG-QPDSNLEKRLERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPG 221

Query: 618 HDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-VKGILKII 676
            +L   L ++  +  D + V ++A E+   ++ +H  G+V+ DLKP N +   +G L + 
Sbjct: 222 GELFYHLKEQGTL--DEDTVAFYAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLT 279

Query: 677 DFGIANAVP--------DHTVNIYRDTQ-------IGTPNYMAPEALVAMNYTPDQGQTE 721
           DFG++            D   N +           IGTP Y APE L    YT       
Sbjct: 280 DFGLSKVSASDDSADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYT------- 332

Query: 722 QEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTH 781
               QN        D +S GC+I+ M+ G+PPY G   +     I+N  +K   P+  ++
Sbjct: 333 ----QN-------CDWYSLGCLIFDMLIGKPPYTGVNHK----VILNKILKDKIPKIPSY 377

Query: 782 GDLVPRTALDTIKACLERNPERRWTVDDLLR--GPFIKPVSV---------THFFIRDLI 830
              +     D + A L+++  +RW VD      GP +K              HF  R + 
Sbjct: 378 ---LSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKKAGQAKTTSFQAHFVFRKIS 434

Query: 831 KNAVKYGSDQR 841
              ++ G  QR
Sbjct: 435 WLKMETGELQR 445

>Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} similar to
            Ashbya gossypii ACR191C
          Length = 1143

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 88/365 (24%), Positives = 157/365 (43%), Gaps = 51/365 (13%)

Query: 496  IIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVR 555
            ++ P++   ++T P+KP S      ++P+R++    V+  ++  +++LG+G   KV   +
Sbjct: 781  VVTPIQP--LSTSPIKPHSAGRHKRKSPKRRK----VSLDDFILLKVLGKGNFGKVLLAK 834

Query: 556  SSN-NKIYALKRVSFDEF-DDTSIDGFKGE--IELLKRLEDQTRVVKLIDHEMNHGVLYV 611
            S N +++ A+K +  D    +  I+  + E  + LL        +  L         +Y 
Sbjct: 835  SKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYF 894

Query: 612  VME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVF-V 669
             ME  G  DL   +    N    +   +++A E+L  ++  HD GI++ DLK  N +  +
Sbjct: 895  AMEFIGGGDL---MWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGIIYRDLKLENILLTL 951

Query: 670  KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRW 729
            +G +KI D+G+      H       T  GTP +MAPE L    YT               
Sbjct: 952  EGHIKIADYGLCKDNMWHGNKT--STFCGTPEFMAPEILKEQAYT--------------- 994

Query: 730  KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTA 789
               K  D W+ G ++YQM+  + P+ G        AI+  E   +YP     GD+V    
Sbjct: 995  ---KAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEP--LYPIDMA-GDIV---- 1044

Query: 790  LDTIKACLERNPERRWTVD-----DLLRGPFIKPVSVTHFF---IRDLIKNAVKYGSDQR 841
                +  L ++PE+R         +++  PF + ++    F   +       +K   D  
Sbjct: 1045 -QIFQGLLTKDPEKRLGAGTRDALEVMEEPFFRNINFDDIFNLRVESPYIPIIKAADDTS 1103

Query: 842  YVSKE 846
            Y  KE
Sbjct: 1104 YFEKE 1108

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 126/284 (44%), Gaps = 38/284 (13%)

Query: 536 EYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           +Y   +++GRG    VYK +    +++ A+K + ++   D  ++    EI LLK L +  
Sbjct: 24  QYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEIVYES--DEELNDIMAEISLLKNL-NHD 80

Query: 595 RVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +VK          LY+++E C +  L +++++ +    + E   Y  Q +L  ++ +H 
Sbjct: 81  NIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKSYVTQTLLG-LKYLHG 139

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K AN +      +K+ DFG++  V    +     T  GT N+MAPE L    
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-----TLAGTLNWMAPEIL---- 190

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
                         NR      SDIWS G  + +M+   PPY      N   A+ N    
Sbjct: 191 -------------GNR-GASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDT-- 234

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
             YP  +    L      D +  C  +N  +R T D LL+  +I
Sbjct: 235 -YYPPSSFSESLK-----DFLSKCFVKNMYKRPTADQLLKHAWI 272

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/329 (27%), Positives = 145/329 (44%), Gaps = 43/329 (13%)

Query: 532 VNGSEYEKVELLGRGGSSKVYKVRS-SNNKIYALKRVSFDEF--DDTSIDGFKGEIELLK 588
           +N S+Y   + LG G    V + +  S ++  A+K +       +D  +     E+ +L+
Sbjct: 42  INKSDYVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGNDVQLQMLYDELSILQ 101

Query: 589 RLEDQTRVVKLIDHEMNHGVLYVVMECG-DHDLSQVLAQRANMPFDIEFVRYHAQEMLKC 647
           RL     +V+  D   +    Y+V +     +L   + +R     +++ V+   Q MLK 
Sbjct: 102 RLH-HPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFT-EVDAVKIIIQ-MLKA 158

Query: 648 VQVVHDTGIVHSDLKPANFVFV----KGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYM 703
           ++ +H   IVH DLKP N +++       L I DFGIA  + D    I++    G+  Y+
Sbjct: 159 IEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAA--GSLGYV 216

