Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47635.432ON53853825520.0
AER257W5.432ON47746916460.0
KLLA0E21121g5.432ON52642116030.0
SAKL0G02486g5.432ON50049815900.0
KLTH0F16104g5.432ON54047415440.0
Suva_8.1725.432ON48647015200.0
YOR119C (RIO1)5.432ON48447515190.0
Skud_15.2825.432ON48547515110.0
Kpol_1062.315.432ON51343015070.0
Smik_15.2975.432ON48647314950.0
CAGL0L11594g5.432ON50748614930.0
Kwal_55.214335.432ON47640514870.0
KAFR0E039205.432ON49741514780.0
NCAS0F033605.432ON50950314670.0
TPHA0E017805.432ON50842214600.0
TDEL0E019305.432ON50238814490.0
TBLA0A037605.432ON50441314480.0
KNAG0C049305.432ON49648214200.0
NDAI0B056505.432ON46238913760.0
ZYRO0F09988g5.432ON46038813001e-176
CAGL0H08019g2.44ON4252381303e-07
TPHA0H009202.44ON4292361285e-07
NCAS0G015802.44ON4242361181e-05
KAFR0A077602.44ON4252361142e-05
NDAI0F036002.44ON4212371125e-05
Smik_14.1252.44ON4202361054e-04
Kwal_23.45632.44ON425275990.002
YNL207W (RIO2)2.44ON425236970.003
Kpol_400.72.44ON425236950.006
KLTH0B07722g2.44ON428242890.026
ZYRO0C10340g2.44ON416237880.037
TDEL0B034208.768ON489258800.33
Ecym_11191.104ON79149770.97
TBLA0G003702.44ON444193751.5
KLLA0F15576g5.200ON51251742.0
KLTH0G16588g3.211ON2498214742.2
KLTH0F10824gna 1ON429107732.6
TPHA0B042801.104ON85091723.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4763
         (538 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   987   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   638   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   622   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   617   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   599   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   590   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   589   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   586   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   585   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   580   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   579   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   577   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   573   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   569   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   566   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   562   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   562   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   551   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   534   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   505   e-176
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    55   3e-07
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    54   5e-07
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      50   1e-05
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    49   2e-05
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    48   5e-05
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    45   4e-04
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    43   0.002
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    42   0.003
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    41   0.006
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    39   0.026
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    39   0.037
TDEL0B03420 Chr2 complement(609095..610564) [1470 bp, 489 aa] {O...    35   0.33 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    34   0.97 
TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44 ...    33   1.5  
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    33   2.0  
KLTH0G16588g Chr7 complement(1437552..1445048) [7497 bp, 2498 aa...    33   2.2  
KLTH0F10824g Chr6 (923729..925018) [1290 bp, 429 aa] {ON} weakly...    33   2.6  
TPHA0B04280 Chr2 complement(1000206..1002758) [2553 bp, 850 aa] ...    32   3.6  

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/538 (90%), Positives = 487/538 (90%)

Query: 1   MNEMSQLNLTYIHTNNLIHHNRIYDLEQIRLDMDLENKLGRLKLLDHSEHENSRILDKFA 60
           MNEMSQLNLTYIHTNNLIHHNRIYDLEQIRLDMDLENKLGRLKLLDHSEHENSRILDKFA
Sbjct: 1   MNEMSQLNLTYIHTNNLIHHNRIYDLEQIRLDMDLENKLGRLKLLDHSEHENSRILDKFA 60

Query: 61  NQIKTDELSVTRGKTSKDKANRATVENVLDPRTMRFLRSLIHRGIITEFNGCLSTGKEAN 120
           NQIKTDELSVTRGKTSKDKANRATVENVLDPRTMRFLRSLIHRGIITEFNGCLSTGKEAN
Sbjct: 61  NQIKTDELSVTRGKTSKDKANRATVENVLDPRTMRFLRSLIHRGIITEFNGCLSTGKEAN 120

Query: 121 VYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEF 180
           VYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEF
Sbjct: 121 VYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEF 180

Query: 181 RFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFA 240
           RFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFA
Sbjct: 181 RFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFA 240

Query: 241 SPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQS 300
           SPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQS
Sbjct: 241 SPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQS 300

Query: 301 VQPEHPMSLDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQK 360
           VQPEHPMSLDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQK
Sbjct: 301 VQPEHPMSLDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQK 360

Query: 361 YASEYLPLKLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKV 420
           YASEYLPLKLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKV
Sbjct: 361 YASEYLPLKLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKV 420

Query: 421 AKTFTASEQFELSDSGTDSVDHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTREHR 480
           AKTFTASEQFELSDSGTDSVDHG                                TREHR
Sbjct: 421 AKTFTASEQFELSDSGTDSVDHGDSDEDLSSDESNSETENDSDDSQSSDEEPDEDTREHR 480

Query: 481 IKEPKGKKYEDKDTRKLRKQDXXXXXXXXXXXXXXXXXXXNWSKRRNLKNNIISSSAK 538
           IKEPKGKKYEDKDTRKLRKQD                   NWSKRRNLKNNIISSSAK
Sbjct: 481 IKEPKGKKYEDKDTRKLRKQDVKESKREKRKTKVKKHIKKNWSKRRNLKNNIISSSAK 538

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/469 (67%), Positives = 369/469 (78%), Gaps = 21/469 (4%)

Query: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92
           MDLE++L +LKL D ++H+N+RIL+KFANQIKTDELS+T+GKT+KDKANRATVENVLDPR
Sbjct: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60

Query: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDT 152
           TMRFLR+L++RG+++EFNGCLSTGKEANVYHA   A                   +EG  
Sbjct: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGA-------------------TEGAP 101

Query: 153 KKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHT 212
           +K EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIY +
Sbjct: 102 EKSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQS 161

Query: 213 GVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQV 272
           GVI CP+P+EIKSNVLVMEFLNRGDGFASP+LKDYP+ DR EIY++YHVMV+YIRLLYQV
Sbjct: 162 GVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQV 221

Query: 273 CQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVFS 332
           CQLVHADLSEYNSIVH+SKLYIIDVSQSVQPEHPMSLDFLRMDIKNIN YF ++GI++F 
Sbjct: 222 CQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFP 281

Query: 333 ERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLGG 392
           ER IFQFVISE L+KF+GD RS + L+ Y +  LP K T +DE ED++FRSLHLVRNLGG
Sbjct: 282 ERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGG 341

Query: 393 LEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGXXXXXXXXX 452
           LEE DFDRFT+GKFDLLKSL++QDN K++ TFTASEQ++LSDS     +           
Sbjct: 342 LEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYDLSDSDDAEDEDEDADEGQDED 401

