Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47905.430ON63061826740.0
SAKL0G02442g5.430ON62358315550.0
KLTH0F16148g5.430ON64664215020.0
KLLA0E21165g5.430ON62762814820.0
AER259W5.430ON61957014670.0
Kwal_55.214445.430ON64463214560.0
NCAS0F033505.430ON63962214450.0
Smik_4.6325.430ON62758414170.0
NDAI0B056405.430ON66965514180.0
Suva_2.5385.430ON62959414070.0
KAFR0E039105.430ON62561513600.0
YDR365C (ESF1)5.430ON62859213571e-180
TBLA0A065405.430ON65962013541e-179
ZYRO0F09944g5.430ON61158813491e-179
Kpol_1016.85.430ON63759313471e-179
CAGL0L11638g5.430ON60858813411e-178
KNAG0C049405.430ON64261013251e-175
TPHA0H017805.430ON62262012881e-170
TDEL0E019505.430ON61762212791e-169
Skud_4.6355.430ON62958412541e-165
CAGL0L11572g5.407ON81341742.7
YGR145W (ENP2)4.77ON70735733.0
Smik_6.2484.77ON70735733.2
Suva_7.4354.77ON70835733.6
Skud_7.4674.77ON70835707.6
ZYRO0D09482g7.145ON28946689.2
NDAI0D037804.77ON70731699.4
KNAG0D021408.140ON87050699.7
TDEL0F027204.77ON69431699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4790
         (630 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...  1034   0.0  
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   603   0.0  
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   583   0.0  
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   575   0.0  
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   569   0.0  
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   565   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   561   0.0  
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   550   0.0  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   550   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   546   0.0  
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   528   0.0  
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   527   e-180
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   526   e-179
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   524   e-179
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   523   e-179
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   521   e-178
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   514   e-175
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   500   e-170
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   497   e-169
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   487   e-165
CAGL0L11572g Chr12 (1236335..1238776) [2442 bp, 813 aa] {ON} sim...    33   2.7  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    33   3.0  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    33   3.2  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    33   3.6  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    32   7.6  
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    31   9.2  
NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {O...    31   9.4  
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    31   9.7  
TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {O...    31   9.9  

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score = 1034 bits (2674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/618 (86%), Positives = 535/618 (86%)

Query: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60
           MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR
Sbjct: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60

Query: 61  RIGSYDEKEAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXX 120
           RIGSYDEKEAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVP         
Sbjct: 61  RIGSYDEKEAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSDE 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFV 180
                                 IEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFV
Sbjct: 121 NSSSESEEESEDSALDPDSELEIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFV 180

Query: 181 PNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXXXXLYEV 240
           PNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQ                  LYEV
Sbjct: 181 PNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQSKKEKDSDDENSDIDINDLYEV 240

Query: 241 DDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVP 300
           DDAEKDYDSKA             AVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVP
Sbjct: 241 DDAEKDYDSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVP 300

Query: 301 DNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIE 360
           DNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIE
Sbjct: 301 DNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIE 360

Query: 361 EMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTP 420
           EMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTP
Sbjct: 361 EMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTP 420

Query: 421 GLENGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVT 480
           GLENGDAPKEENEEETALD                     MQAIDEKKARRRKGDDGAVT
Sbjct: 421 GLENGDAPKEENEEETALDKIKRKEKERRKKRKERVKELKMQAIDEKKARRRKGDDGAVT 480

Query: 481 EAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIV 540
           EAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIV
Sbjct: 481 EAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIV 540

Query: 541 DDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAFNKRKA 600
           DDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAFNKRKA
Sbjct: 541 DDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAFNKRKA 600

Query: 601 SYDHPQSGQTDSLNSLVE 618
           SYDHPQSGQTDSLNSLVE
Sbjct: 601 SYDHPQSGQTDSLNSLVE 618

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/583 (55%), Positives = 396/583 (67%), Gaps = 7/583 (1%)

Query: 9   DPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEK 68
           +P TND RF+GIH+DPKF+  K   LKI LDDRFSKKDLE K+KAKVDKYGRR+   D K
Sbjct: 8   NPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNK 67

Query: 69  EAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXX-XXXXXXXXXXXXXX 127
           E KDF+RYF K E            E E   V++LDRARGEVP                 
Sbjct: 68  ETKDFERYFEKEEESSSPSD----EEGESTKVTSLDRARGEVPSDYLSSSEEESSSESEE 123

Query: 128 XXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIK 187
                          IEESKP TGD T++ AVVNLDWDHV+S DL+ TF+SFVP GG I 
Sbjct: 124 ESENSELESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKIL 183

Query: 188 KVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXXXXLYEVDDAEKDY 247
           K+AIYPSEFGKERM+REEVEGPPRELF+ K+                  LYE  DAEKDY
Sbjct: 184 KIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKDGDDSDVDIKD-LYEEGDAEKDY 242

Query: 248 DSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFED 307
           DSKA             AVV+C++V TA+AIYQNCDGTE+ESTANMFDLRYVP+ M F D
Sbjct: 243 DSKALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSD 302

Query: 308 DPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAY 367
           +P+D+C  VPK+YKP QFST ALQHS VKLTWDETPA+RVE+SKRAF QKEIE+MDFKAY
Sbjct: 303 EPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAY 362

Query: 368 LASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSE-EEADVEITFTPGLENGD 426
           LASDS+ SE E NE ++N L+SLV++SI++  KS+FDK  +E  + D+EITFTPGL+   
Sbjct: 363 LASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGLDEAK 422

Query: 427 APKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVTEAEKEL 486
              E+ ++ET ++                      +A ++K+ +  K D  + T  E E 
Sbjct: 423 KDDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQSKTADEVEK 482

Query: 487 RKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKP 546
            KK +AELELLM++D+   +S LN  AHFNM EI++S+KEK K+++YQN+  IV+D FKP
Sbjct: 483 EKKSKAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKP 542

Query: 547 DLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSS 589
           DLNDPRF+EVFEDHDFAIDPSQPEFK T AMKEIL+ER +R S
Sbjct: 543 DLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRVS 585

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/642 (50%), Positives = 409/642 (63%), Gaps = 35/642 (5%)

Query: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60
           MS + E R   ++D RFAG+ NDPKFR+ +  K KI LDDRFSKKDLEFKRKA+VDKYGR
Sbjct: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60

Query: 61  RIGSYDEKEAKDFDRYFSKNES---------VEKIQSDDEEGET--EDIAVSA----LDR 105
           R+   + K+ +DFD+Y+ K +S         V K   +D EG +  E+ A SA    LDR
Sbjct: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDR 120

Query: 106 ARGEV-PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDW 164
           ARGEV                                 IEE + ++GD +K  AVVNLDW
Sbjct: 121 ARGEVHSDYVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDW 180

Query: 165 DHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXX 224
           DHV+S DL+ TF+SFVP GG I +VAIYPSEFGKER+ +EE EGPPRE+FK K+      
Sbjct: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240

