Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47645.431ON56656630270.0
SAKL0G02464g5.431ON56357114040.0
KLTH0F16126g5.431ON55455213181e-176
Kwal_55.214375.431ON55454912841e-171
NCAS0H020505.431ON57358112361e-164
KLLA0E21143g5.431ON57257712301e-163
YOR118W (RTC5)5.431ON56755612081e-160
AER258C5.431ON55756612051e-159
Smik_15.2965.431ON56655411941e-158
Suva_8.1715.431ON56757211871e-157
NDAI0C016105.431ON58459311361e-149
Skud_15.2815.431ON56756011311e-148
Kpol_1016.75.431ON56257311001e-144
TDEL0E019405.431ON56758110881e-142
KNAG0B042305.431ON57758110571e-137
TPHA0H017905.431ON56557210471e-135
ZYRO0F09966g5.431ON55457410441e-135
CAGL0L11616g5.431ON5555749431e-120
TBLA0A065305.431ON4925266511e-77
ABR126Wna 1ON151247790.61
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4764
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...  1170   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   545   0.0  
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   512   e-176
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   499   e-171
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   480   e-164
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   478   e-163
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   469   e-160
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   468   e-159
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   464   e-158
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   461   e-157
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   442   e-149
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   440   e-148
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   428   e-144
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   423   e-142
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   411   e-137
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   407   e-135
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   406   e-135
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   367   e-120
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   255   1e-77
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    35   0.61 

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score = 1170 bits (3027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/566 (100%), Positives = 566/566 (100%)

Query: 1   MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS 60
           MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS
Sbjct: 1   MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS 60

Query: 61  CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL 120
           CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL
Sbjct: 61  CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL 120

Query: 121 LKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSA 180
           LKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSA
Sbjct: 121 LKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSA 180

Query: 181 DDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNV 240
           DDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNV
Sbjct: 181 DDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNV 240

Query: 241 VTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLC 300
           VTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLC
Sbjct: 241 VTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLC 300

Query: 301 TLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLAKNQR 360
           TLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLAKNQR
Sbjct: 301 TLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLAKNQR 360

Query: 361 YKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQ 420
           YKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQ
Sbjct: 361 YKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQ 420

Query: 421 EVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHG 480
           EVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHG
Sbjct: 421 EVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHG 480

Query: 481 GSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYIN 540
           GSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYIN
Sbjct: 481 GSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYIN 540

Query: 541 LSSIGEDKALLEMVGLVGHHQSGGSL 566
           LSSIGEDKALLEMVGLVGHHQSGGSL
Sbjct: 541 LSSIGEDKALLEMVGLVGHHQSGGSL 566

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/571 (47%), Positives = 392/571 (68%), Gaps = 13/571 (2%)

Query: 1   MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS 60
           MGQ ASS +  +    L F  + ++L +F  +A +Q    ELVAF++N+    D  D +S
Sbjct: 1   MGQTASSGTG-TTGNVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLK-GKDQNDKVS 58

Query: 61  CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL 120
            E ++QL K+P        + +  I   S FPL+      D  T  GL+K+C+L  + + 
Sbjct: 59  VEEMLQLLKIPLGNELLADLLHNCIKTLSNFPLIR--ESYDDITVAGLLKSCILLSHDRC 116

Query: 121 LKYAQCKTYDQVSLIFILLALEPHAKVSKKELGR---PPSSYDARKIMESFNDINLETIE 177
           +KY   K YDQ+ LI+I LAL    + + KEL     P   +DA+ I+ ++N ++++ + 
Sbjct: 117 IKYVGFKNYDQLKLIYIALAL----RKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLY 172

Query: 178 VSADDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAA 237
           V AD +LQ +T  LV++++C   N ++  S++++W DY++ A+N+LRTMNP IV+  D  
Sbjct: 173 VPADSMLQLLTLSLVLSRHCTVNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTV 232

Query: 238 KNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLA 297
           + V++  QF + I AV P +L PL + ++H+LY    L  +  +T    +S ++T+PLLA
Sbjct: 233 QCVISFEQFSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLA 292

Query: 298 QLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKL-LA 356
           QL T+ PK ++Y  L+KL++ ++SGFS+RSFQ+K   WMAPSILL+ GM+I DD +    
Sbjct: 293 QLSTMLPKELVYSKLRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATT 352

Query: 357 KNQRYKSFLQEYPKLKDEDQKA-DSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQ 415
           KN RYK FL+EYP+LKD+DQ   D     +RK+ FAV+V+E WKVTNKE FG+LKT ++Q
Sbjct: 353 KNPRYKKFLEEYPRLKDKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQ 412

Query: 416 LSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFR 475
           LSP+QE+F+A + GN+YFNT+GGGIG+G +QPVIK +GKKYFPGNVSLTID S EF  FR
Sbjct: 413 LSPKQELFKAVRTGNVYFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFR 472

Query: 476 NVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESER 535
           +VG+GG+ISPG L  +  + + + E +FI+QDVEVWGCGG+KE + Q+KQWEWEEAE++R
Sbjct: 473 HVGYGGAISPGTLMTKLEEEKTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKR 532

Query: 536 RQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
           RQ INL SIGED+ALLEM GLVG HQSGGS+
Sbjct: 533 RQRINLQSIGEDRALLEMAGLVGQHQSGGSM 563

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  512 bits (1318), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 256/552 (46%), Positives = 371/552 (67%), Gaps = 19/552 (3%)

Query: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIG---LDADLKDYLSCEFLVQLCKLPRHKY 75
           F  E ++L ++D +A++ +   ELV+++ NI    LDA     L+ + L+++ +L     
Sbjct: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDA----ALNRKELMRVLRLQNANE 73

Query: 76  GFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLI 135
               + +  +   + FPL+     E+V T++G++K+C+L +  + L+Y Q K Y+   L+
Sbjct: 74  AVEGLLFNCVQTLANFPLIKD-CYENV-TYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLV 131

Query: 136 FILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSADDLLQFMTFLLVITK 195
           +I LAL    K     L     S DA K++ +FN++  E + V A+ +L+F+T +L ++K
Sbjct: 132 YISLALNKAVK-EMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSK 190

Query: 196 YCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCP 255
             + +N  ++ +I E W  +++ AL+ILRTMN  I++  DA KNV++  QF++ I++VCP
Sbjct: 191 ATVIKNSRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCP 250

Query: 256 NLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKL 315
           NLL PL   M+HVL+ +  LV    +      S ++T+PLLAQL T+WP+ +++  L+KL
Sbjct: 251 NLLVPLECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKL 310