Query: 453 XXXXXXXXXXXXXXXXXXXXXXXTREHRIKEPKGKKYEDKDTRKLRKQD 501
                                    E R K   GKKYEDKD +KLRK +
Sbjct: 402 GSESGTDSDSSSDDESGDDKDDY--ELRPKVLVGKKYEDKDAKKLRKSE 448

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/421 (70%), Positives = 358/421 (85%), Gaps = 23/421 (5%)

Query: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92
           M++++KL +L L +  EH N++IL+++AN IKTDELS+TRGKTSKDKANRATVENVLDPR
Sbjct: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61

Query: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVD---IVEKQHKVI--------- 139
           TMRFL+S+++RGI++ FNGCLSTGKEANVYHAF GN  +   +VE     I         
Sbjct: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121

Query: 140 RQSSICSDSEGDTK----------KVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQH 189
           +Q ++ ++SE  T           K EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQH
Sbjct: 122 KQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQH 181

Query: 190 NPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPY 249
           NPRKMIKIWAEKEFRNLKRIY +GVI CPKPIE++SNVLVMEFLNRGDGFASP+LKD+PY
Sbjct: 182 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPY 241

Query: 250 SDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSL 309
            DR+EI ++Y++M+AY+RLLYQVC+LVHADLSEYNSIVHE KLYIIDVSQSVQPEHPMSL
Sbjct: 242 KDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMSL 301

Query: 310 DFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLK 369
           DFLRMDIKN+N+YF K+GI++F ER IFQF+ISE L+KFKGDYRS D L+ Y ++ LPLK
Sbjct: 302 DFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPLK 361

Query: 370 LTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQ 429
           LT+EDE EDE+FRSLHL+RNLGGLEE DFDRFT+GKFDLLKSL++ +N+K ++ FTASEQ
Sbjct: 362 LTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTASEQ 421

Query: 430 F 430
           +
Sbjct: 422 Y 422

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/498 (62%), Positives = 369/498 (74%), Gaps = 56/498 (11%)

Query: 33  MDLENKLGRLKLLD----HSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENV 88
           M +E    +L L D    H +H NSRILDK++++IKTDELS+TRGKT+KDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 89  LDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVEKQHKVIRQSSICSD 147
           LDPRTMRFLR L+ RG++++ NGCLSTGKEANVYHAF GNA    E+  K         D
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEK---------D 111

Query: 148 SEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 207
           S+ +  K EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK
Sbjct: 112 SKDELVKREYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 171

Query: 208 RIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIR 267
           RI+ +GVI CP+PIE++SNVLVMEFLNRG+GFASP+LKD+PY DR+EI Y+YH MVAY+R
Sbjct: 172 RIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMR 231

Query: 268 LLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIG 327
           LLYQVCQLVHADLSEYN+IVH  +LY+IDVSQSVQPEHPMSLDFLRMDIKNIN+YF K G
Sbjct: 232 LLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTG 291

Query: 328 INVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLV 387
           I++F ER IFQF+ISE L+KF+GDY +   L+ Y S+ LPLK T EDE EDE+FRSLHLV
Sbjct: 292 IDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLV 351

Query: 388 RNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFEL--------------- 432
           RNL GLEE DFDRFT+GKFDLLKSL++ DN+K A  F ASEQFE+               
Sbjct: 352 RNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQFEIDSSDEDSEDEFPDLD 411

Query: 433 ---------SDSGTDSVDHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTREHRIKE 483
                    S+ G++ +D+G                                     +K+
Sbjct: 412 GEDLESDGGSECGSEQLDNGEEDDSEEDDDEEYDDDRKN------------------LKD 453

Query: 484 PKGKKYEDKDTRKLRKQD 501
           PKGKKYEDKD ++LRKQ+
Sbjct: 454 PKGKKYEDKDAKRLRKQE 471

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/474 (66%), Positives = 362/474 (76%), Gaps = 20/474 (4%)

Query: 33  MDLENKLGRLKLLDH----SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENV 88
           M LE+ LG+L L +      +H N++ILDK A+ IKTDELSVTR KTSKDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 89  LDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVEKQHKVIRQSSICSD 147
           LDPRTMRFL++L  RG+I+EFNGCLSTGKEANVYHAF G      E++ KV+        
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVL-------P 165

Query: 148 SEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 207
           ++G+ +  EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK
Sbjct: 166 NQGERR--EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 223

Query: 208 RIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIR 267
           RIY +GV+  P+PIE+KSNVLVMEFLNRGDGFASPKLKD+PY DR E  Y+YH MVAYIR
Sbjct: 224 RIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIR 283

Query: 268 LLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIG 327
           LLYQ CQLVHADLSEYN+IVH  KLY+IDVSQSVQPEHPMSLDFLRMDIKNIN+YF ++ 
Sbjct: 284 LLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMS 343

Query: 328 INVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLV 387
           I++F ERAIFQFVIS+KLEKF+G+Y + + L++Y ++ L  K   EDE EDE+FRSLHLV
Sbjct: 344 IDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLV 403

Query: 388 RNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGXXXX 447
           RNLGGLEE DFDRFT GKFDLLKSL++ DNQKVA  FTASEQ+ELS S  + V       
Sbjct: 404 RNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQYELSSSSDEEVSEDEDYN 463

Query: 448 XXXXXXXXXXXXXXXXXXXXXXXXXXXXTREHRIKEPKGKKYEDKDTRKLRKQD 501
                                           + KE KGKK+EDKD++K RK D
Sbjct: 464 ESGSGSEDDDGDDESGESSDEEEWL------EKSKEIKGKKHEDKDSKKQRKTD 511

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/470 (63%), Positives = 360/470 (76%), Gaps = 14/470 (2%)

Query: 33  MDLENKLGRLKLLDH-SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDP 91
           M  E+K  +L +    S+H N+++LDKF+++IKTDELS ++ KTSKDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGD 151
           RTMRFL+S+++RG+I + NGCLSTGKEANVYHAF        K   V  ++      E D
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGT----GKAPVVDEETGKYEVLETD 116

Query: 152 TKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYH 211
             + EYAIKIYKTSILVFKDRE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLKRI+ 
Sbjct: 117 GLRAEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQ 176

Query: 212 TGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQ 271
           +GVI  PKP+E+K+NVLVMEFL+RGDGFASPKLKDYPY DR+EI+++Y+ MVAY+RLLYQ
Sbjct: 177 SGVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQ 236

Query: 272 VCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVF 331
           VC+LVHADLSEYN+I+H+ +LY+IDVSQSV+PEHPMSLDFLRMDIKN+N YF K+GIN+F
Sbjct: 237 VCRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIF 296

Query: 332 SERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLG 391
            ER IFQFVISE LEKFKGDY++   L  Y S+ LP+K TE+DE EDEIFRSLHLVR+LG
Sbjct: 297 PERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLG 356

