Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47625.433ON22122111651e-164
AER256C5.433ON2392246423e-84
SAKL0G02508g5.433ON2282225553e-71
KLLA0E21099g5.433ON2242225205e-66
CAGL0A02794g5.433ON2162245031e-63
Suva_2.5395.433ON2272224972e-62
Smik_4.6335.433ON2212224962e-62
KNAG0C049205.433ON2172194934e-62
KAFR0E039305.433ON2112204849e-61
YDR367W (KEI1)5.433ON2212254832e-60
NCAS0F033705.433ON2112184743e-59
TPHA0E017705.433ON2172204744e-59
Skud_4.6365.433ON2342254502e-55
Kpol_1062.305.433ON2142194301e-52
TDEL0E019205.433ON2202194153e-50
Kwal_55.214325.433ON2072194022e-48
TBLA0A065205.433ON2062193943e-47
ZYRO0F10010g5.433ON2082193943e-47
KLTH0F16082g5.433ON2062123743e-44
TBLA0G020105.433ON2131983692e-43
NDAI0B056605.433ON1611753086e-35
KLLA0A00132gsingletonON507127740.44
KLLA0D20009gsingletonON507127740.46
KLLA0E00133gsingletonON507127740.46
KLLA0C00132gsingletonON507127740.46
KLLA0B00143gsingletonON507127740.46
KLLA0F00154gsingletonON507127740.46
KLLA0D00143gsingletonON507127740.46
NDAI0D015401.527ON129385683.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4762
         (221 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   453   e-164
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   251   3e-84
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   218   3e-71
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   204   5e-66
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   198   1e-63
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   196   2e-62
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   195   2e-62
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   194   4e-62
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   191   9e-61
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   190   2e-60
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   187   3e-59
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   187   4e-59
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   177   2e-55
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   170   1e-52
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   164   3e-50
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   159   2e-48
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   156   3e-47
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   156   3e-47
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   148   3e-44
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   146   2e-43
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   123   6e-35
KLLA0A00132g Chr1 (4628..6151) [1524 bp, 507 aa] {ON} similar to...    33   0.44 
KLLA0D20009g Chr4 complement(1709412..1710935) [1524 bp, 507 aa]...    33   0.46 
KLLA0E00133g Chr5 (4528..6051) [1524 bp, 507 aa] {ON} similar to...    33   0.46 
KLLA0C00132g Chr3 (4440..5963) [1524 bp, 507 aa] {ON} similar to...    33   0.46 
KLLA0B00143g Chr2 (4365..5888) [1524 bp, 507 aa] {ON} similar to...    33   0.46 
KLLA0F00154g Chr6 (4320..5843) [1524 bp, 507 aa] {ON} similar to...    33   0.46 
KLLA0D00143g Chr4 (4326..5849) [1524 bp, 507 aa] {ON} similar to...    33   0.46 
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....    31   3.6  

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  453 bits (1165), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/221 (100%), Positives = 221/221 (100%)

Query: 1   MVYLPQSFFGLPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60
           MVYLPQSFFGLPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL
Sbjct: 1   MVYLPQSFFGLPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60

Query: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGI 120
           VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGI
Sbjct: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGI 120

Query: 121 GVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMM 180
           GVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMM
Sbjct: 121 GVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMM 180

Query: 181 KQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           KQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL
Sbjct: 181 KQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  251 bits (642), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 123/224 (54%), Positives = 153/224 (68%), Gaps = 13/224 (5%)

Query: 1   MVYLPQSFFGLPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60
           M +LP+SFFGLPLYIGVELSLG+AIFNKFCGL+G+LALFTG PLD++QW FY+WSF  LL
Sbjct: 26  MNHLPKSFFGLPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLL 85

Query: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKED---TSSGSNPVSG 117
           V+  GL Q+Y+P+L  YC+VL VYS DT+L C + + FT  WF   D   T++     + 
Sbjct: 86  VYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDDAD 145

Query: 118 KGIGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVR 177
              G V V      +          QSAS  YEY+ T+  TL   +LRFYSNF+IASFV+
Sbjct: 146 ATQGSVTVENEPVSH----------QSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQ 195