Query: 225 XXXXXXXXXXXXLYEVDDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDG 284
                       LYE  DA+ D+D+K+             AVVYC++  TA++IY+NCDG
Sbjct: 241 GDDSDEELTVKDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDG 299

Query: 285 TEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPA 344
           TE+ESTANMFDLRYVPD M F+D+ RD+C SVPK+Y+P++FST ALQHS+VK TWDETPA
Sbjct: 300 TEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPA 359

Query: 345 DRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFD 404
           DR  ++KRAF Q+EIE+MDFKAYLASDS+ SE E N++ KN L+SLVN S+QV  KS+FD
Sbjct: 360 DRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFD 419

Query: 405 KHGSEEEADV--EITFTPGLE---NGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXX 459
           +   + E+DV  +ITF P L    +GDA   E  EET L+                    
Sbjct: 420 QDPKDGESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKEL 479

Query: 460 XMQAIDEKKAR----RRKGDDGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHF 515
             QA D+KK +    RRK +  A          K QAELELLM++D     S LN  AHF
Sbjct: 480 KKQAEDDKKQKLKEARRKPEPSATD-------SKSQAELELLMMDDSEEANSKLNKKAHF 532

Query: 516 NMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTP 575
           NMNEI++S+KEK KK+++Q+KN IV+D FKPDLNDPRF EVFEDHDFAIDPSQPEFK T 
Sbjct: 533 NMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTA 592

Query: 576 AMKEILEERTRRSSKMKKAFNKRKASYDHPQSGQTDSLNSLV 617
           AMK+IL+ER +RS K K    KR+A+ D  +    + L  LV
Sbjct: 593 AMKQILQERNKRSQKGKN--KKREANGDIAEPSGNNDLKGLV 632

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/628 (52%), Positives = 414/628 (65%), Gaps = 22/628 (3%)

Query: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60
           M+ K EK++ +T D RF+GIHNDPKFR  K    KI LDDRFSK+DLE +RKAKVDKYGR
Sbjct: 1   MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR 60

Query: 61  RIGSYDEKEAKDFDRYFSKNESVEKIQSDD-------EEGETEDIAVSALDRARGEVPXX 113
           +I   + K+ KDFDRYF+K +  +K    +       +E E   +   ++DRARGE P  
Sbjct: 61  KIVDAN-KDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAA-VHAKSVDRARGE-PPA 117

Query: 114 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLL 173
                                        +EESKP +G+ T   AVVNLDWDHV+S DL 
Sbjct: 118 DYVSSSDEESSSESEEESGDSDIESEEIELEESKPASGNATNTLAVVNLDWDHVKSADLF 177

Query: 174 ATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXX 233
            TF SFVP GG I+K+AIYPSEFGKERM+REE+EGPP+ELF   Q               
Sbjct: 178 VTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELF---QSKKSKKNDKDDDEIN 234

Query: 234 XXXLYEVDDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANM 293
              +YE  DAE DYDSKA             AVVYCSD+ TA++IYQNCDGTE+ESTAN+
Sbjct: 235 VESIYEEGDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTANV 293

Query: 294 FDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRA 353
           FDLRYVPD M+ +DDPRD+C S+PK+YKP QFST ALQHS+VKLTWDETPADRVEISKRA
Sbjct: 294 FDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRA 353

Query: 354 FNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEE--E 411
           F QKEIEEMDFKAYLASDS+ SE E +++ KN L++LV DS++V  KS+FD+   E+  E
Sbjct: 354 FTQKEIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNE 413

Query: 412 ADVEITFTPGL-ENGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKAR 470
           AD+EITFTPGL E+G     +NEEE+ +D                      ++  + K  
Sbjct: 414 ADMEITFTPGLDESGQQDTNDNEEESTIDKIRRKEKERRKKRKDRVKELKKESEAKLKEN 473

Query: 471 RRKGDDGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKK 530
            +K  D + +  +     KK+ ELELLML++  G +ST+NN AHFNMNEI+KS+KEK+KK
Sbjct: 474 LKKKKDTSHSIDD----DKKKGELELLMLDENEG-ESTINNKAHFNMNEILKSEKEKSKK 528

Query: 531 SRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSK 590
           ++YQNK  IVDD F PD+NDPRFKEVFEDHDFAIDP+QPEFKKTPAM++IL+ERT RSSK
Sbjct: 529 AKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVRSSK 588

Query: 591 MKKAFNKRKASYDHPQSGQTDSLNSLVE 618
             +   +     +   S   + +  LVE
Sbjct: 589 KSRGKKRNHEIANTEHSKDINKIGGLVE 616

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/570 (57%), Positives = 402/570 (70%), Gaps = 9/570 (1%)

Query: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAKDF 73
           D RFA I +DPKFR PK   LKI LDDRFSK+DLE+KRKAKVDKYGRRIG+   KE KDF
Sbjct: 14  DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKEEKDF 73

Query: 74  DRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXXXXXXXXXXXXXXX 133
           ++YF+K  S    +  D+E    D +V+ LDRARGEVP                      
Sbjct: 74  EKYFTKESSESAAEESDKE----DSSVAKLDRARGEVPADYVSSSDEESSSESEADSDDA 129

Query: 134 XXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAIYP 193
                    IEE KPE+GDP+KV AVVNLDWDHV+  DLL  FNSFVP GG I++VAIYP
Sbjct: 130 TAESDEEVEIEEEKPESGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYP 189

Query: 194 SEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXXXXLYEVDDAEKDYDSKAXX 253
           SEFGKERM+REEVEGPPRE+FK K+                  LYE  DAEKDYDSKA  
Sbjct: 190 SEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDDEIGLKD--LYEQGDAEKDYDSKALR 247

Query: 254 XXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQC 313
                      AVVYC++V TA+AIYQNCDGTE+ESTANMFDLRYVP+ + F+D+PR++C
Sbjct: 248 RYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREEC 307

Query: 314 VSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSD 373
            SVPKDYKP QFSTSALQH QVKLTWDETPADRVE++KRAF+QKEIE+MDFKAYLASDS+
Sbjct: 308 ASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASDSE 367

Query: 374 SSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLENGDAPKEENE 433
            SE + N + KN LRSLV+ S++VA K +F     EEEADV+ITFTPGLE G+A +E+ E
Sbjct: 368 ESEADDNSEAKNKLRSLVS-SVKVADKPLFADESDEEEADVQITFTPGLEGGEAKEEDAE 426

Query: 434 EETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVTEAEKELRKKKQAE 493
           EE  L+                      QA +E+K   +K    + +E+E++    K+AE
Sbjct: 427 EENILEKLKRKEKERRKKRKERVKELKKQA-EEEKKSSKKEKHASKSESEQKSENDKRAE 485

Query: 494 LELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRF 553
           LELLM+ED+   +S +N++AHFNMN+I++S+KE+ KKS+YQ K+ IV+D+FKPDLNDPRF
Sbjct: 486 LELLMMEDDENSQS-INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRF 544