Query: 392 GLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGXXXXXXXX 451
           GLEE DFDR+T+GKFDLLKSL++ DN+   + F ASEQFE +D+     DHG        
Sbjct: 357 GLEERDFDRYTDGKFDLLKSLIAHDNE---RNFAASEQFEFNDN-----DHGSAPESEES 408

Query: 452 XXXXXXXXXXXXXXXXXXXXXXXXTREHRIKEPKGKKYEDKDTRKLRKQD 501
                                     +   K  KGKKYEDKD +KLRKQ+
Sbjct: 409 SGSEYEDLSGSEEDEDDSDDSEYYDDDEP-KILKGKKYEDKDVKKLRKQE 457

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 357/475 (75%), Gaps = 26/475 (5%)

Query: 33  MDLENKLGRLKLLD-HSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDP 91
           M LE+K   L +    S+H N+++L+K++++IKTDELS +R KTSKDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNA-----VDIVEKQHKVIRQSSICS 146
           RTMRFL+S++ RG+I + NGCLSTGKEANVYHAF        +D    Q++V+       
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVL------- 113

Query: 147 DSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 206
             E D  + EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL
Sbjct: 114 --ETDGSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 171

Query: 207 KRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYI 266
           KRIY +GVI  PKPIE+K+NVLVMEFL+RG+GFASPKLKDYPY +R EI+++YH MVAY+
Sbjct: 172 KRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYM 231

Query: 267 RLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKI 326
           RLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YF K+
Sbjct: 232 RLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKM 291

Query: 327 GINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHL 386
           GI++F ER IFQFVISE LEKFKGDY +   L  Y +  LP+K TE+DE EDEIFRSLHL
Sbjct: 292 GISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHL 351

Query: 387 VRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGXXX 446
           VR+LGGLEE DFDR+T+GKFDLLKSL++ DN+   + F ASEQFE      D+ DH    
Sbjct: 352 VRSLGGLEERDFDRYTDGKFDLLKSLIAHDNE---RNFAASEQFEF-----DNADH---E 400

Query: 447 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTREHRIKEPKGKKYEDKDTRKLRKQD 501
                                          +   K  KGKK+EDKD +KLRKQ+
Sbjct: 401 CSSGTEEFSDDEEDGSSGSEEDDEEEGEYYDDDEPKVLKGKKHEDKDLKKLRKQE 455

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/475 (62%), Positives = 361/475 (76%), Gaps = 25/475 (5%)

Query: 33  MDLENKLGRLKLLDH-SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDP 91
           M LE++  RL +    S+H N+++L+K++++IKTDELS ++ KTSKDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNA-----VDIVEKQHKVIRQSSICS 146
           RTMRFL+S+++RG+I + NGCLSTGKEANVYHAF        +D    Q++V+       
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVL------- 113

Query: 147 DSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 206
             E D  + EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL
Sbjct: 114 --ETDGLRKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL 171

Query: 207 KRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYI 266
           KRI+ +GVI  P+P+E+K+NVLVMEFL+RG+GFASPKL+DYPY DR+EI+++YH MVAY+
Sbjct: 172 KRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYM 231

Query: 267 RLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKI 326
           RLLYQVC+LVHADLSEYN+I+H  KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YF K+
Sbjct: 232 RLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKM 291

Query: 327 GINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHL 386
           G+++F ER IFQFVISE LEKFKGDY +   L  Y ++ LP+K TE+DE EDEIFRSLHL
Sbjct: 292 GVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHL 351

Query: 387 VRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGXXX 446
           VR+LGGLEE DFDR+T+GKFDLLKSL++ DN+   + F ASEQFE      D+ DH    
Sbjct: 352 VRSLGGLEERDFDRYTDGKFDLLKSLIAHDNE---RNFAASEQFEF-----DNADHESSS 403

Query: 447 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTREHRIKEPKGKKYEDKDTRKLRKQD 501
                                          E +I   KGKKYEDKD +KLRKQ+
Sbjct: 404 DLEESSDEEGDNSSGGEEDEESDDREYYEDDEPKIL--KGKKYEDKDIKKLRKQE 456

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/430 (66%), Positives = 340/430 (79%), Gaps = 29/430 (6%)

Query: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92
           M  + K  RLK+       N+RIL+K+ ++IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 1   MSFDEKFDRLKI--SGNDVNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPR 58

Query: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVEKQHKV-----IRQSSICS 146
           TMRFL++L +RG+I+ FNGCLSTGKEANVYHAF G+         KV     +    +  
Sbjct: 59  TMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQ 118

Query: 147 DSE---GDTKKV---------------EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 188
           DSE   GD   V               EYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQ
Sbjct: 119 DSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 178

Query: 189 HNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYP 248
           HNPRKMIKIWAEKEFRNL+RI+ +GVI  PKP+E+KSNVLVMEFLNRG+GFASP+LKDYP
Sbjct: 179 HNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYP 238

Query: 249 YSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMS 308
           Y DR EI+++YH++VAY+RLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMS
Sbjct: 239 YKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMS 298

Query: 309 LDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPL 368
           LDFLRMDIKN+N YF K+GI++F ER IFQFVISEKLE FKGD  S D L+++    LP+
Sbjct: 299 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPI 358

Query: 369 KLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASE 428
           K T+EDE EDE+FRSLHLVRNLGGLEE DFDRFT+GKFDLLK+L++ DNQ   K FTASE
Sbjct: 359 KSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQ---KNFTASE 415

Query: 429 QFELSDSGTD 438
           Q+ + D   D
Sbjct: 416 QYGMEDLDAD 425

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/473 (62%), Positives = 355/473 (75%), Gaps = 20/473 (4%)

Query: 33  MDLENKLGRLKLLDH-SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDP 91
           M LE+   +L +    S+H N+++L+K++++IKTDELS  R KTSKDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGD 151
           RTMRFL+S+++RG+I + NGCLSTGKEANVYHAF        K   +  ++      E D
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG----TGKAPVIDEETGKYEVLETD 116

Query: 152 TKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYH 211
             + EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIY 
Sbjct: 117 GPRPEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQ 176

Query: 212 TGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQ 271
           +GVI  PKPIE+K+NVLVMEFL+RG+GFASPKLKDYPY DR EI+++Y+ MVAY+RLLYQ
Sbjct: 177 SGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQ 236

Query: 272 VCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVF 331
           VC+LVHADLSEYN+I+H+ KL++IDVSQSV+PEHPMSLDFLRMDIKN+N YF K+GI++F
Sbjct: 237 VCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIF 296

Query: 332 SERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLG 391
            ER IFQFVISE LEKFK DY +   L  Y ++ LP+K TE+DE EDEIFRSLHLVR+LG
Sbjct: 297 PERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLG 356