Query: 316 FIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA-KNQRYKSFLQEYPKLKDE 374
           ++ + SGFS+RSFQAK   WMAPSILLV G +I DD      KNQRYK FL EYP+LKDE
Sbjct: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDE 370

Query: 375 DQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIYFN 434
           DQ     + GKRK+ FA+ ++E WKVTN E FG++KT I+QLSP QEV++ASK GN+YFN
Sbjct: 371 DQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFN 430

Query: 435 TVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLERPD 494
           T+GGGIGIG+ QP+IKSSG K+ PGNVSLTIDP+ EF  FRNVG GGSI+P         
Sbjct: 431 TLGGGIGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSN------- 483

Query: 495 VEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMV 554
              + E +F+IQD+E WGCGG+KE E Q+K WEWEEAE++RRQ INL S+ +D+ALLE+ 
Sbjct: 484 -TPTSEHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELA 542

Query: 555 GLVGHHQSGGSL 566
           GLVG +QSGGS+
Sbjct: 543 GLVGQNQSGGSV 554

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  499 bits (1284), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/549 (44%), Positives = 364/549 (66%), Gaps = 13/549 (2%)

Query: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFV 78
           F  EK+++ +FD +A++ L   ELV+F+ NI    DL D ++ + L+++ +L        
Sbjct: 18  FNSEKDVIIWFDKKAIKSLTSPELVSFKANIN-GKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 79  KVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFIL 138
            + +  +   S FP +     E++ T+ GL+K+C+L +  + L Y + K YD   L++I 
Sbjct: 77  SLIFNCVQTLSNFPFIRD-CYENI-TYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYIS 134

Query: 139 LALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSADDLLQFMTFLLVITKYCI 198
           LAL    K           S DA +I+ +FN + +E + V ++ +L+F+T +L ++K  I
Sbjct: 135 LALNKTVK-EVSSSSNSQESLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193

Query: 199 FENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCPNLL 258
            +N +++P++ E W+ +   AL+ILRTMN  I + +D  K  +T +QF+  I+ VCPNLL
Sbjct: 194 IKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLL 253

Query: 259 TPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIA 318
            P    M+HVL+    LV    +      S ++++PLLAQL T+WP+ +++  L+KL++ 
Sbjct: 254 LPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVG 313

Query: 319 KQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLL-AKNQRYKSFLQEYPKLKDEDQK 377
           + SGFS+RSFQAK   WMAPSILL+ G++I +D +   +KN RYK+FL+EYP+LK+EDQ 
Sbjct: 314 RDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQV 373

Query: 378 ADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIYFNTVG 437
                 GK+K+ FAV+V+  WKVTN E FG+LKT I+QLSP QEV++AS+ GNIYFNT+G
Sbjct: 374 LLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLG 433

Query: 438 GGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLERPDVEQ 497
           GGIG+G+ QP++K + +KY PGNVSLTIDP+ EF VFR+ G GGSI P    +       
Sbjct: 434 GGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN------ 487

Query: 498 SLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMVGLV 557
             E +F+IQD+E WGCGG+KE E Q+K WEWEEAE++RRQ INL SI +D+ALLEM GLV
Sbjct: 488 --EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGLV 545

Query: 558 GHHQSGGSL 566
           G +QSGGS+
Sbjct: 546 GQNQSGGSI 554

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  480 bits (1236), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 255/581 (43%), Positives = 363/581 (62%), Gaps = 23/581 (3%)

Query: 1   MGQNASSRSAESV----EGR----LIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIG-- 50
           MGQ  SS   E      EG+    + F  E+E+ E F  + +     LELVAF+  IG  
Sbjct: 1   MGQTPSSNQNEPSHLKEEGKQYKGITFNSEEELRESFKRRILCHFTPLELVAFKKKIGHE 60

Query: 51  -LDADLK-DYLSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGL 108
             D++   +Y+S   L  L  LPR     V + Y++I   S FPL+     E   T +GL
Sbjct: 61  QTDSEAGVEYISKNELTNLLHLPRENVLLVDLTYKLIAILSNFPLLREPQTE--VTEIGL 118

Query: 109 VKACLLFDYKKLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESF 168
           +   +L   ++  ++    TYDQ+ LIFI ++L+   K+      R P   +  +++ +F
Sbjct: 119 LMCIILLSKERCHRFIGSNTYDQLGLIFIAMSLDYADKLLP--YARTPKKLNVEELLRTF 176

Query: 169 NDINLETIEVSADDLLQFMTFLLVITKYCIFENVEVNP--SIYENWKDYESQALNILRTM 226
           ++I ++ +E+ A  LLQF+++ L++   C   N ++ P    Y+NW  YE  A NI+R+M
Sbjct: 177 DNIPIDELEIPAPVLLQFLSWGLLLLIKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSM 236

Query: 227 NPCIVSYSDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDR 286
           +  I+      +  +   QF D   AV PN  TPL   M H+LY    L+      +N+ 
Sbjct: 237 DQSIIRNLTDVR--INYTQFSDVFKAVLPNFTTPLESLMGHLLYMDSDLIDHETMPMNN- 293

Query: 287 SSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGM 346
            S +M++PLLAQL T+ PK +    L+KL++ ++SGFS+RS Q+K  NW APSILLVSGM
Sbjct: 294 -SKLMSEPLLAQLATVLPKELFLSKLQKLYVGRESGFSMRSLQSKCFNWEAPSILLVSGM 352

Query: 347 KIMDDSKLLA-KNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQ 405
            I DD +    KN RY  FL++YPKLK+E Q  D+    ++K TFAV++ + W+VTNKE 
Sbjct: 353 LISDDLQYAKEKNPRYGKFLEQYPKLKEEQQHLDACHSQRKKATFAVYIDDPWRVTNKEF 412

Query: 406 FGNLKTLILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTI 465
           FG++ ++I+QL+PRQ+VF ASK   IYFNTVGGGIG GN QP+I ++ KKY PGNVSLTI
Sbjct: 413 FGSMNSMIIQLAPRQDVFHASKPNMIYFNTVGGGIGFGNKQPLISNAHKKYIPGNVSLTI 472

Query: 466 DPSFEFGVFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQ 525
           D + EF VFR++G+GG+  P  L  +R   ++S E +FIIQDVEVWGCGG+KE + Q+K+
Sbjct: 473 DSTLEFAVFRHIGYGGAFKPSALLTKRGKEDESFEIKFIIQDVEVWGCGGEKELQEQIKK 532