Query: 554 KEVFEDHDFAIDPSQPEFKKTPAMKEILEE 583
           KEVFED DFAIDPSQPEFK+T AMK+IL+E
Sbjct: 545 KEVFEDRDFAIDPSQPEFKETAAMKQILQE 574

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/632 (53%), Positives = 415/632 (65%), Gaps = 36/632 (5%)

Query: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAK 71
           ++D RFA +H+DPKFR+ K  K KI LDDRFSKKDL+FKRKA+VDKYGR +   + K+ K
Sbjct: 12  SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQENKDKK 71

Query: 72  DFDRYFSKNESV----------EKIQSDDEEG-ETEDIAVSA------LDRARGEVPX-X 113
           DFD+Y+ K++            EK  S+ E   E +DI  SA      LDRARGEVP   
Sbjct: 72  DFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEVPSDY 131

Query: 114 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLL 173
                                        IE++KP++GD +K  AVVNLDWDHV+S DL+
Sbjct: 132 VSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKSTDLM 191

Query: 174 ATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXX 233
            TF+SFVP+GG I K+A+YPSEFGKER+KREE+EGPPRE+FK K                
Sbjct: 192 ITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSDSDVD 251

Query: 234 XXXLYEVDDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANM 293
              LYE  DAE DYD+K+             AVVYC++V TA+AIY+NCDGTEFESTANM
Sbjct: 252 VRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEFESTANM 310

Query: 294 FDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRA 353
           FDLRYVPD M F+D+ RD+C S+PK+Y+P+QFST ALQHS+VKLTWDETPADRV +SKRA
Sbjct: 311 FDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRVAMSKRA 370

Query: 354 FNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEAD 413
           F QKEIE+MDFKAYLASDS+ SE E N+  K  L+SLV+ S++V  KS+FD+   E E+D
Sbjct: 371 FTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFDQAPEEGESD 430

Query: 414 V--EITFTPGL-ENGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKAR 470
           V  +ITF PGL E  +  K+EN EET L+                      QA +EKK +
Sbjct: 431 VDMQITFAPGLAEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKELKKQAEEEKKQK 490

Query: 471 R---RKGDDGAVTEAEKELRKKKQAELELLML-EDETGKKSTLNNNAHFNMNEIIKSQKE 526
           R   R   +  V +A      K +AELELLM+ +DE    S LN  AHFNMNEI++S+KE
Sbjct: 491 RKESRYKPESTVEDA------KSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVRSEKE 544

Query: 527 KTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTR 586
           K KKSRYQNK+ IV+D FKPDLNDPRF EVFED DFAIDPSQPEFK T AMK+IL+ERT+
Sbjct: 545 KGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTK 604

Query: 587 RSSKMKKAFNKRKASYDHP-QSGQTDSLNSLV 617
           RS K +    KRKA  +   Q+GQ+D L  LV
Sbjct: 605 RSHKGQN--KKRKADGNLANQNGQSD-LKGLV 633

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/622 (52%), Positives = 408/622 (65%), Gaps = 26/622 (4%)

Query: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI---GSYDEK 68
           T+DSRF+GI+NDPKFRK K   LKI LD+RFSKKDLE +RKAKVDKYGR+I      + K
Sbjct: 10  TDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKIHEDNDMNNK 69

Query: 69  EAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXXXXXXXXXX 128
           E KDFD+YF K     + +S DE+ E E+I    +DRARGEVP                 
Sbjct: 70  ELKDFDKYFEK-----EGESADEKKEEEEIETVTVDRARGEVPADYVSSSDEYTSSESED 124

Query: 129 XXXXXXXXXXXXX-XIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIK 187
                          ++E+ PETGD TK  AVVNLDWDHVRS DL+ TF+ F+P GG I+
Sbjct: 125 SGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFLPKGGKIE 184

Query: 188 KVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXXXX---LYEVDDAE 244
           K+ + PSEFGKERM+REE EGPPRELF++K+                     LYE  DA+
Sbjct: 185 KIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVDIKDLYEEGDAD 244

Query: 245 KDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMK 304
           KD D++A             AVVYC+ V  A+AIY+NCDGTE+ESTANMFDLRYVPD M 
Sbjct: 245 KDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRYVPDGMD 304

Query: 305 FEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDF 364
           F+D+PRDQC S+PK+YKP QFST ALQHS VKLTWDETPA+RVE++KRAF QKEIE+MDF
Sbjct: 305 FDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKEIEDMDF 364

Query: 365 KAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDK----HGSEEEADVEITFTP 420
           KAYLASDSD SE E N+  KN L+SLV DS+++ ++ +F       G +EE D+EITF P
Sbjct: 365 KAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEGEDEEVDMEITFDP 424

Query: 421 GLENGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKK-----ARRRKGD 475
           GL  G   K E  EET ++                       A  EKK      + +K +
Sbjct: 425 GLSEG-VEKTEEHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLKSLKGKKHN 483

Query: 476 DGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQN 535
           D   TE +    K K AELELLM++DE   ++ +N  AHFNM EI++S+KEK+KK +YQ+
Sbjct: 484 DS--TEGDASTAKSK-AELELLMMDDEDDTETGINKKAHFNMKEILRSEKEKSKKGKYQD 540

Query: 536 KNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAF 595
           K  IV+DNFKPDLNDPRFKEVFEDHDFAIDPS+PEFK+TPAMKEIL+ER++RSSK  +  
Sbjct: 541 KRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRSSKNAQK- 599

Query: 596 NKRKASYDHPQSGQTDSLNSLV 617
            KR  S    Q+ +T  ++++V
Sbjct: 600 KKRSHSLMDNQANETSDISNIV 621

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/584 (51%), Positives = 382/584 (65%), Gaps = 22/584 (3%)

Query: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI-GSYDEKEAKD 72
           D+RFAGI++DPKF+  +    KI LD RFSKKDLE + K+KVDKYGR+I  + + KE +D
Sbjct: 12  DTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNTQNNKELED 71

Query: 73  FDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXX-XXXXXXXXXXX 131
           FD+YF K       +++++E +TE    + +DRARGE+                      
Sbjct: 72  FDKYFQK-------EAENDE-DTEASVKTVVDRARGEISGDYVSSSDEFTSSDSESSEQS 123

Query: 132 XXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAI 191
                      IE+ KPE GD +K  AVVNLDWDHV+S DL+ TF+SFVP GG +++VAI
Sbjct: 124 EVESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAI 183

Query: 192 YPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXX-----XXLYEVDDAEKD 246
           YPSEFGKERM+REEVEGPP+ELF++K                        LYE  DA+KD
Sbjct: 184 YPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDADKD 243

Query: 247 YDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFE 306
            DS+A             A+VYCSD+ T+KAIY NCDGTE+ESTANMFDLRYVPD M F+
Sbjct: 244 VDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303

Query: 307 DDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKA 366
           D  RD+C  +PK+Y+P QFST ALQHS VKLTWDETPADR+E++KRAF QKEI++MDFKA
Sbjct: 304 DAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKA 363