Query: 178 RMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           RM + N++    DDVE DLK+ SVAYRAY   QRWCY+ CRRYL
Sbjct: 196 RMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  218 bits (555), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 144/222 (64%), Gaps = 1/222 (0%)

Query: 1   MVYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAAL 59
           MV+LP+SF G LPLYIGVEL LG++IFNKF G YGILALFTG PLD +QW FY  S   L
Sbjct: 6   MVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTL 65

Query: 60  LVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKG 119
           LV+  GL Q+ KP  +TY +VL V+++DT+L CFF + F+  WFS E+       V    
Sbjct: 66  LVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSK 125

Query: 120 IGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRM 179
           +          +    R     +QSAS  YEY+ T+L T++  A+RFY NFI+A+FV++M
Sbjct: 126 LQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQM 185

Query: 180 MKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           ++  +YI + DDVE DLKN S+  R  + +++WCY  C+R L
Sbjct: 186 LRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  204 bits (520), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 148/222 (66%), Gaps = 5/222 (2%)

Query: 1   MVYLPQSFFGLPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60
           MV+LPQ+F   PLYIGVE++LGV  FNKF G+YG+LALFTG PLD +QW FY+WS   L+
Sbjct: 7   MVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLV 66

Query: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVS-GKG 119
           VF  G+ QVYKP ++    V  V+S+DT+++C + + FT  WFS+E ++  ++  S G  
Sbjct: 67  VFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTA 126

Query: 120 IGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRM 179
           +G    G + T        VD ++SAS+ YE+   ILLTL+  A+RFY NFII +F +++
Sbjct: 127 LGPAHEGTTST----ISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQL 182

Query: 180 MKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           ++  ++  + +D+E +L N ++ ++     ++WC+Y C+RYL
Sbjct: 183 LRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  198 bits (503), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 103/224 (45%), Positives = 143/224 (63%), Gaps = 18/224 (8%)

Query: 2   VYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60
           +  P+SFFG LPLY+GVE+ LG+ I NK  G YGILALFTG PLD +QW  Y+WS   L+
Sbjct: 6   ISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLI 65

Query: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWF--SKEDTSSGSNPVSGK 118
           VF++GL  ++KPKL+ +  +L  ++ DTVL CFF + F+  WF  + E+    S PV   
Sbjct: 66  VFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPV--- 122

Query: 119 GIGVVDVGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVR 177
             GV       +QN  YRR+ D  +Q AS  YEY+ T+L TL+    R Y NFI+ASFV+
Sbjct: 123 --GV-------SQN--YRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQ 171

Query: 178 RMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
            +++  +Y+ + DDVE DLKN S   R ++ +Q++CY  CR  L
Sbjct: 172 ELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  196 bits (497), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 95/222 (42%), Positives = 134/222 (60%), Gaps = 1/222 (0%)

Query: 1   MVYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAAL 59
           +V LP+SF G +PLY+ VE+ LG++I NK  G YGILALFTG PLD +QW  Y+WS   L
Sbjct: 5   LVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTL 64

Query: 60  LVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKG 119
           +VF +GL  ++KP L+ +  +  +Y++DT+  CFF + FT  WF+ E  +S     S   
Sbjct: 65  IVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTA 124

Query: 120 IGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRM 179
              ++     T     R T    Q AS  YEYS TIL+TL+    RFY NFI+ASFV+ +
Sbjct: 125 TQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFVQEL 184

Query: 180 MKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           +   +Y+ + DDVE DLKN  +  R +  +Q+ CY  C+  L
Sbjct: 185 LHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  195 bits (496), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 95/222 (42%), Positives = 138/222 (62%), Gaps = 7/222 (3%)

Query: 1   MVYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAAL 59
           ++ LP+SF G +PLY+ VE+ LG++I NK  G+YGILALFTG PLD +QW  Y+WS   L
Sbjct: 5   LLTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTL 64

Query: 60  LVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKG 119
           ++F++GL  ++KP L+ +  +  +Y+LDT+  CFF + FT  WF+ EDT+ G    S   
Sbjct: 65  IIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQSNNS 124