Query: 526 WEWEEAESERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
            EWEEAE++RRQ+INL S+GED+ALLEM GLVG  QSGGS+
Sbjct: 533 LEWEEAEAKRRQHINLKSLGEDRALLEMAGLVGQSQSGGSM 573

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  478 bits (1230), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 261/577 (45%), Positives = 377/577 (65%), Gaps = 16/577 (2%)

Query: 1   MGQNASSR--SAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDY 58
           MGQ+ S    +A + E +L     + +++FF+++ ++QL   EL++F+NNI    +L DY
Sbjct: 1   MGQSTSKEHENARTNESKL---KGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDY 57

Query: 59  LSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYK 118
           +    + ++  +P+     + VF  M    + FPL+   + E V TF  L+KA LL   +
Sbjct: 58  VEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQD-SYEKV-TFKTLLKATLLLVKE 115

Query: 119 KLLKYAQCKTYDQVSLIFILLALEPHAKVSK-KELGRPPSSYDARKIMESFNDINLETIE 177
           + +KY   K Y+ + ++FI L+LE + K     +        D + ++ S+N  + + ++
Sbjct: 116 RAIKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELK 175

Query: 178 VSADDLLQFMTFLLVITKYCIFENVEV-NPSIYENWKDYESQALNILRTMNPCIVSYSDA 236
           V+A++LL F+  +L +++ CI  N ++ N  + ++ +D++ QALNI+RTMNP I+S SD 
Sbjct: 176 VNANNLLHFLALILALSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDC 235

Query: 237 AKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLL 296
             + +T  QF   +  V PNLL PL + M+HVLY    LV           + ++ +  L
Sbjct: 236 LDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESEL 295

Query: 297 AQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSK--- 353
           +QL T  PK I++   +KL++ ++SGFS+RSFQ+KV  WMAP+IL V GM+I D+     
Sbjct: 296 SQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDG 355

Query: 354 --LLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKT 411
                KN RY++FLQEY KLK EDQ  D++   KRK+ FAV + + WKV+NK+ FG+  T
Sbjct: 356 DAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSST 415

Query: 412 LILQLSPRQEVFQAS--KNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSF 469
            I+QL PRQE+F A   K GN+YFNTVGGGIGIG+SQP+IK++GKKYFPGNVSLTID S 
Sbjct: 416 KIIQLHPRQEIFDADPFKTGNVYFNTVGGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSL 475

Query: 470 EFGVFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWE 529
           EFG+FR++G GGS  PG+L   R +   S E RFIIQDVEVWGCGG+KE E Q+KQW+WE
Sbjct: 476 EFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWE 535

Query: 530 EAESERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
           EAE++RRQ INL S+GED+ALLEM GLVG HQSGGS+
Sbjct: 536 EAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  469 bits (1208), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 258/556 (46%), Positives = 360/556 (64%), Gaps = 17/556 (3%)

Query: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFV 78
           F + K+IL +F+N+A +Q+   ELV+F+ N+ ++ DL   +S + L      P++    V
Sbjct: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIE-DLNTPISHKALCNSLYFPQNHAMIV 79

Query: 79  KVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFIL 138
            +   M+   S FPLM   +  +  T  GL+K  LL +  +  K+ + K+YDQ+ L+FI 
Sbjct: 80  GIVTNMLRVLSNFPLMK--SSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFIS 137

Query: 139 LALEPHAKVSKKELGRPPSSYDARK------IMESFNDINLETIEVSADDLLQFMTFLLV 192
           L+L+   K  K+EL    S  D  K      I+  F+D++ E + + AD +LQF+T+LL+
Sbjct: 138 LSLQ---KTDKEELSEE-SENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLI 193

Query: 193 ITKYCIFENVEV-NPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCIT 251
           +T  C   N ++ N   ++ W +++  ALN+LRTMNP +V   D   + +T  QF   I 
Sbjct: 194 LTVDCPTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIR 251

Query: 252 AVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQN 311
            V PNLL PL   M+H  Y    LV       + + S VMT  LLAQL T  PK +    
Sbjct: 252 TVMPNLLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHK 311

Query: 312 LKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA-KNQRYKSFLQEYPK 370
           L+ L+I ++SGFS+RS QAKV  WMAPSIL+VSGM+I +  +  A KN RY+ FL+E+PK
Sbjct: 312 LQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPK 371

Query: 371 LKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGN 430
           LK+ DQ  D+    KRK TFAV++ + WKVTNK+ FG+L T I+++SPRQ++++ ++ G 
Sbjct: 372 LKESDQMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGT 431

Query: 431 IYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFL 490
           IYFNT+GGGIGIG+ QP+IK + K+Y PGNVSLT D + EF VFRN G+GGS+ PG L +
Sbjct: 432 IYFNTIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSM 491

Query: 491 ERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKAL 550
           ER +     E  F+IQDVEVWGCGG+KE E Q+KQ EWEEAES+RRQ INL S+GED+AL
Sbjct: 492 ERKEENSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRAL 551

Query: 551 LEMVGLVGHHQSGGSL 566
           LEM GLVG HQ GGS+
Sbjct: 552 LEMAGLVGQHQGGGSM 567

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  468 bits (1205), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 232/566 (40%), Positives = 352/566 (62%), Gaps = 9/566 (1%)

Query: 1   MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS 60
           MGQ ASS   E+   R  F D   ++ FF+ +A+RQL  +E  AF  NIG + +  + L 
Sbjct: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60

Query: 61  CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL 120
            + L  L  +P     F +VFY  +   + FPLM   +    PT++GL+K CLLF+ K+ 
Sbjct: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSP---PTYMGLLKVCLLFNKKRA 117

Query: 121 LKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSA 180
            +Y   K+YD  SL+  LLA  P      + + +    +D  K++++ +   +  +EV  
Sbjct: 118 ARYTARKSYDVASLVLALLA--PPRDACDENVDQ----FDGDKLIDTLDGTFIAELEVRP 171

Query: 181 DDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNV 240
           + L+++  F+  I++ C   N  ++ S++  W       L +LR+++  IVS SDA    
Sbjct: 172 NKLVRYSPFIAQISQVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRS 231

Query: 241 VTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLC 300
           +T  QF   + +V PN+   LG+F++ + Y      +    T    +ST++T+ LL QL 
Sbjct: 232 ITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLS 291