Query: 367 YLASDSDSSEGETNEKTKNALRSLVND-SIQVAHKSVFDKHGSEEEADVEITFTPGLENG 425
           YLASDSD S+ + +E  KN L+SLV   +     ++V D   S+EE D+EITFTP LE G
Sbjct: 364 YLASDSDESDEQIDEDAKNKLKSLVGGINFNSKKENVKD---SDEEVDMEITFTPALEGG 420

Query: 426 DAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVTEAEKE 485
           +    E +EET ++                      Q+  +KK  + K  +    E E++
Sbjct: 421 NEQPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKT-KLKSINKKYAEGEED 479

Query: 486 LRK--KKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDN 543
           ++   K +AELELLM +D+   + T+NN AHFNMNEI++S+KEK KKSRYQNK  IV+DN
Sbjct: 480 IKNNAKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDN 539

Query: 544 FKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRR 587
           F PDLNDPRFKEVFEDHDFAIDP+QPE+K T AM +IL+ER +R
Sbjct: 540 FTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKR 583

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/655 (48%), Positives = 401/655 (61%), Gaps = 66/655 (10%)

Query: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSY--DEKE 69
           + D RFA I+NDPKFRK K   LKI LDDRFSKKDLE +RK+KVDKYGR++     +EKE
Sbjct: 11  STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNEKE 70

Query: 70  AKDFDRYFSKNESVEKIQSDDEEGETEDIAV------------------------SALDR 105
             DFD+YF K         DDE+ E+E+IA                         + +DR
Sbjct: 71  MNDFDKYFEK---------DDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNIDR 121

Query: 106 ARGEVPXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDW 164
           ARG+VP                                +   +PE+G+P+K  AVVNLDW
Sbjct: 122 ARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLDW 181

Query: 165 DHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXX 224
           DHV+S DL+ TF+SF+P GG I+ +AIYPSEFGKERM+RE+VEGPP+ELF++++      
Sbjct: 182 DHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSKS 241

Query: 225 XXXXXXXXXX-------XXLYEVDDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKA 277
                              LYE  DA+KD D+KA             AVVYC+++ TA A
Sbjct: 242 KKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETATA 301

Query: 278 IYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKL 337
           IYQNCDGTE+ESTANMFDLRYVPD M F D+PRDQC S+PK+YKP QFST ALQHS VKL
Sbjct: 302 IYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKL 361

Query: 338 TWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQV 397
           TWDETP +R E++KRAF QKEI++MDFKAYLASDSD SE E NE  KN L++LV      
Sbjct: 362 TWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGG-GF 420

Query: 398 AHKSVFDKHGS-----EEEADVEITFTPGLENGDAPKEENE-EETALDXXXXXXXXXXXX 451
             + +F   G+     E+E D+EITF P L+  ++PKE+ E EET ++            
Sbjct: 421 GSREIFGGKGAKAGEDEDEVDMEITFNPALDE-NSPKEDGEHEETTIEKVARKEKERRKA 479

Query: 452 XXXXXXXXXMQAIDE---------KKARRRKGDDGAVTEAEKELRKKKQAELELLMLEDE 502
                     +A  E          K    K DD     AE +  +K +AELELLM++D+
Sbjct: 480 RKQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDD-----AEAKKNQKSRAELELLMMDDD 534

Query: 503 TGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDF 562
               ST+NN AHFNMNEI++S+KEK K+ +YQNK+ IV+D FKPDLNDPRFKEVFEDHDF
Sbjct: 535 EETGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDF 594

Query: 563 AIDPSQPEFKKTPAMKEILEERTRRSSKMKKAFNKRKASYDHPQSGQTDSLNSLV 617
           AIDPS+PEFK+T AMKEIL+ER++R  K K +  KR+ S       ++  + ++V
Sbjct: 595 AIDPSRPEFKETKAMKEILKERSKRIHK-KGSNKKRRLSITENAGAESSDITNIV 648

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/594 (50%), Positives = 385/594 (64%), Gaps = 20/594 (3%)

Query: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI-GSYDEKEAKD 72
           D+RFAGI+NDPKF+  +    KI LD RFSKKDLE + K+KVDKYGR+I  +++ KE +D
Sbjct: 12  DARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDAHNTKELED 71

Query: 73  FDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXX-XXXXXXXXXXX 131
           FD+YF K       ++++EE    D+  + +DRARGEVP                     
Sbjct: 72  FDKYFEK-------EAENEEDTEADVKAT-VDRARGEVPNDYVSSGDEFTSSDSESSGES 123

Query: 132 XXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAI 191
                       E++KPE+GD +K  AVVNLDWDHV+S DL+ TF+ FVP GG I+++++
Sbjct: 124 EIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIERISV 183

Query: 192 YPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXX-----XXLYEVDDAEKD 246
           YPSEFGKERM+REE+EGPP+ELF+RK+                       LYE  DA+KD
Sbjct: 184 YPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLYEEGDADKD 243

Query: 247 YDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFE 306
            DS+A             A+V CSD+ TA+AIY+NCDGTE+ESTANMFDLRYVPD M F+
Sbjct: 244 VDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGMTFD 303

Query: 307 DDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKA 366
           D  RD C ++PK+Y+P QFST ALQHS VKLTWDETPADRVE++KRAF QKEI++MDFKA
Sbjct: 304 DTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMDFKA 363

Query: 367 YLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLENGD 426
           YLASDSD S+ E NE  K+ L+SLV   +    K      G EEE D+EITFTP LE GD
Sbjct: 364 YLASDSDESDEEVNEDAKSKLKSLVG-GLGFNSKKENANDGDEEEVDMEITFTPALEGGD 422

Query: 427 APKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVTEAEKEL 486
               E +EET+++                      Q+  EK+ + +  +   V + E+E+
Sbjct: 423 EKPIEGQEETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKKHVAD-EEEI 481

Query: 487 RK--KKQAELELLMLED-ETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDN 543
           +   K +AELELLM +D +   +S++N+ AHFNMNEI++S+KEK KKSRYQ K  IV+DN
Sbjct: 482 KNNAKSKAELELLMDDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVEDN 541

Query: 544 FKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAFNK 597
           F PDL DPRFKEVFEDHDFAIDP+QPE+K T AM +IL+ER +R    K+   K
Sbjct: 542 FTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGKRVHDRKRKHGK 595

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/615 (50%), Positives = 384/615 (62%), Gaps = 42/615 (6%)

Query: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI---GSYDEK 68
           ++D RF+ I+NDPKF+  K   LKI LD RFSK+DLE + KAKVDKYGR+    GS  +K
Sbjct: 8   SDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGS--KK 65

Query: 69  EAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXX-XXXXXXXXX 127
           E  DF++YF K +  EK  +       E      +DRARGEVP                 
Sbjct: 66  ELDDFEKYFEKEDEEEKKDT------EETEEKPKVDRARGEVPSDYVSSSDEYTSSESED 119