Query: 120 IGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRM 179
             +       T+    R T    QSA+  YEYS TIL+TL+    RFY N I+ASFV+ +
Sbjct: 125 NLI------STERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQEL 178

Query: 180 MKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           +   +Y+ + DDVE +LKN  +  R Y  +Q+ CY  C+  L
Sbjct: 179 LHHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  194 bits (493), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 138/219 (63%), Gaps = 11/219 (5%)

Query: 4   LPQSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP++FFG+ PLYIGVE+ LGV + NK  G +GILALFTG PLDL+QW  Y+WS   L+V+
Sbjct: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
            +GL Q++KPKL+T+  ++ V+S+DTVL C F + FTG WF++E     SN  +  G   
Sbjct: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEE-----SNTDAAMG--- 119

Query: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182
                S       R    DTQ A+  YEY  TI++T++    R Y NF++ASFV+ +++ 
Sbjct: 120 --TAASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRH 177

Query: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
            +Y+ + DD+E DLKN     R +V +Q+  Y  CR  L
Sbjct: 178 PQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  191 bits (484), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 136/220 (61%), Gaps = 19/220 (8%)

Query: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP+SF G LPLY+ VE+ LG+  FNK  G +GILALFTG PL  +QW FY+WS   L VF
Sbjct: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
            +GL +++KP ++T+  +   YS+DT+  CFF + FTGDWF+ E  +  +          
Sbjct: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAA---------- 117

Query: 123 VDVGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMK 181
             VG + T     +RT D  +Q AS  YEYS TI +TL     RFY NFI+ASFV+ +++
Sbjct: 118 --VGSTIT-----KRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLR 170

Query: 182 QNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
             +Y+ + DD+E DLKN S+  R ++  Q+ CY  C+  L
Sbjct: 171 HPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  190 bits (483), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 94/225 (41%), Positives = 142/225 (63%), Gaps = 13/225 (5%)

Query: 1   MVYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAAL 59
           ++ LP+SF G +PLY+ VE+ LG++I NK  G YGILALFTG PLD +QW  Y+WS   L
Sbjct: 5   LLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTL 64

Query: 60  LVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSS--GSNPVSG 117
           +VF++GL  ++KP L+ +  +  +Y++DT+  CFF + FT  WF+ EDT++  G+N +  
Sbjct: 65  IVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNALQS 124

Query: 118 KGIGVVDVGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFV 176
             I    + + G         +D   QSA+  YEY+ TIL+TL+    RFY NFI+ASFV
Sbjct: 125 NPISTGKLTERG---------IDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFV 175

Query: 177 RRMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           + ++   +Y+ + DDVE +LKN  +  R +  +Q+ CY  C+  L
Sbjct: 176 QELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  187 bits (474), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 93/218 (42%), Positives = 128/218 (58%), Gaps = 22/218 (10%)

Query: 6   QSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTK 64
           QSFFG+ PLY+GVE+ LG+ IFNK  G YGILALFTG PLD +QW FY+WS   L++F +
Sbjct: 13  QSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQ 72

Query: 65  GLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVD 124
           GL +++KP L+T+  +L  YSLDT+  C F + FT  WF  E T                
Sbjct: 73  GLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPT---------------- 116

Query: 125 VGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQN 183
               GT+    RR    ++Q A+  YEY  TI +TL+    R Y N ++A+FV+ ++   
Sbjct: 117 ----GTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHP 172

Query: 184 RYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           +Y+ + DDVE DLKN  V  R ++  Q+W Y  C   L
Sbjct: 173 KYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  187 bits (474), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 135/220 (61%), Gaps = 22/220 (10%)

Query: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP+SFFG LPLYIGVE  LG+ IFNK  G+YGILALFTG PL  IQW  Y+WS   LL++
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
            +GL QV+ P L+TYC +L  YS DT+  CFF + F   WF+ E++++G N  S      
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFT-EESNAGDNINSST---- 131