Query: 301 TLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLAKNQR 360
           TL+P+  ++ ++++LF+A  +GFS+  FQAKV  WMAP+IL VSG +I DD  +  KN+R
Sbjct: 292 TLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKNKR 351

Query: 361 YKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQ 420
           YK+FLQ+YP LKD +Q+       KR + +A+FV + WK+TNK+ FG++ T I+QL+PRQ
Sbjct: 352 YKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQ 411

Query: 421 EVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHG 480
           ++F+A +  NIYFN VGGGIG G+SQP +K +GK+YFPGNVS T+DPS EF VFRNVG G
Sbjct: 412 KIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDG 471

Query: 481 GSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYIN 540
           G  S G       +   S E R +I+D+EVWG GG++E + Q+++W+WEEAE+ +R+YI 
Sbjct: 472 GMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIK 531

Query: 541 LSSIGEDKALLEMVGLVGHHQSGGSL 566
            +   ED+ALLEM G+VGH+QSGGS+
Sbjct: 532 TNGGNEDRALLEMAGIVGHYQSGGSV 557

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  464 bits (1194), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 248/554 (44%), Positives = 360/554 (64%), Gaps = 14/554 (2%)

Query: 19  FRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFV 78
           F +++++L +F+ +A RQ+   ELV+ + N+ ++ +L   +S + L      P++    V
Sbjct: 21  FANDRDVLTYFNTKAQRQITVPELVSLKGNLQIE-NLNTPISHKRLCNFLYFPQNHTIIV 79

Query: 79  KVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFIL 138
            +   M+   S FPL+   +  +  T  GL+K  +L +  +  K+ + K+YDQ+ L+FI 
Sbjct: 80  GIVTNMLRVLSNFPLVN--SSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFIS 137

Query: 139 LALEPHAKVSKKELGRPPSS-----YDARKIMESFNDINLETIEVSADDLLQFMTFLLVI 193
           L+L+   K  K+EL     +      + ++I+  F+D++ E + + AD +LQF+T+LL++
Sbjct: 138 LSLQ---KTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLIL 194

Query: 194 TKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAV 253
           +  C   N  +N      W  ++  A+N+LRTMNP +V+  +   + +T  QF   I  V
Sbjct: 195 SVECPTTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVN--NIESHFITYQQFSTAIRTV 252

Query: 254 CPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLK 313
            PNLL PL   M+H LY    LV       + + S +MT  LLAQL T  PK +  Q L+
Sbjct: 253 MPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQ 312

Query: 314 KLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA-KNQRYKSFLQEYPKLK 372
            L+I ++SGFS+RS QAKV  WMAPSIL+VSG++I +  +  A KN RY+ FL+E+P LK
Sbjct: 313 SLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILK 372

Query: 373 DEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIY 432
           D DQK D+ +  K+K TFAV++ + WKVTNK+ FG+L T I+Q+SPRQ++++ +K G +Y
Sbjct: 373 DSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVY 432

Query: 433 FNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLER 492
           FNT+GGGIGIGN QP+IKS+ K+Y PGNVSLT D + EF VFRN G+GGS+ PG L +ER
Sbjct: 433 FNTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMER 492

Query: 493 PDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLE 552
            +   S E   +IQDVEVWGCGG+KE E Q+KQ  WEEAES+RRQ INL S+GED+ALLE
Sbjct: 493 KEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLE 552

Query: 553 MVGLVGHHQSGGSL 566
           M GLVG HQ GGS+
Sbjct: 553 MAGLVGQHQGGGSM 566

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  461 bits (1187), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 248/572 (43%), Positives = 372/572 (65%), Gaps = 11/572 (1%)

Query: 1   MGQNASSRSA--ESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDY 58
           MGQ++S+ S+  E       F +  ++L +F+++A +Q+   ELV+ + N+ ++ D+   
Sbjct: 1   MGQSSSTPSSNEEKSSNLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIE-DMNTP 59

Query: 59  LSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYK 118
           +S + L  +   P+       +   M+   S FPLM   +  +  T  GL+K  LL +  
Sbjct: 60  ISHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMN--SSYEPITGYGLLKCILLLNKG 117

Query: 119 KLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRP--PSSYDARKIMESFNDINLETI 176
           +  KY + K+YDQ+ L+FI L+L+   K    E          + ++I+ +F+D++ E +
Sbjct: 118 RCGKYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVL 177

Query: 177 EVSADDLLQFMTFLLVITKYCIFENVEV-NPSIYENWKDYESQALNILRTMNPCIVSYSD 235
            V AD +LQF+++LL+++  C   N ++ N  IY+ W  ++  A+N+LRTMNP +VS ++
Sbjct: 178 YVPADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTE 237

Query: 236 AAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPL 295
           +  +++T  QF   I  V PNLL PL   M+H  Y    LV+   +  + R S +MT  L
Sbjct: 238 S--HLITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPAL 295

Query: 296 LAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLL 355
           L QL T+ P+ +  Q L+ L+I ++SGFS+RS QAKV  WMAPSIL+VSG +I +  +  
Sbjct: 296 LTQLSTVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYA 355

Query: 356 A-KNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLIL 414
           A KN RY+ FL+E+PKLKD DQK D+    K+K TFAV++ + WKVTNK+ FG++ T I+
Sbjct: 356 AQKNPRYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRII 415

Query: 415 QLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVF 474
           Q+SPRQ++++ ++ G IYFNT+GGGIGIG+ QP+IK + K++ PGNVSLT D + EF VF
Sbjct: 416 QISPRQDIYKVNRKGTIYFNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVF 475

Query: 475 RNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESE 534
           R+ G+GGS+ PG L +ER + +   E  F+IQDVEVWGCGG+KE E Q+KQ  WEEAES+
Sbjct: 476 RHTGYGGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESK 535

Query: 535 RRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
           RRQ INL S+GED+ALLEM GLVG ++ GGS+
Sbjct: 536 RRQQINLRSLGEDRALLEMAGLVGQNRGGGSM 567

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  442 bits (1136), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 239/593 (40%), Positives = 360/593 (60%), Gaps = 36/593 (6%)

Query: 1   MGQNASSRSAESV----EGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLK 56
           MGQ+ SS    +     E  + F +  E+ ++F  + +     LEL++++N +  D  L 
Sbjct: 1   MGQHISSAEKPNTKTHNEKEIQFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHD-HLD 59

Query: 57  DYLSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFD 116
           D ++ E ++QL  LP        + + M+ +   FP +G    +   T   L+   +L D
Sbjct: 60  DMITKEEIIQLLHLPDDNVILSNMIFNMVHSLCNFPFLGERIWD--ITAGNLLTCIILLD 117