Query: 128 XXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIK 187
                          IE +KPETGD +K  AVVNLDWDHV+S DL+ TF+SFVP GG I 
Sbjct: 120 SEEEELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKIS 179

Query: 188 KVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXX--XXXXXXXXXLYEVDDAEK 245
           ++ IYPSEFGKER++REEVEGPP+ELF++K                     LYE  DAEK
Sbjct: 180 RICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDVDIKDLYEEGDAEK 239

Query: 246 DYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKF 305
           D DSKA             AVVYC+++ TA+AIY+NCDGTE+ESTANMFDLRYVPD M F
Sbjct: 240 DVDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTF 299

Query: 306 EDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFK 365
           +D+PRD+C S+PK+YKP QFST ALQHS VKLTWDETPADRVE++KRAF+QKEIE+MDFK
Sbjct: 300 DDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFK 359

Query: 366 AYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLE-- 423
           AYLASDSD SE E NE +KN L++LV +S+        D    E E D+EITFTPGL+  
Sbjct: 360 AYLASDSDESEEEVNENSKNKLKALVGESLDFGTNGASD---GESEVDMEITFTPGLDEA 416

Query: 424 -----------NGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRR 472
                           ++E E   A                       M+++ +KK+R+ 
Sbjct: 417 KESEEEKEESTIEKVRRKEKERRKA----RKDKLKQLKKDAENEKKEKMRSLHDKKSRK- 471

Query: 473 KGDDGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSR 532
                   E E E   K +AELELLM+EDE   + +LN  AHFN+NEII+S+KEK KK +
Sbjct: 472 -------AETENEEAAKAKAELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGK 524

Query: 533 YQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMK 592
           YQ K  IV+D+FKPDL+DPRFKEVFEDHDFAIDPSQPEFK+T AMK+IL ER++RS +  
Sbjct: 525 YQRKEKIVEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERS 584

Query: 593 KAFNKRKASYDHPQS 607
           K    +K   D   S
Sbjct: 585 KGGKNKKRKLDTSTS 599

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  527 bits (1357), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 300/592 (50%), Positives = 378/592 (63%), Gaps = 21/592 (3%)

Query: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI-GSYDEKEAKD 72
           D+RFAGI++DPKF+  K    KI LD RFSKKDLE + K+KVDKYGR+I  + + +E +D
Sbjct: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELED 71

Query: 73  FDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXX-XXXXXXXXXXX 131
           FD+YF      EK   +DE+ E    A + +DRARGEVP                     
Sbjct: 72  FDKYF------EKEAENDEDSEVN--AKTVVDRARGEVPDDYVSSSDEFTSSDSESSGES 123

Query: 132 XXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAI 191
                      IE +KPE+GD +K  AVVNLDWDHV+S DL+ TF+SFVP GG I++VAI
Sbjct: 124 EVESEEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAI 183

Query: 192 YPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXX-----XXLYEVDDAEKD 246
           YPSEFGKERM+REEVEGPP+ELF++K                        LYE  DA+KD
Sbjct: 184 YPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDADKD 243

Query: 247 YDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFE 306
            DS+A             A+VYCSD  T+KAIY NCDGTE+ESTANMFDLRYVPD M F+
Sbjct: 244 VDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303

Query: 307 DDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKA 366
           DD RD+C  +PK+Y+P QFST ALQHS VKLTWDETPADRVE++KRAF QKEI++MDFKA
Sbjct: 304 DDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKA 363

Query: 367 YLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLENGD 426
           YLASDSD S+G+ +E+ KN L+SLV D    + K     +  +EE D+EITFTP LE G+
Sbjct: 364 YLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKET--PNDEDEEVDMEITFTPALEGGN 421

Query: 427 APKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVTEAEKEL 486
               E++EET ++                      Q+  +KK+ + K  +   T  E+E+
Sbjct: 422 EKSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKS-KLKSVNKKHTNDEEEI 480

Query: 487 RKK---KQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDN 543
            K    K     L+  +D+T  + T+NN AHFNMNEI++S+KEK KK RYQ K  IV+D 
Sbjct: 481 EKNAKSKAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDT 540

Query: 544 FKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAF 595
           F PDL DPRFKEVFEDHDFAIDP+QPEFK T AM +IL+ER++R    K+  
Sbjct: 541 FTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKL 592

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  526 bits (1354), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 309/620 (49%), Positives = 393/620 (63%), Gaps = 53/620 (8%)

Query: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAKDF 73
           D+RFAG+  DPKFR+ K + LK+ LD+RFSKKDL+   K+KVD+YGR+I   +EK+ KDF
Sbjct: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNEKDKKDF 68

Query: 74  DRYFSKNESVEKI--------------------QSDDEEGETEDIAVSALDRARGEVPXX 113
           D+Y++K+E  E                      ++DD+E    ++A   LDRARG+VP  
Sbjct: 69  DKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELA--RLDRARGDVPSD 126

Query: 114 XXXXXXXXXXXXXXXXXXXXXXXXXXX-XXIEESKPETGDPTKVFAVVNLDWDHVRSVDL 172
                                         IE +KPETGDP+K  AVVNLDWDHV+S DL
Sbjct: 127 YVSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHVKSTDL 186

Query: 173 LATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXX 232
           + TF+ F+P GG I K+AIYPSEFGKERM+REE+EGPP+ELFK+K               
Sbjct: 187 MITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTAEDNEDD 246

Query: 233 XX----XXLYEVDDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFE 288
                   LYE  DA+K+ DSK+             AVVYC+++ TA++IY+NCDGTE+E
Sbjct: 247 VSDVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNCDGTEYE 306

Query: 289 STANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVE 348
           STAN+FD+RYVPD M F+D PRD+C  +PK+YKP QFST ALQHS VKLTWDETPADRVE
Sbjct: 307 STANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVE 366

Query: 349 ISKRAFNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVF----- 403
           ISKRAF+QKEI+EMDFKAYLASDSD SE E N  +KN L+SLV      A  +VF     
Sbjct: 367 ISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGG---AFGNVFGKDTE 423

Query: 404 -DKHGSEEE--ADVEITFTPGLENGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXX 460
            D  GS++E   D+EITFTPGL   D  KE ++ ET  +                     
Sbjct: 424 YDLDGSDDEDGVDMEITFTPGL---DEKKEASDNETKKEESTIEKLQRKEKERRKLRKQK 480

Query: 461 MQAIDEKKARRRK-----------GDDGAVTEAEKELRKKKQAELELLMLEDETGKKSTL 509
           ++ + EK  + RK            ++  + + EKE + K +AELELLM+ DE  + S +
Sbjct: 481 VKDLKEKSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDKSKAELELLMM-DEDDRISGV 539

Query: 510 NNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQP 569
           NN AHFNMNEI++S+KEK KKS+YQ+KN IV D FKP+LND RF E+FEDH FAIDP+QP
Sbjct: 540 NNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQP 599