Query: 123 VDVGKSGTQNFAYRRTVDD-TQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMK 181
                          TVD   Q AS   E+  T+ LTLI    RFY NFI+ASF +++  
Sbjct: 132 ---------------TVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFL 176

Query: 182 QNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
             +Y+ + DDVE DLKN S+  + ++ +++ CYY  +R+L
Sbjct: 177 HPKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  177 bits (450), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 89/225 (39%), Positives = 131/225 (58%), Gaps = 14/225 (6%)

Query: 6   QSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTK 64
           +SF G +PLY+ VE+ LG++I NK  G YGILALFTG PLD +QW  Y+WS   L+VF++
Sbjct: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73

Query: 65  GLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKED--------TSSGSNPVS 116
           GL  ++KP L+ +  +  +Y++DT+  CFF + FT  WF+ E+         S+    + 
Sbjct: 74  GLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTADTALR 133

Query: 117 GKGIGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFV 176
             G+  +  GK        R      QSA+ +YEYS TI +TL     RFY N I+ SFV
Sbjct: 134 TNGLSPIMAGK-----LTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFV 188

Query: 177 RRMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           + ++   +Y+ + DDVE DLKN  +  R +  +Q+ CY  C+  L
Sbjct: 189 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  170 bits (430), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 131/219 (59%), Gaps = 23/219 (10%)

Query: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP+SFFG LPLYIGVE  LG+ I NK  G YGILALFTG PL++ QW  Y+WS   L+++
Sbjct: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
           ++GL QV+ P L+TY  +  V+S DT L C F ++F+  WF+  +T SG +     G GV
Sbjct: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFT--ETGSGMS----DGSGV 130

Query: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182
            + G                Q AS  YEY+ TIL+T++    R Y NFI+A+F + +   
Sbjct: 131 DEYG----------------QGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLH 174

Query: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
            +Y+ + DDVE DLKN +   + ++ +++ CY   R  L
Sbjct: 175 PKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  164 bits (415), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 128/219 (58%), Gaps = 11/219 (5%)

Query: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP+SF G +PLYIGVE++LG++I NK  G YGILALFTG PLD +QW  Y+WS   L++ 
Sbjct: 11  LPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFTLIIC 70

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
            +GL Q++KP ++T+  +   + +DT+   FF + FT  W++ E     SN V       
Sbjct: 71  VQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLE---GNSNNVKDTKSSY 127

Query: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182
            D     +   A+       Q AS  +EY  T+ +T++  A + Y  FIIASFV+ ++  
Sbjct: 128 SDAPVDYSSKIAH-------QGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLH 180

Query: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
            RY+ + DDVE DLK+ S   R ++ +Q+ CY   +  L
Sbjct: 181 PRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  159 bits (402), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 126/219 (57%), Gaps = 25/219 (11%)

Query: 15  IGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTKGLSQVYKPKL 74
           +GVE+ LG+ + NK  G YGIL L TG  LD +QW  Y+ S   ++V++ GLS +YKP +
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 75  MTYCMVLTVYSLDTVLACFFAVLFTGDWFSKED------------TSSGSNPVSGKGIGV 122
           ++Y ++L  ++ DT++ CFF + F+G WFS ++            +S+G+N  SG  I  
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLI-- 118

Query: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182
                      + R     +QSAS   EY  TIL+T+   A RFY NFII +FV+R+++ 
Sbjct: 119 -----------SKRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRH 167

Query: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
            +Y+ + DDVE DLK+     R ++  +   Y  CRRYL
Sbjct: 168 PKYVVDQDDVEQDLKHRGFLRRWWIRAETHSYKICRRYL 206

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  156 bits (394), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 123/219 (56%), Gaps = 29/219 (13%)

Query: 4   LPQSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP+ F G+ PLY+GVEL LG+ IFNK  G YGILALF G PL+  QW  Y WS   L ++
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
            +GL++V++P L T+  V   +S+DT+L C F V FT +WF+   T   + P + +G   
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT---TRPPAAQG--- 128

Query: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182
                                 AS  YEYS ++L+TL     R Y NFI+ SF++ +  +
Sbjct: 129 ----------------------ASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFR 166