Query: 392 GLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGXXXXXXXX 451
           GLEE DFDR+T+GKFDLLKSL++ DN+   + F ASEQFE      D+ DH         
Sbjct: 357 GLEERDFDRYTDGKFDLLKSLIAHDNE---RNFAASEQFEF-----DNADHTSGSGSEEF 408

Query: 452 XXXXXXXXXXXXXXXXXXXXXXXXTREHRIKEP---KGKKYEDKDTRKLRKQD 501
                                      +   EP   KGK+YEDKD +KLRKQ+
Sbjct: 409 SDDEDDSSENDKEGNEESDDCAY----YEDDEPKILKGKRYEDKDVKKLRKQE 457

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/486 (60%), Positives = 361/486 (74%), Gaps = 28/486 (5%)

Query: 34  DLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPRT 93
           DL +K   +K+   ++H N++I+DK+ ++IKTDELS+ + KT+KDKANRATVENVLDPRT
Sbjct: 3   DLSDKFRNVKV--STDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRT 60

Query: 94  MRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQH----KVIRQSSICSD-- 147
           MRFL +L++RG+I   NGCLSTGKEANVYHAF  +    E+Q     + I  ++I S   
Sbjct: 61  MRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGN 120

Query: 148 ---SEGDTKKVE---------YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI 195
              SE   K  E         YAIKIYKTSIL+FKDRERYVDGEFRFRNSRSQHNPRKMI
Sbjct: 121 IDISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMI 180

Query: 196 KIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEI 255
           KIWAEKEFRNLKRIY  GVI  P+PIE+K+NVLVMEFLNRGDGFASPKL+DYPY DR+EI
Sbjct: 181 KIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEI 240

Query: 256 YYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMD 315
           YY+YH++V+Y+RLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMSLDFLRMD
Sbjct: 241 YYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMD 300

Query: 316 IKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDE 375
           IKN+N YF K+GI +F E+AIFQFVI++ L+KF GD  SY+ L+KY +  +P+K T+EDE
Sbjct: 301 IKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDE 360

Query: 376 VEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDS 435
            EDE+FRSLHLVRNL GLEE DFDRFT+GKFDLLKSL++QDN+   K + A++  +++  
Sbjct: 361 AEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNK---KNYIAAQASKIN-- 415

Query: 436 GTDSVDHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTREHRIKEPKGKKYEDKDTR 495
             DS D                                  + E   KE KGKKYEDKD +
Sbjct: 416 -VDSSDEN--ISDSEDEGSDDGSDDDTDGSDEEEQYSEAESYEEVPKELKGKKYEDKDLK 472

Query: 496 KLRKQD 501
           K RKQ+
Sbjct: 473 KQRKQE 478

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/405 (69%), Positives = 333/405 (82%), Gaps = 14/405 (3%)

Query: 33  MDLENKLGRLKLLDHSE----HENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENV 88
           M L++++  L+L D+ E    H N++ILDK A+ IK DELSV+RGKTSKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 89  LDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGN-AVDIVEKQHKVIRQSSICSD 147
           LDPRTMRFL++L  RG+I++FNGC+STGKEANVYHAF        E+  +V+        
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLE---- 116

Query: 148 SEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 207
                ++ E AIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK
Sbjct: 117 -----ERRELAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLK 171

Query: 208 RIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIR 267
           RIY +G++  P+P+E++SNVLVMEFL+RG+GFASP+LKDYPY DR+E  ++Y+ MVAYIR
Sbjct: 172 RIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIR 231

Query: 268 LLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIG 327
           LLYQ CQLVHADLSEYN+IVH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N YF ++ 
Sbjct: 232 LLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMS 291

Query: 328 INVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLV 387
           ++VF ER IFQFVISE L+KF GDY S   L+ Y S+ LP+K   +DE EDE+FRSLHLV
Sbjct: 292 VDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLV 351

Query: 388 RNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFEL 432
           RNLGGLEE DFDRFT GKFDLLKSL++ DN++VA TFTASEQFEL
Sbjct: 352 RNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFTASEQFEL 396

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/415 (67%), Positives = 338/415 (81%), Gaps = 18/415 (4%)

Query: 33  MDLENKLGRLKL---LDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVL 89
           M +E+K   LK+      S+H N++ILDK+ ++IKT+E S++RGKT+KDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 90  DPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-------GNAVDIVEKQHKVIRQS 142
           DPRTM+FL++L+ RG+I+ F+GCLSTGKEANVYHAF       G    +V+++  V    
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 143 SICS-----DSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKI 197
           S  S     D     ++ EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPRKMIKI
Sbjct: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180

Query: 198 WAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYY 257
           WAEKEFRNLKRIY + VI  PKPIEIK+NVLVMEFLNRGDGFASP+LKD+PY DR+EI++
Sbjct: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240

Query: 258 FYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIK 317
           +YH +VAYIRLLYQVC LVHADLSEYN++VH+ +LY+IDVSQSV+PEHPMSLDFLRMDIK
Sbjct: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300

Query: 318 NINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVE 377
           N+N YF K+GI++F ER IFQFVISE L+KF GDY+S D L+ Y  + LP+K T +DE E
Sbjct: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360

Query: 378 DEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFEL 432
           DEIFRSL+LVRNL GLEE DFDR+T G+FDLLKSL++ DN+   K F ASEQ+EL
Sbjct: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNE---KNFAASEQYEL 412

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/503 (57%), Positives = 358/503 (71%), Gaps = 57/503 (11%)

Query: 33  MDLENKLGRLKLLDH--SEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLD 90
           M LE+K  RL + +   +EH N++ILDK+ ++ KTDE+S TR KT+KDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 91  PRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNA----VDIV-------------- 132
           PRTMRFL++L  RG+I++FNGCLSTGKEANVYHAF        D+V              
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 133 --------------EKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDG 178
                         EK    +R   +   S+    K EYA+KI+KTSILVFKDRERYVDG
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQD---KKEYAVKIFKTSILVFKDRERYVDG 177

Query: 179 EFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDG 238
           EFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIY +GVI  PKPIE+K+NVLVMEFL RGDG
Sbjct: 178 EFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDG 237

Query: 239 FASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVS 298
           FASP+LKD+PY DR+EI+++YH +VAY+RL+YQ+C+LVHADLSEYN ++H+ K+YIIDVS
Sbjct: 238 FASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVS 297

Query: 299 QSVQPEHPMSLDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHL 358
           QSV+PEHPMSLDFLRMDIKNIN YF K+GI++F ER IFQF+IS+ LE F GDYR Y+ L
Sbjct: 298 QSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDL 357