Query: 570 EFKKTPAMKEILEERTRRSS 589
           EFK+T AMKEIL ERT+R+S
Sbjct: 600 EFKQTSAMKEILNERTKRAS 619

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  524 bits (1349), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 301/588 (51%), Positives = 385/588 (65%), Gaps = 21/588 (3%)

Query: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAK 71
           ++D RFAGI NDPKFR  K   LK+ LDDRFSKKDL+ +RKAKVDKYGRRI + + K+ K
Sbjct: 10  SSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI-TGESKDLK 68

Query: 72  DFDRYFSK--NESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXXXXXXXXXXX 129
           DFD+YF K   E  E   S   E E E+     +DRARGE+P                  
Sbjct: 69  DFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSESEDSESDLSEE 128

Query: 130 XXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKV 189
                        +EE+KPE+GDP+K  AVVNLDWDHVR+ DL+ TF+SF+P+GG I+K+
Sbjct: 129 ESEADVAEA----VEEAKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEKI 184

Query: 190 AIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXXXXLYEVDDAEKDYDS 249
            IYPSEFGKERM+REE EGPPRE+F +K+                  LYE  DA+K+ D+
Sbjct: 185 CIYPSEFGKERMQREEKEGPPREIFNKKKKHHDEDSDSDVDIRD---LYEEGDADKEVDN 241

Query: 250 KAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDP 309
            A             A+VYC++V T ++IY NCDGTE+ESTAN+FDLRYVP+ M+F+D+P
Sbjct: 242 AALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEP 301

Query: 310 RDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLA 369
           +D+C  +PK+YKP +FST ALQHS VKLTWDETP DR+E+SKRAF+QKE+E+MDF+AYLA
Sbjct: 302 KDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLA 361

Query: 370 SDSDSSEG--ETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLENGDA 427
           S +D S+G    NE+ KN L+SLV  S+    +        EEE D+EITFTPGL++   
Sbjct: 362 SGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQ-------QEEEPDMEITFTPGLDDSKP 414

Query: 428 PKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVTEAEKELR 487
             +E+ EET ++                      QA  EKK + R G +    E E + +
Sbjct: 415 QADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNKKQVEDESDAK 474

Query: 488 KKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPD 547
            K  AELELLM+EDE   + +LN  AHFNMNEI+KS+KEK KK +YQ+K  I++D FKPD
Sbjct: 475 SK--AELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKPD 532

Query: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAF 595
           LNDPRF EVFE+ DFAIDPSQPE+K T AMKEILEER++R+ K +K  
Sbjct: 533 LNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPL 580

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  523 bits (1347), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 302/593 (50%), Positives = 383/593 (64%), Gaps = 31/593 (5%)

Query: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSY-DEKEA 70
           ++D RF+GI++DPKF+  K   +KI LDDRF K DL+ K K+KVDKYGR++    D KE 
Sbjct: 10  SSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKDVKDNKEL 69

Query: 71  KDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXXXXXXXXXXXX 130
           +DFD+YF K +  +K +    E +     V  LDRARGEVP                   
Sbjct: 70  EDFDKYFEKEDEEDKEEEIGTEAK-----VKVLDRARGEVPSDYESSSEEFTSSDSESSG 124

Query: 131 XXXXXXXXXXXXIEE-SKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKV 189
                         E SKPE+GD +K  AVVNLDWD+V+S DL+ TF+SF+P GG I+K+
Sbjct: 125 ESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGKIEKI 184

Query: 190 AIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXXX--------XLYEVD 241
            IYPSEFGKERM REEVEGPPRELF +K+                          LYE  
Sbjct: 185 CIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIRELYEEG 244

Query: 242 DAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPD 301
           DAEKD DSKA             AVVYC+++ +A++IY+NCDGTE+ES+AN+FDLRYVPD
Sbjct: 245 DAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFDLRYVPD 304

Query: 302 NMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEE 361
             +F+D+PRD+C+ +PK+YK  QF+T ALQHS VKLTWDETPADRVEI+KRAF QKEIEE
Sbjct: 305 GTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIEE 364

Query: 362 MDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHG---SEEEADVEITF 418
           MDFKAYLASDSD SE E N+  KN L+SLV+ S  +  KS+FD  G    E++ D+EITF
Sbjct: 365 MDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGDNNEEDDVDMEITF 424

Query: 419 TPGL--ENGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQA------IDEKKAR 470
           TPGL     D  ++++ EET ++                      Q+        ++  +
Sbjct: 425 TPGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQSENEKKEKLKELKK 484

Query: 471 RRKGDDGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKK 530
            R G +G  T  +     K +AELELLM++DET   STLN  AHFNMNEI++S+KEK KK
Sbjct: 485 ERNG-NGKNTNVD----AKAKAELELLMMDDETESTSTLNKKAHFNMNEIVRSEKEKGKK 539

Query: 531 SRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEE 583
           S+YQ+KN IV+D+FKPDLNDPRFKE+FEDHDFAIDP+Q EFK+T AMKEIL+E
Sbjct: 540 SKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKE 592

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  521 bits (1341), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 302/588 (51%), Positives = 384/588 (65%), Gaps = 26/588 (4%)

Query: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAK 71
           +ND RF+ I+NDPKF+K    +LKI LDDRF KKDLE  R+AKVDKYGR+I     K+ +
Sbjct: 6   SNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEGSSKDIE 65

Query: 72  DFDRYFSKNESVEKIQSDDEEGETEDIAVS--ALDRARGEVPXXXXXXX---XXXXXXXX 126
           DFD+YF K+E   + +S DE     D+A S   +DRARGEVP                  
Sbjct: 66  DFDKYFEKDEKSAEEESADEG----DVAKSKKIVDRARGEVPSDYVSSEDEFTSSDSDTS 121

Query: 127 XXXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSI 186
                            E++K ETGD TK  A VNLDWDHVRSVD++ TF+SF+P GG I
Sbjct: 122 GDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKI 181

Query: 187 KKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXX--XXLYEVDDAE 244
           +K+ IYPSEFGKERMKREEVEGPPRELF++ +                    LYE  +A+
Sbjct: 182 EKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDLYEEGNAD 241

Query: 245 KDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMK 304
              D +A             AV+YC++V +AKAIY+NCDGTE+ESTAN+ DLRYVPD M 
Sbjct: 242 DQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMD 301

Query: 305 FEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDF 364
           F+D+P+DQC  +PK+YKP QFST ALQHS VKLTWDETP DRVE++KRAF QKEIE+MDF
Sbjct: 302 FDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDF 361

Query: 365 KAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLEN 424
           KAYLASDSD SE E NE+ KN L+SLV +S+++  K   D    +E  D+EITFTPGL+ 
Sbjct: 362 KAYLASDSDESEEEVNEEAKNKLKSLVGESLKIDGK---DGSDEDEGMDMEITFTPGLDE 418

Query: 425 GDAPKE----ENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVT 480
            +A  E    E+ EET ++                      ++ +EKK + +   D  ++
Sbjct: 419 ANAEGEDKDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSKHDEPLS 478