Query: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
             Y  + D+VE +L+++S+  R ++  Q +CY   RR L
Sbjct: 167 PAYTLDTDEVETELRHSSLLRRLWLQNQHYCYILSRRIL 205

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  156 bits (394), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 121/219 (55%), Gaps = 19/219 (8%)

Query: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP+ F G LPLYIGVE++LGV I NK  GL+GILALFTG PL+ +QW  Y+WS  + +V+
Sbjct: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
            +GL    KP L+ +  +   +S+DT L C F + FT  W++ ED +     ++   +  
Sbjct: 67  AQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAAAAMQ- 125

Query: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182
                            +  Q AS  +E+  TI +TL     R Y NF++ASFV+ +++ 
Sbjct: 126 -----------------EPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQH 168

Query: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
            RY+ +  DVE +L+   V  R +  TQ  C  + ++ L
Sbjct: 169 PRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  148 bits (374), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 125/212 (58%), Gaps = 12/212 (5%)

Query: 15  IGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVFTKGLSQVYKPKL 74
           +GVE+ LG+ I NK  G YGIL L TG  LD +QW  Y+ S   L+V++ GL+ VYKPKL
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 75  MTYCMVLTVYSLDTVLACFFAVLFTGDWFSKE-----DTSSGSNPVSGKGIGVVDVGKSG 129
            TY  VL  ++ DT++ CFF + F+G WF+ +     D SS +   SG GI       SG
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSG-GI------SSG 113

Query: 130 TQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQNRYITEP 189
           ++    R     +QSAS   EY  TIL++LI    RFY NFII +FV+R+ +  +Y+ + 
Sbjct: 114 SKLLTARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQ 173

Query: 190 DDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           DDV+ DLK+  +  R ++  + W Y  C  YL
Sbjct: 174 DDVDQDLKHKKLWQRWWIRAENWSYRVCHHYL 205

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  146 bits (369), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 112/198 (56%), Gaps = 15/198 (7%)

Query: 4   LPQSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62
           LP SFF L PLY+GVEL LG+ I NK  G YGILALFTG PL ++QW  Y+WS   LL++
Sbjct: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72

Query: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122
           T+G+  + KP +  +  + T++SLDT+   F  + F  DWFS + ++  S          
Sbjct: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQS---------- 122

Query: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182
               ++  Q       +   Q AS+ YE    +++TL     R Y N ++ASF+ ++   
Sbjct: 123 ----ENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFIN 178

Query: 183 NRYITEPDDVEYDLKNTS 200
            ++I + DDVE DLKN S
Sbjct: 179 PKFIIDQDDVETDLKNKS 196

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  123 bits (308), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 97/175 (55%), Gaps = 15/175 (8%)

Query: 47  IQWGFYVWSFAALLVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKE 106
           +QW  Y+WS   L++F +GL Q++KP L+T+  +   ++LDT+  CFF + FT  WF   
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 107 DTSSGSNPVSGKGIGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRF 166
           +  S     +G       V K        R T   +Q A+  YEY  T+L+T I    RF
Sbjct: 61  EGESAVQTSTG-------VQK--------RDTSLASQGATAGYEYFVTMLITFITLTFRF 105

Query: 167 YSNFIIASFVRRMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221
           Y N I+ASFV+ ++   +++ + DDVE DLKN S+  R ++  +++CY  C+  L
Sbjct: 106 YFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>KLLA0A00132g Chr1 (4628..6151) [1524 bp, 507 aa] {ON} similar to
           uniprot|P36032 Saccharomyces cerevisiae YKL221W MCH2
           Protein with similarity to mammalian monocarboxylate
           permeases which are involved in transport of
           monocarboxylic acids across the plasma membrane mutant
           is not deficient in monocarboxylate transport
          Length = 507

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 19  LSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLV-FTKGLSQVYKPKLMTY 77
           LS GV +   F  LY  + L    P  LI  G  + + AALL  F+  L QVY  + +  
Sbjct: 122 LSFGVGVL--FSPLYNYI-LINTSPRKLISLGIVIQNVAALLAAFSTKLWQVYLTQGV-- 176