Query: 359 QKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQ 418
           + Y ++ LP+K +E+DE EDEIFRSL+LVRNL GLEE DFDR+T+GKFDLLKSL++ DN+
Sbjct: 358 RDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNE 417

Query: 419 KVAKTFTASEQFELSDSGTDSVDHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRE 478
              K F+A+EQF+L      +                                      E
Sbjct: 418 ---KNFSAAEQFDLKAQDATTD-----------------EEDEISEEDFDGEDDDDEGYE 457

Query: 479 HRIKEPKGKKYEDKDTRKLRKQD 501
              K  KGK+YEDKD +KLRKQ+
Sbjct: 458 SEEKVLKGKRYEDKDAKKLRKQE 480

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/422 (66%), Positives = 343/422 (81%), Gaps = 24/422 (5%)

Query: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92
           M LE K  +LK+ + SEH NS+IL+K+ ++IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 1   MSLEGKFDKLKVHE-SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59

Query: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-------GNAV---------DIVEKQ- 135
           TM+ L++LI+RG+I EFNGCLSTGKEANVYHAF       GNA          D++ K+ 
Sbjct: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKEL 119

Query: 136 -HKVIRQSSICSDSEGDT--KKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPR 192
               I   +I S+ E     ++ EYAIKIYKTSILVFKDRERYVDGEFRFRN+RSQHNPR
Sbjct: 120 IPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 179

Query: 193 KMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDR 252
           KMIKIWAEKEFRNL+RI+ +G+I  P+P+E+K N+LVMEFL RGDGFASP+L+D+ Y  R
Sbjct: 180 KMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTR 239

Query: 253 QEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFL 312
           +EI Y+YH +VAYIRLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMSLDFL
Sbjct: 240 EEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFL 299

Query: 313 RMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTE 372
           RMDIKN+N YF K+GI++F ER IFQFVIS +L+KF GD RS   L+ Y + YLP+K T+
Sbjct: 300 RMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTD 359

Query: 373 EDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFEL 432
           EDE++DEIFRSLHLVRNL GLEE DFDRFT+GKFDLLK+L++ DNQ   K FTAS QF+ 
Sbjct: 360 EDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQ---KNFTASTQFDF 416

Query: 433 SD 434
           ++
Sbjct: 417 NN 418

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/388 (71%), Positives = 323/388 (83%), Gaps = 14/388 (3%)

Query: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92
           M LE++  RL +    EH N +ILDK +N IKTDELS TR K+SKDKANRATVENVLDPR
Sbjct: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60

Query: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVEKQHKVIRQSSICSDSEGD 151
           TMRFL+S+++RG+I+EFNGCLSTGKEANVYHAF G +++  +  H            +G+
Sbjct: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGH-----------VQGE 109

Query: 152 TKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYH 211
            K  E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI  
Sbjct: 110 KK--ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQ 167

Query: 212 TGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQ 271
           +GVI  PKP+E+K+NVLVMEFL+RGDGFASP+LKD+ ++DR EIY++YH M+AYIRLLYQ
Sbjct: 168 SGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQ 227

Query: 272 VCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVF 331
           VC+LVHADLSEYN+IVH+ KLYIIDVSQSV+PEHPMSLDFLRMDIKNINAYF K+GI++F
Sbjct: 228 VCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIF 287

Query: 332 SERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLG 391
            ER IFQFVISE LEKF G+ +S   L  Y S+ LP+K T  D  EDEIFRSLHLVRNL 
Sbjct: 288 PERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLE 347

Query: 392 GLEEGDFDRFTNGKFDLLKSLVSQDNQK 419
           GLEE DFDRFT+GKFDLLKSL++ DN++
Sbjct: 348 GLEERDFDRFTDGKFDLLKSLIAHDNER 375

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/413 (66%), Positives = 333/413 (80%), Gaps = 15/413 (3%)

Query: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92
           M L++   +L L   + H+N+RILDK  ++IKTDE S++RGKT+KDKANRATVENVLDPR
Sbjct: 1   MVLDDDFQKLDL--SNNHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDPR 58

Query: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVDIVE-KQHK-----VIRQSSIC 145
           TMRFL++L  RGII++FNGC+STGKEANVYHAF G+ +   E K H      V       
Sbjct: 59  TMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYDPYS 118

Query: 146 SDSEGDT---KKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKE 202
           + +  DT    + EYAIKIYKTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEKE
Sbjct: 119 NPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKE 178

Query: 203 FRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVM 262
           FRNLKRIY + VI  PKPIE+K+NVLVMEFLNRGDGFASP+LKDYPY D  +I ++YH M
Sbjct: 179 FRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYYHTM 238

Query: 263 VAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAY 322
           + YIRLLYQVC+LVHADLSEYN++VH++KLY+IDVSQSV+PEHPMSLDFLRMDIKNIN Y
Sbjct: 239 IVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNINNY 298

Query: 323 FVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFR 382
           F ++G+ +F+ER IFQF ISE L+ F G+Y + D L+ Y    LPLK+  +D+ EDEIFR
Sbjct: 299 FERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDEIFR 358

Query: 383 SLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDS 435
           SLHLVRNLGGLEE DFDR+T+GKFDLLKSL++ DN+   K F+ASEQ+   D+
Sbjct: 359 SLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNE---KNFSASEQYNFEDN 408

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/482 (59%), Positives = 347/482 (71%), Gaps = 28/482 (5%)

Query: 33  MDLENKLGRLKLLDHSEHE--NSRILDKFANQIKTDELSVTR-GKTSKDKANRATVENVL 89
           M +E K  +L +  H + +  N+++LDK+A++IK D+ S ++  KT+KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 90  DPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF---------GNAVDIVEKQHKVIR 140
           DPRTMRFL++L++RGII++FNGCLSTGKEANVYHAF         G   D      ++ +
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 141 QSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 200
           +      S G  K  EYAIKI+KTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE
Sbjct: 121 EERAVQASVGGKK--EYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178

Query: 201 KEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYH 260
           KEFRNLKRIY +G +  PKP+E+K+NVLVMEFLNRGDGFASP+L+DYPY D   I  +Y 
Sbjct: 179 KEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238

Query: 261 VMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNIN 320
            +VAY+RL+YQVC LVHADLSEYN +VH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N
Sbjct: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298

Query: 321 AYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEI 380
            YF K+GI++F ER IFQFVISE L+KF+GDY+S   L +Y    LP+K TE+DE+EDE+
Sbjct: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358

Query: 381 FRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASE-QFELSDSGTDS 439
           FRSL+LVRNL GLEE DFDRFT GKFDLLKSL++ D   + K FTA+E QFE  D    S
Sbjct: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHD---MEKNFTAAEQQFEFDDENDSS 415