Query: 117 YKKLLKYAQCKTYDQVSLIFILLAL------------------EPHAKVSKKELGRPPSS 158
             +  ++   K+YDQ+ L+FILL L                  E    +S   +      
Sbjct: 118 NDRCQRFIGSKSYDQIKLLFILLCLSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIG 177

Query: 159 YDARKIMESFNDINLETIEVSADDLLQFMTFLLVITKYCIFENVEV--NPSIYENWKDYE 216
           Y+   I++S+N I+++ + V A  L +  T+ L+++  C   N ++  N +IY +W +Y+
Sbjct: 178 YNLTDILQSYNGISIDDLSVPALSLSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQ 237

Query: 217 SQALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLV 276
             +LNILR+M+  IVS  D  +  ++  QF++  T+V PN   PL   M H+LY  + L+
Sbjct: 238 KASLNILRSMDSSIVSNLDDYR--ISFTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLI 295

Query: 277 SDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWM 336
           +     I    S +M++ LLAQL T  PK +    L+KL+I +QSGFS+RS Q+K   W+
Sbjct: 296 NHPVMEI--PKSKLMSESLLAQLSTTLPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWL 353

Query: 337 APSILLVSGMKIMDDSKLLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHE 396
           AP+ILLVSG+ I +D +    N R+K FLQE+PKL D +Q  +     K+K++FAV++ E
Sbjct: 354 APTILLVSGLIIPNDEEY--NNPRFKRFLQEFPKLNDNEQSLEPCHSYKKKISFAVYIDE 411

Query: 397 AWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGN-IYFNTVGGGIGIGNSQPVIK--SSG 453
            W+VTNKE FG+L + I++LSPRQ++F++ K+   IYFNT+G GIGIG+ QP +   ++ 
Sbjct: 412 PWRVTNKEFFGDLNSRIIELSPRQDIFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANS 471

Query: 454 KKYFPGNVSLTIDPSFEFGVFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGC 513
           +KY PGNVSLT++ + EF VFR+VGHGG+ SP +L  +R   E+S E +FIIQDVEVWGC
Sbjct: 472 RKYQPGNVSLTLESTLEFAVFRHVGHGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGC 531

Query: 514 GGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
           GG+KE E Q+KQ  WEEAE++RRQ +NL SI ED+ALLEMVGLVG HQSGGS+
Sbjct: 532 GGEKELEEQMKQLAWEEAEAKRRQQVNLKSISEDRALLEMVGLVGQHQSGGSM 584

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  440 bits (1131), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 244/560 (43%), Positives = 355/560 (63%), Gaps = 11/560 (1%)

Query: 1   MGQNAS--SRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDY 58
           MGQ++S  SR+ E       F + +++L +F+N+A +Q+   ELV+F+ N+ ++ +L   
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIE-NLNTP 59

Query: 59  LSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYK 118
           +S + L  +   P +    V +   M+   S FPL+   + E +  F GL+K  LL +  
Sbjct: 60  ISHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINS-SYEPITGF-GLLKCILLLNRT 117

Query: 119 KLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSY--DARKIMESFNDINLETI 176
           +  K+ + K+YDQ+ L+FI L+L+   K    E      +     ++I+  F+D++ E +
Sbjct: 118 RCEKFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITDFDDVDTEML 177

Query: 177 EVSADDLLQFMTFLLVIT-KYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSD 235
            + AD +LQF+++LL+++ K+    +   N   YE W  ++  A+N+LRTMNP +VS  +
Sbjct: 178 CLPADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVS--N 235

Query: 236 AAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPL 295
              + +T  QF   I  V PNL  PL   M+H  Y    LVS      + + S +MT  L
Sbjct: 236 VESHFITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPAL 295

Query: 296 LAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLL 355
           LAQL T  PK +  Q L+ L+I ++SGFS+RS QAKV  WMAPSIL+VSGM+I +  +  
Sbjct: 296 LAQLSTGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYA 355

Query: 356 A-KNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLIL 414
           A KN RY+ FL E+PKLKD DQK D+    K+K TFAV++ + WKVTNK+ FG+L T I+
Sbjct: 356 AEKNPRYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNTRII 415

Query: 415 QLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVF 474
           Q+SPRQ++++ ++ G IYFNT+GGGIGIG+ QP IK++ K+Y PGNVSLT D + EF VF
Sbjct: 416 QISPRQDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVF 475

Query: 475 RNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESE 534
           R+ G+GG + PG L +ER +     E  F+IQDVEVWGCGG+KE E Q+KQ  WEEAES+
Sbjct: 476 RHTGYGGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESK 535

Query: 535 RRQYINLSSIGEDKALLEMV 554
           RRQ IN  S+GED+ALLEM 
Sbjct: 536 RRQQINFRSLGEDRALLEMA 555

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  428 bits (1100), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 238/573 (41%), Positives = 364/573 (63%), Gaps = 18/573 (3%)

Query: 1   MGQNASSRSAESVEGR---LIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKD 57
           MGQ  S  S ES E +      +  ++IL+FF+N+++  L  +E+  F++ +G D DL D
Sbjct: 1   MGQTPSVESQESKETKNEMPELKSREDILDFFNNRSLSILLPMEIECFKSRLG-DKDLSD 59

Query: 58  YLSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDY 117
            L+ +    L ++         + +      S FP +   +  +  T  G++K  +L   
Sbjct: 60  PLTKDEFNTLLRIADSNSQLQILLWNFFLKISAFPFLSNRS--ESMTGFGILKGIILLTR 117

Query: 118 KKLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIE 177
           +++ KY        + LIFI   L    KV  K      S +  + ++++ + I+L +  
Sbjct: 118 ERIKKYLGWSNAKLIKLIFI--GLTSQEKVGVK---TEASVFKIQHVLDTLDGIDLASST 172

Query: 178 VSADDLLQFMTFLLVITKYCIFENVEVN-PSIYENWKDYESQALNILRTMNPCIVSYSDA 236
           V   D+L F+T+LL+++ +C   N ++N  S+Y+ WKDYE  A +++R+MN  I +    
Sbjct: 173 VKDTDMLSFITWLLLLSVHCPTSNCKLNEKSLYDKWKDYEIVASSMVRSMNKKITT---T 229