Query: 704 APEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 763
           APE L    +                  GKP DIWS G I Y ++ G   Y  F  +  +
Sbjct: 217 APEVLTTNGH------------------GKPCDIWSLGVITYTLLCG---YSAFIAET-V 254

Query: 764 LAIMNPEVKIVYPEK--TTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSV 821
              +      +YP K    + + V R A + I   L  NP+ R T  +LL  P+IK  S+
Sbjct: 255 EGFLEECTSNIYPVKFHEPYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIKSKSL 314

Query: 822 -THFFIRDLIKNAVKYGSDQRYVSKEKVE 849
            TH  + D     VK G D R   +E VE
Sbjct: 315 QTHDLLPD-----VKKGFDARKKFREAVE 338

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 127/284 (44%), Gaps = 38/284 (13%)

Query: 536 EYEKVELLGRGGSSKVYK-VRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQT 594
           +Y   +++GRG    VYK +    +++ A+K + ++  +D  ++    EI LLK L +  
Sbjct: 24  QYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEIVYE--NDEELNDIMAEISLLKNL-NHH 80

Query: 595 RVVKLIDHEMNHGVLYVVME-CGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHD 653
            +VK          LY+++E C +  L +++++ +    + E   Y  Q +L  ++ +H 
Sbjct: 81  NIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLG-LKYLHG 139

Query: 654 TGIVHSDLKPANFVF-VKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMN 712
            G++H D+K AN +      +K+ DFG++  V    +     T  GT N+MAPE L    
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-----TLAGTLNWMAPEIL---- 190

Query: 713 YTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVK 772
                         NR      SDIWS G  + +M+   PPY      N   A+ N    
Sbjct: 191 -------------GNR-GASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDT-- 234

Query: 773 IVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFI 816
             YP  +    L      D +  C  +N  +R T D LL+  +I
Sbjct: 235 -YYPPSSFSESLK-----DFLSKCFVKNMYKRPTADQLLKHVWI 272

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 159/353 (45%), Gaps = 49/353 (13%)

Query: 517 NGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKV---YKVRSSNNKIYALKRVSFDEFD 573
           NGSY + +            Y+ V+ LG G   KV   Y V ++  K+ ALK ++     
Sbjct: 19  NGSYVSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHV-TTGQKV-ALKIINKKVLA 76

Query: 574 DTSIDG-FKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPF 632
            + + G  + EI  L RL     ++KL D   +   + +V+E   ++L   + QR  M  
Sbjct: 77  KSDMQGRIEREISYL-RLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRNKMSE 135

Query: 633 DIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNI 691
             +  R   Q+++  V+  H   IVH DLKP N +  + + +KI DFG++N + D     
Sbjct: 136 --QEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN--- 190

Query: 692 YRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGR 751
           +  T  G+PNY APE +    Y                  G   D+WSCG I+Y M+  R
Sbjct: 191 FLKTSCGSPNYAAPEVISGKLYA-----------------GPEVDVWSCGVILYVMLCRR 233

Query: 752 PPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPR----TALDTIKACLERNPERRWTV 807
            P+             +  + +++   +     +P+     A D IK  L  NP  R ++
Sbjct: 234 LPFD------------DESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVNPLNRISI 281

Query: 808 DDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWNRLS 860
            ++++  + K V +  + +   +K   ++  +++  ++E VE++ D++   LS
Sbjct: 282 HEIMQDEWFK-VDLAEYLVPQDLKQQEQF--NKKSGNEENVEEIDDEMVVTLS 331

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 131/286 (45%), Gaps = 38/286 (13%)

Query: 537 YEKVELLGRGGSSKV---YKVRSSNNKIYALKRVSFDEFDDTSIDG-FKGEIELLKRLED 592
           Y+ ++ LG G   KV   Y V ++N K+ ALK ++      + + G  + EI  L RL  
Sbjct: 68  YQIIKTLGEGSFGKVKLAYHV-TTNQKV-ALKIINKKVLAKSDMQGRVEREISFL-RLLR 124

Query: 593 QTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVH 652
              ++KL D   +   + +V+E  +++L + + QR  M  +    R   Q+++  V+  H
Sbjct: 125 HPHIIKLYDVIKSKDEIIMVIEYANNELFEYIVQRDKMTEN--EARKFFQQIISAVEYCH 182

Query: 653 DTGIVHSDLKPANFVFVKGI-LKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAM 711
              IVH DLKP N +  + + +KI DFG++N + D     +  T  G+PNY APE +   
Sbjct: 183 RHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGK 239

Query: 712 NYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEV 771
            Y                  G   D+WSCG I+Y M+  R P+      + + A+     
Sbjct: 240 LYA-----------------GPEVDVWSCGVILYVMLCRRLPF----DDDSIPALFKNIS 278

Query: 772 KIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIK 817
             +Y    T    +   A + IK  L  NP  R ++ +++   + K
Sbjct: 279 NGIY----TLPKFLSEGAANLIKKMLIVNPLNRISMTEIIHDEWFK 320

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,311,964
Number of extensions: 3954317
Number of successful extensions: 18823
Number of sequences better than 10.0: 2035
Number of HSP's gapped: 16120
Number of HSP's successfully gapped: 2217
Length of query: 864
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 746
Effective length of database: 39,950,811
Effective search space: 29803305006
Effective search space used: 29803305006
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)