Query: 440 VDHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTREHRIKEPKGKKYEDKDTRKLRK 499
                                               T +   K  KGKKYEDKD +KLRK
Sbjct: 416 S----------GSQDDDGEDEDEEESDGEDEEDVYYTTDDEDKVLKGKKYEDKDAKKLRK 465

Query: 500 QD 501
           Q+
Sbjct: 466 QE 467

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/389 (65%), Positives = 314/389 (80%), Gaps = 20/389 (5%)

Query: 68  LSVTRGKTSKDKANRATVENVLDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFG- 126
           +S T+GKT+KDKANRATVENVLDPRTM+FL++L  RG+I++FNGCLSTGKEANVYHAF  
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 127 ---------------NAVDIVEKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKD 171
                          N +D    + K+  Q +   ++     K EYA+KI+KTSILVFKD
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQIN-PEETRLQKDKKEYAVKIFKTSILVFKD 119

Query: 172 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVME 231
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIY + VI  PKPIE+K+NVL+ME
Sbjct: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179

Query: 232 FLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESK 291
           FLNRGDGFASP+L+DYPY DR+E+ ++YH+ +AY+RL+YQVC+LVHADLSEYN ++H + 
Sbjct: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239

Query: 292 LYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGD 351
           +YIIDVSQSV+PEHPMSLDFLRMDIKNIN YF ++GI++F ER IFQF+ISE L+KF G+
Sbjct: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299

Query: 352 YRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKS 411
           Y  Y+ L+ Y ++ LP+K T +DE EDEIFRSL+LVRNL GLEE DFDR+T+GKFDLLKS
Sbjct: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359

Query: 412 LVSQDNQKVAKTFTASEQFELSDSGTDSV 440
           L++ DN+   K F+A+EQFE+ D   + V
Sbjct: 360 LIAHDNE---KNFSAAEQFEIQDDDEEIV 385

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  505 bits (1300), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 248/388 (63%), Positives = 304/388 (78%), Gaps = 28/388 (7%)

Query: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRG-KTSKDKANRATVENVLDP 91
           M LE +  RL +  H   +N+RIL+K+ N+I+    +  +G KT KDK++RATVENVLDP
Sbjct: 1   MSLETEFDRLHVSKH--QDNTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLDP 58

Query: 92  RTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGD 151
           RTM+FL +L +RG+I+EFNGC+S+GKEANVYHAFG                      EG 
Sbjct: 59  RTMKFLSALTNRGVISEFNGCISSGKEANVYHAFG---------------------PEGQ 97

Query: 152 TKKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYH 211
               E AIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+ 
Sbjct: 98  ----ELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHS 153

Query: 212 TGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQ 271
           +GV+    P+E+KSNVLVM+FLNRGDG  SP+LKDY Y D  E+ ++Y+  +AY+RLLYQ
Sbjct: 154 SGVVPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQ 213

Query: 272 VCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVF 331
           VC+LVHADLSEYN +VH++ L+IIDVSQSV+P HPMSLDFLRMDIKNINAYF K+G+++F
Sbjct: 214 VCRLVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLF 273

Query: 332 SERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLG 391
            ER IFQF+I+E LE F+GDY++ D L +Y  E+LPLK   E   EDEIFRSLHLVR+LG
Sbjct: 274 QERMIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLG 333

Query: 392 GLEEGDFDRFTNGKFDLLKSLVSQDNQK 419
           GLEE DFDRFT+GKFDLLKSL++ DN++
Sbjct: 334 GLEERDFDRFTDGKFDLLKSLIANDNER 361

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 101/238 (42%), Gaps = 47/238 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           LR+L+++ ++      +  GKE+++Y                       SD  G T KV 
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQV---------------------SDRNG-TAKVM 122

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    K+   Y+      RNSR   N   + K+ A KEF  +  +Y  G I 
Sbjct: 123 KIHRLGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI- 175

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            P+      +V+VM+ +   DG+   +L+++     + I   Y  ++ +I  L     L+
Sbjct: 176 VPQAYGCSRHVVVMDLI---DGYPMRRLREH-----KNIPKLYSDLMTFIVKLAN-SGLI 226

Query: 277 HADLSEYNSIV---------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++          +    +ID  Q +  +H  +  + + D+  I  +F K
Sbjct: 227 HCDFNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 102/236 (43%), Gaps = 45/236 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           L+SL+++  +    G +  GKE+++Y                       SD  G+ K+V 
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG---------------------SDKNGN-KRVL 122

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    K+   Y+      R S    N   + K+ A KE++ +  +Y  G   
Sbjct: 123 KIHRLGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FK 175

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            P+P +   +V+VME +    G+   +L+ +     ++I   Y  ++ +I  L     L+
Sbjct: 176 VPEPFDNSRHVIVMELIR---GYPMRRLRKH-----KDIPKLYSDLMKFILQLAN-SGLI 226

Query: 277 HADLSEYNSIV-------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++       ++    +ID  Q +  +H  +  + + D+  I  +F K
Sbjct: 227 HCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 103/236 (43%), Gaps = 45/236 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           L+++++R  I    G +  GKE+++Y    +AVD   +  K+ R                
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQV--SAVDGNPRVMKIHR---------------- 126

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
               + +TS    ++   Y+      RN++   N   + ++ A KE++ +  +Y  G   
Sbjct: 127 ----LGRTSFHTVRNNRDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FE 175

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            P+P +   +++VME +    G+   +L+ +     + I   Y  ++ +I  L     L+
Sbjct: 176 VPEPFDNSRHIIVMELIK---GYPMRRLRKH-----KNIPKLYSDLMNFIVKLGN-SGLI 226

Query: 277 HADLSEYNSIV-------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++       ++    +ID  Q +  +H  +  + + D+  I  +F K
Sbjct: 227 HCDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 104/236 (44%), Gaps = 44/236 (18%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           L+++++R  +    G +  GKE+++Y                       SD  G T+KV 
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYRV---------------------SDRNG-TEKVM 122

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    K++  Y+      +N+++  N   + KI A KE++ +  ++  G   
Sbjct: 123 KIHRLGRTSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FD 176

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            P+  +   + +VME +    G+   +L+ +     + I   Y  ++++I  L     L+
Sbjct: 177 VPEAFDCSRHCIVMELIK---GYPMRRLRKH-----KNIPKLYSDLMSFIVKLGN-SGLI 227

Query: 277 HADLSEYNSIV-------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++       ++    +ID  Q +  +H  +  + + D+  I  +F K
Sbjct: 228 HCDFNEFNIMIKDKVEDENDPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/237 (19%), Positives = 102/237 (43%), Gaps = 46/237 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFG-NAVDIVEKQHKVIRQSSICSDSEGDTKKV 155
           L+++++R  +    G +  GKE+++Y     N V  V K H++ R               
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQVSDKNGVSKVMKIHRLGR--------------- 129