Query: 237 AKNV-VTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPL 295
            K + ++ + F   I AV  N+++PL   ++H+LYK + L+         + + +MT PL
Sbjct: 230 GKGIGISYSDFSHTIVAVSKNVMSPLENIVEHMLYKQDDLLEFPCLDTFLKETKLMTYPL 289

Query: 296 LAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLL 355
           +AQLCT+ P  I+   L+KL++ ++SG+S+RS Q+KV NW A +ILLVSG +I+DD +  
Sbjct: 290 VAQLCTVLPNEIVMSQLQKLYVGRESGYSMRSLQSKVFNWKAATILLVSGTRIVDDIEYS 349

Query: 356 A-KNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLIL 414
             KN RYK FL+EYPKLKDEDQ+ D     K+KVTFAV++ E W+VTNK  FG  +T I+
Sbjct: 350 ENKNPRYKRFLEEYPKLKDEDQEMDDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSII 409

Query: 415 QLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVF 474
           +LSPRQ+ F + K G++YFNT+GGGIGIGN+QPV K +  +Y PGNVSLT+D + EFGVF
Sbjct: 410 ELSPRQDKFNSLKVGSVYFNTIGGGIGIGNNQPVTKLNSVRYAPGNVSLTLDNTLEFGVF 469

Query: 475 RNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESE 534
           R+ G+GG+I P +L  +  +  ++ E RF+I+DVEVWGCGG+KE E QL++W+WEEAE++
Sbjct: 470 RHTGYGGTIGPSELLKKNNEENKAFEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAK 529

Query: 535 RRQYINLSSIGEDKALLEMVGLVGHH-QSGGSL 566
           RRQ INL ++GED+ALLEM G++G H QSGGS+
Sbjct: 530 RRQEINLKTMGEDRALLEMAGIIGQHGQSGGSI 562

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  423 bits (1088), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/581 (41%), Positives = 346/581 (59%), Gaps = 29/581 (4%)

Query: 1   MGQNASSRS--AESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDY 58
           MGQNAS +   AE    +  F    E++EFFD +AV      EL AF++ +     LKD 
Sbjct: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLE-GKTLKDP 59

Query: 59  LSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYK 118
           +  E L +  ++P       +  Y+ +   S FPLM   + +DV T VGL+K+ LL +  
Sbjct: 60  VRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKD-SFDDV-TGVGLLKSVLLTNPS 117

Query: 119 KLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDAR---------KIMESFN 169
           K  KY   K YD + L+FI L++       +K +   PS   +           ++ ++N
Sbjct: 118 KCHKYVGVKNYDHMKLLFIALSM-------RKSVKEEPSCSSSTSLEDGGGSINLLRTYN 170

Query: 170 DINLETIEVSADDLLQFMTFLLVITKYCIFENVEVNPSI-YENWKDYESQALNILRTMNP 228
           +I ++ + + A  L+Q + +LL++T YC   N +    + Y  W  ++  A N+LRTMN 
Sbjct: 171 NIVVDDLAIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNN 230

Query: 229 CIVSYSDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVS---DSGATIND 285
            IV+  ++    V   QF   I+ V PN+   L   M+H+LY+   LVS   +S   I  
Sbjct: 231 NIVTNLESYS--VKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPI-- 286

Query: 286 RSSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSG 345
            +S   T  +LAQL T     + +   + L++ ++SGFS+RS QAKV  WMAP+++L+SG
Sbjct: 287 LTSKPTTQAVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSG 346

Query: 346 MKIMDDSKLLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQ 405
             ++DD     KN RY+ FL +YPKLKD DQ    +   K KV FAV++ E WK TNK+ 
Sbjct: 347 KCVLDDEDFSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDY 406

Query: 406 FGNLKTLILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTI 465
           FG   T I+QLSP Q+VF+A+ N  +YFNT+GGGIGIGN+QP IK+  K Y PGNVSLTI
Sbjct: 407 FGGSGTTIVQLSPTQDVFKAASNEVMYFNTLGGGIGIGNNQPHIKNGVKSYSPGNVSLTI 466

Query: 466 DPSFEFGVFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQ 525
           D + EF  FR+VG+GG+ +PG L  +    +   E +F+IQDVEVWGCGG +E E Q K+
Sbjct: 467 DSTLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKK 526

Query: 526 WEWEEAESERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
           W+WEEAE++RRQ INL S GED+ALLEM GLVGH Q+GGS+
Sbjct: 527 WQWEEAEAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  411 bits (1057), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/581 (40%), Positives = 338/581 (58%), Gaps = 19/581 (3%)

Query: 1   MGQNASSRSAESVE---GRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKD 57
           MGQ+ SS+  E  +    +L     +EI + ++++ +RQ +  EL  F+  +G+   L D
Sbjct: 1   MGQSVSSQEPEPTQESDPQLGNGTTEEIEQEYNDRVLRQFNASELYTFKCRVGMTRQLND 60

Query: 58  Y-LSCEFLVQLC-KLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLF 115
             L  E L  LC  L  H     K+   +I    +FP +    G    T V L+KA +L 
Sbjct: 61  VVLEQELLEWLCLPLEGHLQQPSKLLVGVIKVLGQFPFISNTGGN--LTAVSLLKAVILI 118

Query: 116 DYKKLLKYAQCKTYDQVSLIFILLALEPHAKVS-KKELGRPPSSYDARKIMESF--NDIN 172
           +  K LKY   K+Y+ + LIF+ L L   +  S KKE   P   ++  K++ S+  N   
Sbjct: 119 NRGKCLKYIGNKSYNHLELIFMALYLAQDSHDSTKKESYDPKEPHNIEKVISSYDGNSDC 178

Query: 173 LETIEVSADDLLQFMTFLLVITKYCIFENVEVNPSIYEN-WKDYESQALNILRTMNPCIV 231
           +  I V AD+LLQF T LL+++      N +++    +N W  YE  A N++RTMN  I+
Sbjct: 179 VSEITVQADNLLQFTTMLLLLSARIPRPNSQIDLKTADNDWAKYEKSAYNVIRTMNSSII 238

Query: 232 SYSDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVM 291
           S      + ++  QF D I+ + P +LT L   ++H+LY  + LV  +        + VM
Sbjct: 239 S--SCQTHTISFHQFYDVISILLPTILTTLDNLLQHLLYTPDQLVDHTALGPTFTETKVM 296

Query: 292 TDPLLAQL-CTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMD 350
                A L   L  K      L+KL++ + SGFS+RSFQ KV +W AP++L VSG +I D
Sbjct: 297 NHGSFALLQFALADKGYPISKLQKLYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQD 356