Query: 481 EAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIV 540
           +       KK+AELELLM+ DE    S +N+ AHFNMNEI++S+KEK+KK ++Q K  IV
Sbjct: 479 D-------KKKAELELLMM-DENESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRIV 530

Query: 541 DDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRS 588
           +D+FKP+L+D RFKEVFEDHDFAIDPSQPEFK+T AMKEIL+ER +RS
Sbjct: 531 EDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRKRS 578

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  514 bits (1325), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 303/610 (49%), Positives = 389/610 (63%), Gaps = 28/610 (4%)

Query: 9   DPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI--GSYD 66
           D +++D RF+G++NDPKFR  K  KLK+ LD RFSKKDLE K+KAKVDKYGR+I  G  +
Sbjct: 3   DKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDAN 62

Query: 67  EKEAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXXXXXXXX 126
           +KE +DFD+YF K +  E  +S+D E     + V  +DRARGEVP               
Sbjct: 63  KKELEDFDKYFEKED--EAKESEDAEAPEAPVKV-VVDRARGEVPDDYVSSADEFTSSDS 119

Query: 127 XXXXXXXXXXXXXXXXIEE------SKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFV 180
                           +E+       KPE+GDP+K  AVVNLDWDHV+SVDL+ TF  F+
Sbjct: 120 ESSGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFI 179

Query: 181 PNGGSIKKVAIYPSEFGKERMKREEVEGPPRELF----------KRKQXXXXXXXXXXXX 230
           P GG I+++ IYPSEFGKER+ REE EGPP+ELF           + +            
Sbjct: 180 PKGGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVS 239

Query: 231 XXXXXXLYEVDDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFEST 290
                 LYE  DAEKD DSKA             AVVYC++V TAKAIY NCD TE+EST
Sbjct: 240 DVDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYEST 299

Query: 291 ANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEIS 350
           ANMFDLRYVP+ M F+DDPRD+C ++PK+YKP  F+T ALQHS VKLTWDETPADRVEI+
Sbjct: 300 ANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIA 359

Query: 351 KRAFNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAH--KSVFDKHGS 408
           KRAF+QKEI++MDFKAYLASDS+ S+ + +E  KN L++LV  +++ +       +    
Sbjct: 360 KRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDD 419

Query: 409 EEEADVEITFTPGLE--NGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDE 466
           EE  D+EITFTPGL+       +   EEE+ +D                       A  E
Sbjct: 420 EEGMDMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNAEKE 479

Query: 467 KKARRRKGDDGAVTEAEKELRKKKQAELELLML--EDETGKKSTLNNNAHFNMNEIIKSQ 524
           K+ + +    G     E+ +  K +AELELLM+  ++E   KSTLN   HFNMNEI++S+
Sbjct: 480 KRDKLKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSE 539

Query: 525 KEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEER 584
           KEK KKS++Q+KN IV+D FKPDL+D RFKEVFEDHDFAIDPS+PEFK+TPAM++IL+ER
Sbjct: 540 KEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQER 599

Query: 585 TRRS-SKMKK 593
           + R+ SK KK
Sbjct: 600 SNRARSKGKK 609

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  500 bits (1288), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 308/620 (49%), Positives = 389/620 (62%), Gaps = 27/620 (4%)

Query: 10  PVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKE 69
           PV  D RF+G+ NDPKF+  +   LKI LD RFSK DLE  RKA+VDKYGR+I + + +E
Sbjct: 6   PVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLNNQE 65

Query: 70  AKDFDRYFSKNESVEKIQSDDEEGETEDIAVSAL-DRARGEVPXXXXXXXX-XXXXXXXX 127
           AKDFD+YF K E           G+ E+IAV  L DRARGEVP                 
Sbjct: 66  AKDFDKYFEKEED----------GKGEEIAVKPLIDRARGEVPSDYQSSLDDYTSSESED 115

Query: 128 XXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIK 187
                          IEE+KPE+GD +K  AVVNLDWDHV++ DLL TF+SFVP GG I+
Sbjct: 116 SEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIE 175

Query: 188 KVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXX---XXXXXXXXLYEVDDAE 244
           ++AI+PSEFGK+RM+REE+EGPP+ELF++K+                     LYE  D +
Sbjct: 176 RIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDINDLYEEGDVD 235

Query: 245 KDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMK 304
           K+ DSK+             AVV+C+++ TA+AIY NCDGTE+ESTAN+FDLRYVPD M 
Sbjct: 236 KEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMD 295

Query: 305 FEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDF 364
           FED P D+C  +PK+Y P  F+T ALQHS VKLTWDETPADRVEI+KRAF QKEI+EMDF
Sbjct: 296 FEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDF 355

Query: 365 KAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEE--EADVEITFTPGL 422
           KAYLAS         NE+ KN L+SLV  S+++  KS+ D     E  E D+EITFTPGL
Sbjct: 356 KAYLAS-DSEESEGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITFTPGL 414

Query: 423 ENGDAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKG--DDGAVT 480
              D   +E E E                          Q  +++K  + K    + +  
Sbjct: 415 AENDNNDKEEENEETTIEKVRRKEKERRKARKQKLKEIKQNSEQEKREKLKSLKTERSKK 474

Query: 481 EAEKELRKKKQAELELLML-EDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVI 539
             + E  K  +AELELLM+ EDE    ST+N  AHFNM EI++S+KEKTKKS++QNK  I
Sbjct: 475 SEDTESDKNAKAELELLMMDEDEINGTSTINKKAHFNMKEILRSEKEKTKKSKFQNKEKI 534

Query: 540 VDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKA--FNK 597
           V+DNFK DLNDPRF E+FEDHDFAIDP+Q E+K+T AMKEIL+ER++RS+ MKKA    K
Sbjct: 535 VEDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEILKERSKRST-MKKANRSEK 593

Query: 598 RKASYDHPQSGQTDSLNSLV 617
           RK S   P  G    ++++V
Sbjct: 594 RKIS---PSDGSQKDISNIV 610

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  497 bits (1279), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 298/622 (47%), Positives = 400/622 (64%), Gaps = 24/622 (3%)

Query: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60
           MS+KR K      D RF+ I++DPKF   K    K+ LDDRFSKKDLE KRK KVDKYGR
Sbjct: 1   MSEKRSK------DPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGR 54

Query: 61  RIGSY-DEKEAKDFDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXX 119
           R+    D KE+KDFD+YF         QSD+E+ + +D  +  +DRARGEVP        
Sbjct: 55  RMRDVEDSKESKDFDKYFE--------QSDEEKKKDKDTEILTVDRARGEVPSDYVSSSD 106

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSF 179
                                  +E+++P +GD +K  AVVNLDWD+VRS DL+ TF+SF
Sbjct: 107 EFTSSDSEVSDNEVESESESEVELEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSF 166

Query: 180 VPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXX-XXXXLY 238
           +P GG I+K+AIYPSEFGKERM+REEVEGPP+ELF++K+                   LY
Sbjct: 167 LPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKDLY 226