Query: 156 EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVI 215
                   TS    ++   Y+      +N ++  N   + ++ A KE++ +  +Y  G  
Sbjct: 130 --------TSFHTVRNNRDYLK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-F 175

Query: 216 SCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQL 275
             P+P +   ++++M  +   +G+   +L+ +       I   Y+ ++ +I  L     L
Sbjct: 176 EVPEPFDNSRHIIIMGLI---EGYPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGL 226

Query: 276 VHADLSEYNSIV-------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           +H D +E+N ++       ++    +ID  Q +  +HP +  + + D+  I  +F K
Sbjct: 227 IHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 99/236 (41%), Gaps = 45/236 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           L+++++R  +      +  GKE+++Y                       SD  G   +V 
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV---------------------SDKNG-KPRVM 122

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    ++   Y+      RNS    N   + ++ A KE++ +  +Y  G   
Sbjct: 123 KIHRLGRTSFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FK 175

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            P+P +   +++VME +   +G+   +L+ +     + I   Y  ++ +I  L     L+
Sbjct: 176 VPEPFDNSRHIVVMELI---EGYPMRRLRKH-----KNIPKLYSDLMCFIVELAN-SGLI 226

Query: 277 HADLSEYNSIV-------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++        +    +ID  Q V  +H  +  + + D+  I  +F K
Sbjct: 227 HCDFNEFNIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/275 (18%), Positives = 122/275 (44%), Gaps = 37/275 (13%)

Query: 63  IKTDELSVTRGKTSKDKANRATVENVLDPRTMRFLRSLIHRGIITEFNGCLSTGKEA--- 119
           + T  +    G  S+   NR ++ ++     +  +R++ + G    +NG    G +A   
Sbjct: 32  VPTPMIHQISGMRSQSGTNR-SIGDLAKLNLVSRMRNIKYDGFRLTYNGFDYLGLKAMLN 90

Query: 120 -NVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDG 178
            +  ++ GN +  V K+  V R S+     +  T +V    ++ +TS    K+   Y+  
Sbjct: 91  RDTVYSIGNVIG-VGKESDVYRVSA-----KDGTPRVLKIHRLGRTSFTTVKNNRDYL-- 142

Query: 179 EFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGD 237
                  R+Q      + ++ A KE++ +  +Y  G +  P+P +   ++++M+ +   D
Sbjct: 143 ------KRNQSGSWMFLSRLAANKEYQFMSLLYSKGFV-VPEPFDNSRHMILMQLI---D 192

Query: 238 GFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVH-------ES 290
           G+   +++ +     + +   Y  ++++I  L     L+H D +E+N ++        + 
Sbjct: 193 GYPMRRMRSH-----KNLPKLYSDLMSFIVKLAN-HGLIHCDFNEFNIMIKNKVTDADDC 246

Query: 291 KLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
              +ID  Q +  +H  + ++ + D+  I  +F K
Sbjct: 247 GFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK 281

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/236 (18%), Positives = 101/236 (42%), Gaps = 45/236 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           L+++++R  +      +  GKE+++Y                       SD  G+ + ++
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV---------------------SDKNGNPRVMK 123

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    ++   Y+      + S    N   + ++ A KE++ +  +Y  G   
Sbjct: 124 IH-RLGRTSFHSVRNNRDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FK 175

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            P+P +   +++VME +   +G+   +L+ +     + I   Y  ++ +I  L     L+
Sbjct: 176 VPEPFDNSRHIVVMELI---EGYPMRRLRKH-----KNIPKLYSDLMCFIVDLAN-SGLI 226

Query: 277 HADLSEYNSIV-------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++       ++    +ID  Q +  +H  +  + + D+  I  +F K
Sbjct: 227 HCDFNEFNIMIKDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 98/236 (41%), Gaps = 45/236 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           L+SL+++  +      +  GKE+++Y A                     SD  G+  +V 
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA---------------------SDRNGE-HRVM 122

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    K+   Y+      +      +   + ++ A KE++ +  +Y  G  +
Sbjct: 123 KIHRLGRTSFHTVKNNRDYL------KKYNQGASWMFLSRVAANKEYQFMSLLYSKG-FT 175

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            PK  +   +++VME +    GF   +L+ +       I   Y  ++ +I  L     L+
Sbjct: 176 VPKAFDNSRHIVVMELIK---GFPLRRLRKH-----DNIPKLYSDLMCFIVNLAN-SGLI 226

Query: 277 HADLSEYNSIVHESK-------LYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++ + K         +ID  Q +  +H  +  + + D+  I  +F K
Sbjct: 227 HCDFNEFNIMIKDEKDDENDCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKK 282

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 100/242 (41%), Gaps = 58/242 (23%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           LR+++ R  I      +  GKE++VY    +A D   +  K+ R                
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRV--SAKDGSARVLKIHR---------------- 126

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAEKEFRNLKRIYHTGVI 215
               + +TS    K+   Y+         R+Q      + ++ A KE++ +  ++  G  
Sbjct: 127 ----LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAANKEYQFMSLLHSKG-F 173

Query: 216 SCPKPIEIKSNVLVMEFLNRGDGFASPKL---KDYP--YSDRQEIYYFYHVMVAYIRLLY 270
           + P+P +   ++++ME +   DG+    +   K+ P  YSD         +M+  ++L  
Sbjct: 174 TVPEPFDNSRHMILMELI---DGYPMRNMRLHKNLPKLYSD---------LMLFIVKLAN 221

Query: 271 QVCQLVHADLSEYNSIVHES-------KLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYF 323
               L+H D +E+N ++  S          +ID  Q +  +H  +  F + D+  I  +F
Sbjct: 222 H--GLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFF 279

Query: 324 VK 325
            K
Sbjct: 280 KK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 45/237 (18%), Positives = 99/237 (41%), Gaps = 46/237 (19%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           ++++++R  +      +  GKE+++Y                       SD  G+ + ++
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYKV---------------------SDRNGNAQVMK 123

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    ++   Y+      ++SR   +   +  + A KE+  L  ++  G   
Sbjct: 124 IH-RLGRTSFTSVRNNRDYL------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQ 175

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            P+  +   ++++MEF+    GF    L+ +       I   Y  ++ +   L +   L+
Sbjct: 176 VPEAFDNSRHMVLMEFIK---GFPMKNLRTH-----SNIPKLYSDLMKFAVDLAK-SGLI 226

Query: 277 HADLSEYNSIV--------HESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVK 325
           H D +E+N ++         +    +ID  Q +  +HP +  F R DI+ I  +F K
Sbjct: 227 HCDYNEFNIMIKDQDTTDSSDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>TDEL0B03420 Chr2 complement(609095..610564) [1470 bp, 489 aa] {ON}
           Anc_8.768 YOR298W
          Length = 489