Query: 351 DSKLLA-KNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNL 409
           D      KN RY  FL+++ KL+D DQ+    +  KRKV F +++   W+VTNK+ F   
Sbjct: 357 DDDYSKNKNPRYSKFLEDFRKLRDTDQQLSPCLLKKRKVMFVIYIESPWRVTNKDYFSAG 416

Query: 410 KTLILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSF 469
           +T I QLSP  ++F+A+++  +YFNT+GGGIGIG++QP  K + ++Y PGN+SLT+D S 
Sbjct: 417 RTTIFQLSPELDIFKANRDDVVYFNTMGGGIGIGDTQPYTKVNYREYRPGNISLTLDSSL 476

Query: 470 EFGVFRNVGHGGSISPGKLFLERPD----VEQSLECRFIIQDVEVWGCGGDKEFEAQLKQ 525
           EFG FRNVG GG   PG LF  R         S E RF+IQDVEVWGCGG+KE   Q+KQ
Sbjct: 477 EFGAFRNVGPGGMFEPGALFTRRNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQMKQ 536

Query: 526 WEWEEAESERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
            +WEE E++RRQ++NL S+ ED+ALLEM GLVG HQSGGS+
Sbjct: 537 LQWEETEAKRRQHVNLKSLSEDRALLEMAGLVGQHQSGGSI 577

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  407 bits (1047), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/572 (39%), Positives = 350/572 (61%), Gaps = 13/572 (2%)

Query: 1   MGQNASSRSAESVEGRLIFRD---EKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKD 57
           MGQ +S   A S +     +D   E EI+++F+ + + Q   +EL+ F++ + +D D   
Sbjct: 1   MGQGSSIPEASSGDSNESIKDLTSELEIVDYFNKRVISQFSNIELLCFKHLLEID-DYST 59

Query: 58  YLSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDY 117
            +    + +L ++         +    I   + FP +   A  D  T  GL+K  ++   
Sbjct: 60  IIDDAVVYKLLQIQDVSDRLRNLILNFIKRLTNFPFISTVA--DNVTAYGLLKTIVILQK 117

Query: 118 KKLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIE 177
           +K +KY      + + ++FI L      + +KK L     S     I+ +++ I +  I 
Sbjct: 118 QKFIKYTNNNQLNMLKILFIALGDYDREEDNKKILDCHNISIST--ILTTYDGIPIHDIS 175

Query: 178 VSADDLLQFMTFLLVITKYCIFENVEVNPS-IYENWKDYESQALNILRTMNPCIVSYSDA 236
           VS+ +++ F+T++L ++  C   N  V+   +++ W+ YE+ A++++R+MNP I+   D 
Sbjct: 176 VSSSNMISFLTWILALSNVCPTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIK-PDD 234

Query: 237 AKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLL 296
            +N++   QFK  +  + P++  PL   + H+L+    L+      I+ + S +MT  + 
Sbjct: 235 NQNIL-FIQFKTALETIMPHVYLPLEHLLNHLLFMESSLIKSQEIEISFQESKLMTFAVA 293

Query: 297 AQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLA 356
           +QL TL    ++   L KL+  ++SGFS+RSFQ+K   W AP+ILL+SGM++ DD +   
Sbjct: 294 SQLSTLLRNDVVISKLHKLYSGRESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYAT 353

Query: 357 K-NQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQ 415
           K N RYK F+ +YP+L+D DQ  +      RKVTFAV+V E WKV+NK QFG LKTLI++
Sbjct: 354 KKNPRYKKFIDQYPRLRDLDQNLEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVE 413

Query: 416 LSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFR 475
           LSPRQ+ F+A+K G IYFNTVGGGIGIG+SQPV K +   Y PGNVSLTID S EFG FR
Sbjct: 414 LSPRQDCFRAAKPGVIYFNTVGGGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFR 473

Query: 476 NVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESER 535
           + G+GGSI P  +  ++ D  ++ E RF+IQD+EVWGCGG+KE + QLKQW WEE E+++
Sbjct: 474 HTGYGGSIEPSSILQKKEDATRTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKK 533

Query: 536 RQYINLSSIGEDKALLEMVGLVGHH-QSGGSL 566
           RQ +NL S+GED+ALLEM G++G+H  SGGSL
Sbjct: 534 RQRVNLKSMGEDRALLEMAGIIGNHAHSGGSL 565

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  406 bits (1044), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/574 (40%), Positives = 352/574 (61%), Gaps = 28/574 (4%)

Query: 1   MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS 60
           MGQ  S  + +S      F    +IL+ F+++A++Q    ELV+F+N +G   DL + L+
Sbjct: 1   MGQRTSQATLQSSTH---FTSNSDILKSFNDRALKQFTVTELVSFKNKLG--KDLNERLT 55

Query: 61  CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL 120
            E L +   +P+ +    ++ Y  +     FPLM   + E+V T +G++KA +L + ++ 
Sbjct: 56  NEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKN-SYENV-TGIGVLKAIILTNPERC 113

Query: 121 LKYAQCKTYDQVSLIFILLALEPHAKVSKK--ELGRPPSSYDARKIMESFNDINLETIEV 178
            KY + + YDQ+ L FI L++    K             S+D  +I+++F+ +++  + V
Sbjct: 114 KKYVKSRNYDQLKLWFIALSIRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSV 173

Query: 179 SADDLLQFMTFLLVITKYCIFENVEV-NPSIYENWKDYESQALNILRTMNPCIVSYSDAA 237
               ++ F+++LL++T YC   N ++ N ++++NW  Y   A  ILR+M P   S     
Sbjct: 174 PFAYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRPMDES----- 228

Query: 238 KNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLV---SDSGATINDRSSTVMTDP 294
            + +    F   + ++ P++  PL   M+H+L+K + LV   S++   I   SS ++   
Sbjct: 229 -SWIEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEI--ASSKLLNSA 285

Query: 295 LLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKL 354
           LLAQ+ +   K +   +L++L++ +  GFS+RSFQAKV  W AP+I+L+ G +I+DD + 
Sbjct: 286 LLAQISSALSKQLPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEY 345

Query: 355 LAKNQRYKSFLQEYPKLK--DEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTL 412
             KN R++ FL EYPKLK  D D + + +   K K+  AV+V + WK+TNKE FG   T 
Sbjct: 346 SVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTT 405