Query: 239 EVDDAEKDYDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRY 298
           E  DA+K+ D+KA             AVVYC++V  A++IY NCDGTE+ESTAN+FD+RY
Sbjct: 227 EEGDADKNVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRY 286

Query: 299 VPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKE 358
           VPD M F+  P+D C  +PK+YKP QFST ALQHS VKLTWDETPADR++++KRAF QKE
Sbjct: 287 VPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKE 346

Query: 359 IEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDS--IQVAHKSVFDKHGSEEEADVEI 416
           IE+MDFKAYLASDSD SE E + ++K+ L+SLV  S       K+  +  G++EE D+EI
Sbjct: 347 IEDMDFKAYLASDSDDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEI 406

Query: 417 TFTPGLENGDAPKEEN-EEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGD 475
           TFTPGL+  +   +E  EEE+ +D                      QA  +KK + +KG 
Sbjct: 407 TFTPGLDEANKDGQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGR 466

Query: 476 DGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQN 535
               ++ E++ + K  AELELLM++DE   + ++N  AHFNM EI+KS+KEK KK++YQ+
Sbjct: 467 GKQTSDIEQDPKSK--AELELLMMDDEDDTEKSINKKAHFNMKEILKSEKEKKKKNKYQD 524

Query: 536 KNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAF 595
           KN IV D+FKPDL DPRFKE+FE HDFAIDP+Q EF+ T AMKE+L +R++++ ++    
Sbjct: 525 KNKIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVN--- 581

Query: 596 NKRKASYDHPQSGQTDSLNSLV 617
           +KRK +     + +   + ++V
Sbjct: 582 SKRKIATQENDTNENGDIANIV 603

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  487 bits (1254), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 288/584 (49%), Positives = 367/584 (62%), Gaps = 20/584 (3%)

Query: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI-GSYDEKEAKD 72
           D+RFAGI +DPKF+  +    KI LD RFSKKDLE + K+KVDKYGR+I  + + KE +D
Sbjct: 12  DARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKELED 71

Query: 73  FDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPXXXXXXXXX-XXXXXXXXXXX 131
           FD+YF      EK    DE+ E    A   +DRARGEVP                     
Sbjct: 72  FDKYF------EKEAEHDEDSEV--AAKIVVDRARGEVPSDYVSSSDEFTSSDSESSGES 123

Query: 132 XXXXXXXXXXXIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAI 191
                       E+   E+GD +K  AVVNLDWDHV+S DL+ TF+SFVP GG I+++AI
Sbjct: 124 EVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAI 183

Query: 192 YPSEFGKERMKREEVEGPPRELFKRKQXXXXXXXXXXXXXXXX-----XXLYEVDDAEKD 246
           +PSEFG+ERM+REEVEGPP+ELF++K                        LYE  DA+KD
Sbjct: 184 FPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLYEEGDADKD 243

Query: 247 YDSKAXXXXXXXXXXXXXAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFE 306
            DS+A             AVV CSD  +AKAIY NCDGTE+ESTANMFDLRYVPD M F+
Sbjct: 244 VDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303

Query: 307 DDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKA 366
           D  RD+C S+PK+Y+P QFST ALQHS VKLTWDETPADR+E++KRAF QKEI++MDFKA
Sbjct: 304 DAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKA 363

Query: 367 YLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEE-EADVEITFTPGLENG 425
           YLASDSD S+ + +E  KN L+SLV   +    K      G EE E D+EITFTP LE  
Sbjct: 364 YLASDSDESDEQVDEDAKNKLKSLVG-GLDFNMKKKGANDGKEEGEVDMEITFTPALEGE 422

Query: 426 DAPKEENEEETALDXXXXXXXXXXXXXXXXXXXXXMQAIDEKKARRRKGDDGAVTEAEKE 485
           +    E ++ET ++                      Q+  +KK++ +  +   V + E+E
Sbjct: 423 NEKPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHVAD-EEE 481

Query: 486 LRK--KKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDN 543
           ++   K +AELELLM ED+   + ++N+ AHF+M EI++S+KEK K+ RYQ K  IV+D 
Sbjct: 482 IKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDT 541

Query: 544 FKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRR 587
           F PDL DPRFKEVFEDHDFAIDP+QPE+K T AM  IL+ER +R
Sbjct: 542 FAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKR 585

>CAGL0L11572g Chr12 (1236335..1238776) [2442 bp, 813 aa] {ON}
           similar to uniprot|P38814 Saccharomyces cerevisiae
           YHR103w SBE22 or uniprot|P42223 Saccharomyces cerevisiae
           YDR351w SBE2
          Length = 813

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 2/41 (4%)

Query: 178 SFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQ 218
           + +PN G+  K+A+ PS+  + R+++E+ E   R++ KRK+
Sbjct: 252 AIIPNAGTGSKLALTPSQ--RYRLRKEQSEHALRDVIKRKE 290

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILE 582
           L D RFKE+FED +F +D    +FK+   +K I E
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSIKE 511

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILE 582
           L D RFKE+FED +F +D    +FK+   +K I E
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSIKE 511

>Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILE 582
           L D RFKE+FED  F +D    +FK+   +K I E
Sbjct: 477 LTDDRFKEMFEDEQFQVDEDDYDFKQLNPVKSIRE 511

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILE 582
           L D RFKE+FE+ +F +D +  +FK+   +K + E
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKSLRE 511

>ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {ON}
           similar to uniprot|P40561 Saccharomyces cerevisiae
           YIR001C SGN1 Cytoplasmic RNA-binding protein contains an
           RNA recognition motif (RRM) may have a role in mRNA
           translation as suggested by genetic interactions with
           genes encoding proteins involved in translational
           initiation
          Length = 289

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%)

Query: 310 RDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFN 355
            D+   VPK Y   QF +S +Q + +KL   E   +++ + K+  N
Sbjct: 115 HDKHTGVPKGYAYVQFESSEVQENALKLNGTELKGNKINVYKKRTN 160

>NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {ON}
           Anc_4.77 YGR145W
          Length = 707

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMK 578
           L D RFKE+FED DF +D    ++K+   +K
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQLNPVK 507

>KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {ON}
           Anc_8.140 YGL179C
          Length = 870

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 511 NNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDH 560
           N AH++M+ +     +KTK S   + NVI+D   K  LN P  +E+   H
Sbjct: 89  NTAHYDMHLL-----DKTKSSSADSLNVILDRQRKTQLNHPLHQELIIGH 133

>TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {ON}
           Anc_4.77 YGR145W
          Length = 694

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMK 578
           L D RFKE+FED DF +D    ++K+   +K
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQLNPVK 507

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.128    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,228,263
Number of extensions: 2885718
Number of successful extensions: 14748
Number of sequences better than 10.0: 247
Number of HSP's gapped: 15112
Number of HSP's successfully gapped: 276
Length of query: 630
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 514
Effective length of database: 40,180,143
Effective search space: 20652593502
Effective search space used: 20652593502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)