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 106/258 (41%), Gaps = 50/258 (19%)

Query: 2   NEMSQLNLTYIHTNNLIHHNRIYDLEQIRLDMDLENKLGRLKLLDHSEHENSRILDKFAN 61
           NE+    L +I    +++   +  ++ I L MD    +   K+ +H     +++L  F  
Sbjct: 194 NEIPIPRLNFITWGKIVNFPHLSLMKNI-LMMDENAFVPPTKIKNHLTRTGNQVLTIFPE 252

Query: 62  -QIKTDELSVTRGKTSKDKANRATVENVLDPRTMRFLRSL-----IHRGIITEFNGCLST 115
             I T ELS+ + K ++D    A   NVL PR   F+ ++     I    + E NG LS 
Sbjct: 253 VNIMTTELSIVQRKLNQDYPFVAKFYNVLYPRFKTFISTIKCFAYIKHVKLKEQNGLLS- 311

Query: 116 GKEANVYHAFGNAVD--IVEKQHKVIR-----QSSICSD------------SEGDTKKVE 156
               N  H   N VD  I++ Q K        Q+S+  D            + GD ++ E
Sbjct: 312 ----NARHLLTNGVDKIILKAQSKHTNEEENAQASMIVDLPNFYETAEMTIASGDVEEPE 367

Query: 157 -------YAIKIYKTSILVFKDR-----ERYVDGEFRFRNSRS--QHNPRKMIKIWAEKE 202
                   +  +Y  +++ +K R       +++G+F   +     Q NP     +  EK+
Sbjct: 368 QIKEPVVISQDLYDLTMIYYKPRYTNVGHDHINGQFTLHDGYQLEQVNPSIFEMLKPEKD 427

Query: 203 FRNLKRIYHTGVISCPKP 220
           F++    Y     +C KP
Sbjct: 428 FKSRDDNY-----TCSKP 440

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 161 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 209
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44
           YNL207W
          Length = 444

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 85/193 (44%), Gaps = 35/193 (18%)

Query: 97  LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVE 156
           + SL+    I      +  GKE+++Y                       SD  G+T+ ++
Sbjct: 85  MNSLLLHDTIYSIGHMIGIGKESDIYKV---------------------SDKSGNTRVMK 123

Query: 157 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVIS 216
              ++ +TS    K+   Y+      +NS+   N   +  + A KE++ +  +Y +    
Sbjct: 124 IH-RLGRTSFQTVKNNRDYLK-----KNSKIGTNWMVLSGLAALKEYQFMSILY-SNDFK 176

Query: 217 CPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLV 276
            PKP +   ++++ME +   +G+   +L+     ++ ++   Y+ ++ +I  L     L+
Sbjct: 177 VPKPFDNSRHIIIMELI---EGYPMRRLRS---KNQLKLAKLYNELMCFIVKLAD-HGLI 229

Query: 277 HADLSEYNSIVHE 289
           H D +E+N ++ E
Sbjct: 230 HCDFNEFNIMIKE 242

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 166 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVI 215
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ + VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>KLTH0G16588g Chr7 complement(1437552..1445048) [7497 bp, 2498 aa]
            {ON} similar to uniprot|P35194 Saccharomyces cerevisiae
            YBL004W UTP20 Possible snoRNA-binding protein based on
            computational analysis of large-scale protein- protein
            interaction data
          Length = 2498

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 91/214 (42%), Gaps = 40/214 (18%)

Query: 97   LRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIV----------EKQHKVIRQSSICS 146
            L SL+    + E  G L   K   V       VD++          E + K    SS+  
Sbjct: 1179 LVSLVASTCLRELPGLLKNAKSQEVVSI---TVDLLLNLVEAGYVDEDETKKYLLSSLAH 1235

Query: 147  DSEGDTKKVEYA--IKIYKT-SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEF 203
              EG+ K V+ A  +K+ ++ + L+      + + E  +R+        K+ +++AEK  
Sbjct: 1236 ILEGEVKGVQTADKVKVLQSIASLIIGYNCEWTEIEHLYRSCS------KLYRVFAEKSL 1289

Query: 204  R-NLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVM 262
            R +L +++          I I +     E L++  G  S +L  Y  +DR E Y F  V+
Sbjct: 1290 RLSLNKVF----------ISIGTQ---FEHLSKVAGLLS-ELNAYS-TDRMESYNFKSVL 1334

Query: 263  VAYIRLLYQVCQLVHADLSEYNSIVHESKLYIID 296
             A+ ++    CQL   D  E+  ++H    +I D
Sbjct: 1335 PAFKKIADGSCQLT--DELEWLPVIHTCLYFITD 1366

>KLTH0F10824g Chr6 (923729..925018) [1290 bp, 429 aa] {ON} weakly
           similar to uniprot|P18634 Saccharomyces cerevisiae
           YLR392C Hypothetical ORF
          Length = 429

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 16/107 (14%)

Query: 288 HESKLYIIDVSQSVQPEHPMSLDFL--RMDIKNINAYFVKIG-INVFSERAIFQFVISEK 344
           H+ KL+   +     P+ P S + L    D+ N+NAYF  +G I  F E  +F    +  
Sbjct: 129 HQRKLFTY-LKGRTNPKLPPSFNNLLSSKDVLNLNAYFYSLGCIEYFVEATVF----TGG 183

Query: 345 LEKFKGDYRSYDHLQK--------YASEYLPLKLTEEDEVEDEIFRS 383
            E +   +RSY  L++         A E+L   L E      ++FRS
Sbjct: 184 DEMWFKPFRSYPALKRTFEFIPSNVAQEHLEDALRENPNTPPQVFRS 230

>TPHA0B04280 Chr2 complement(1000206..1002758) [2553 bp, 850 aa]
           {ON} Anc_1.104 YNL256W
          Length = 850

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 121 VYHAFGNAVDIVEKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKDRERYVDGEF 180
           VY AFG+ V  V     ++    I S ++  T  V     +++++ + F D+ ++++G  
Sbjct: 320 VYLAFGSNVGDVFSN--IVEALKILSSTKDVT--VSKVSSLFQSNPMYFGDQRKFINGVL 375

Query: 181 RFRNSRSQHNPRKMIKIWAEKEFRNLKRIYH 211
             +   ++ NP +++++  + E+ +LKR+ H
Sbjct: 376 EVK---TKLNPDEVLQLCKKIEYEDLKRVKH 403

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,750,885
Number of extensions: 2363415
Number of successful extensions: 7617
Number of sequences better than 10.0: 57
Number of HSP's gapped: 7809
Number of HSP's successfully gapped: 74
Length of query: 538
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 424
Effective length of database: 40,409,475
Effective search space: 17133617400
Effective search space used: 17133617400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)