Query: 413 ILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFG 472
           I+QLSP QEVF +S+   +YFNT+GGGIGIGN QPVIKS+ K Y PGNVSLT+D + EF 
Sbjct: 406 IVQLSPFQEVFGSSRENALYFNTIGGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFA 465

Query: 473 VFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAE 532
           V R+ G GG + PG +  ++       E + ++QDVEVWGCGG+KE E QLKQWEWEE+E
Sbjct: 466 VLRHAGQGGVLKPGLVVGDK-----DFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESE 520

Query: 533 SERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
           ++RRQ INL SIGED+ALLEM GLVG  QSGGS+
Sbjct: 521 AKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV 554

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  367 bits (943), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 219/574 (38%), Positives = 331/574 (57%), Gaps = 27/574 (4%)

Query: 1   MGQNASS-RSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQ---NNIGLDADLK 56
           MGQ ASS +  +  +    F+   EIL++F+ + V+     E+ AF+   N I L+  + 
Sbjct: 1   MGQTASSPQDNKESKSHPQFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNEPID 60

Query: 57  DYLSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFD 116
           D L  E L  L   P + +  V    +++ N   FPL      + +  F GL+K   + +
Sbjct: 61  DTLIKEALY-LDAQP-NVWSAVSETIRLLQN---FPLFHQPIADSITGF-GLLKVIAIIN 114

Query: 117 YKKLLKYAQCKT--YDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLE 174
            K+  K        YD    I + L L   AK S+ ++     S +   I+++++ I +E
Sbjct: 115 VKRFEKLVNTTITRYD----ITVTLGLCGQAKESENKI----KSTNLGDILKTYDHIEIE 166

Query: 175 TIEVSADDLLQFMTFLLVITKYCIFENVEVNPS-IYENWKDYESQALNILRTMNPCIVSY 233
           +I +  D L+  + +LL +       N +V  S    NW +++S A++I  T++    + 
Sbjct: 167 SIHIPYDKLILLVAWLLTLVTGVATTNCKVELSDTIANWNNFKSSAISIANTISTS--AL 224

Query: 234 SDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTD 293
            +A    +      +    +  +L+  +    +H+L+  + L+       N     V+T 
Sbjct: 225 GNANDIGIPATDILNAFNTIMISLVPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTP 284

Query: 294 PLLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDD-S 352
            L AQ+    P  I    L+KL++ K+SGFS+RS Q+KV  W AP++++VSG +I DD S
Sbjct: 285 SLYAQVIIGLPNSITITKLQKLYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDES 344

Query: 353 KLLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTL 412
              +KN RY+SFL  +PKL++ DQ  D+I   K+KVT+AV++ E WKV+NKE+FG     
Sbjct: 345 YADSKNPRYRSFLYSFPKLRENDQNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMT 404

Query: 413 ILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFG 472
           I++L+P+Q+ +Q+     +YFNT+GGGIG+G+ QP++K +  K+ PGN+SLT+D S EFG
Sbjct: 405 IMELTPQQKTYQSCMERTMYFNTIGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFG 464

Query: 473 VFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAE 532
           VFR+VG GG     K  L   D  +S E RFIIQ+VEVWGCGG+KE   QLKQ EWEEAE
Sbjct: 465 VFRHVGAGGGF---KTSLLDNDDSKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAE 521

Query: 533 SERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566
           ++RRQ INL S+ EDKALLEMVGLVG HQSGGS+
Sbjct: 522 AKRRQTINLQSLSEDKALLEMVGLVGQHQSGGSV 555

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  255 bits (651), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 175/526 (33%), Positives = 277/526 (52%), Gaps = 74/526 (14%)

Query: 41  ELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGE 100
           EL+ FQ  I  +  L D +S + +++   +P  K     ++ + I N +K+P     + +
Sbjct: 29  ELITFQKRI--NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP-----SND 81

Query: 101 DVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYD 160
           ++ T    +K   L + K+     + K + ++  I I+        +S +E+  P     
Sbjct: 82  NIITGYSYLKIITLLNKKR-----RNKMFPKIEWIKIIFMC-----LSDEEVQFP----- 126

Query: 161 ARKIMESFNDINLETIEVSADDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYES--- 217
                E+ +DI+     V  +DL++F++ LL +   C  +   +N  +  N  D+++   
Sbjct: 127 ---CWETTHDIH-----VLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWR 178

Query: 218 -QALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLV 276
             A  I+R M  C V             +F++ +  V PN+   L   ++H LY  + L 
Sbjct: 179 KSASCIVRDMKECNVE------------EFENVLLIV-PNIFDCLKNLIEHSLYTKDQL- 224

Query: 277 SDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWM 336
            +     +  + T M   +L Q+     K  +  ++ KL+I +++G+S+RSFQ+KV  W 
Sbjct: 225 KECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRSFQSKVFKWK 282

Query: 337 APSILLVSGMKIMDDSKLLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHE 396
           AP+ILL++G KI++D +   KN RYKSFL  YP+LKD      +        TFA+++ E
Sbjct: 283 APTILLITGKKIINDQEYSEKNNRYKSFLNSYPRLKD----GKTTFQTPLHYTFAIYIEE 338

Query: 397 AWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKY 456
            WK+T K  FG L T I+QLSPRQ+VF  +    +YF+T   GIGIGN      SS  KY
Sbjct: 339 PWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSSDNKY 393

Query: 457 FPGNVSLTIDPSFEFGVFRNVGHG----GSISPGKLFLERPDVEQSLECRFIIQDVEVWG 512
            PGNVS+TID + EF VFR+ G G    G I+  ++F          E R  IQ VEVWG
Sbjct: 394 KPGNVSITIDSTLEFAVFRHSGPGVFKTGIIANQEIF----------EIRLHIQSVEVWG 443

Query: 513 CGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMVGLVG 558
           CGG KE   Q  +WEWEE E++RRQ++++  + ED+ALLE+ G++G
Sbjct: 444 CGGAKELAEQKHEWEWEEREAQRRQHVSM-HVTEDRALLELAGIIG 488

>ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR153W (PDR5) and
           YDR406W (PDR15)
          Length = 1512

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 26/47 (55%)

Query: 487 KLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAES 533
           KL++  PD  +  E   +++++ V G   D +++A +  W W+ A S
Sbjct: 112 KLYMSDPDHYKPAELSVVLRNLRVCGEAADTDYQATVGNWPWKTARS 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,122,166
Number of extensions: 2657118
Number of successful extensions: 6897
Number of sequences better than 10.0: 23
Number of HSP's gapped: 6967
Number of HSP's successfully gapped: 23
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)