Query: 78  CMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFAYRR 137
                  S+ T   CF        WF K+ + +    V+G G+G +        N + +R
Sbjct: 177 -----FISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGI------VFNLSTQR 225

Query: 138 TVDDTQS 144
            +D+  S
Sbjct: 226 IIDNYDS 232

>KLLA0D20009g Chr4 complement(1709412..1710935) [1524 bp, 507 aa]
           {ON} similar to uniprot|P36032 Saccharomyces cerevisiae
           YKL221W MCH2 Protein with similarity to mammalian
           monocarboxylate permeases which are involved in
           transport of monocarboxylic acids across the plasma
           membrane mutant is not deficient in monocarboxylate
           transport
          Length = 507

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 19  LSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLV-FTKGLSQVYKPKLMTY 77
           LS GV +   F  LY  + L    P  LI  G  + + AALL  F+  L QVY  + +  
Sbjct: 122 LSFGVGVL--FSPLYNYI-LINTSPRKLISLGIVIQNVAALLAAFSTKLWQVYLTQGV-- 176

Query: 78  CMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFAYRR 137
                  S+ T   CF        WF K+ + +    V+G G+G +        N + +R
Sbjct: 177 -----FISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGI------VFNLSTQR 225

Query: 138 TVDDTQS 144
            +D+  S
Sbjct: 226 IIDNYDS 232

>KLLA0E00133g Chr5 (4528..6051) [1524 bp, 507 aa] {ON} similar to
           uniprot|P36032 Saccharomyces cerevisiae YKL221W MCH2
           Protein with similarity to mammalian monocarboxylate
           permeases which are involved in transport of
           monocarboxylic acids across the plasma membrane mutant
           is not deficient in monocarboxylate transport
          Length = 507

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 19  LSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLV-FTKGLSQVYKPKLMTY 77
           LS GV +   F  LY  + L    P  LI  G  + + AALL  F+  L QVY  + +  
Sbjct: 122 LSFGVGVL--FSPLYNYI-LINTSPRKLISLGIVIQNVAALLAAFSTKLWQVYLTQGV-- 176

Query: 78  CMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFAYRR 137
                  S+ T   CF        WF K+ + +    V+G G+G +        N + +R
Sbjct: 177 -----FISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGI------VFNLSTQR 225

Query: 138 TVDDTQS 144
            +D+  S
Sbjct: 226 IIDNYDS 232

>KLLA0C00132g Chr3 (4440..5963) [1524 bp, 507 aa] {ON} similar to
           uniprot|P36032 Saccharomyces cerevisiae YKL221W MCH2
           Protein with similarity to mammalian monocarboxylate
           permeases which are involved in transport of
           monocarboxylic acids across the plasma membrane mutant
           is not deficient in monocarboxylate transport
          Length = 507

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 19  LSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLV-FTKGLSQVYKPKLMTY 77
           LS GV +   F  LY  + L    P  LI  G  + + AALL  F+  L QVY  + +  
Sbjct: 122 LSFGVGVL--FSPLYNYI-LINTSPRKLISLGIVIQNVAALLAAFSTKLWQVYLTQGV-- 176

Query: 78  CMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFAYRR 137
                  S+ T   CF        WF K+ + +    V+G G+G +        N + +R
Sbjct: 177 -----FISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGI------VFNLSTQR 225

Query: 138 TVDDTQS 144
            +D+  S
Sbjct: 226 IIDNYDS 232

>KLLA0B00143g Chr2 (4365..5888) [1524 bp, 507 aa] {ON} similar to
           uniprot|P36032 Saccharomyces cerevisiae YKL221W MCH2
           Protein with similarity to mammalian monocarboxylate
           permeases which are involved in transport of
           monocarboxylic acids across the plasma membrane mutant
           is not deficient in monocarboxylate transport
          Length = 507

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 19  LSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLV-FTKGLSQVYKPKLMTY 77
           LS GV +   F  LY  + L    P  LI  G  + + AALL  F+  L QVY  + +  
Sbjct: 122 LSFGVGVL--FSPLYNYI-LINTSPRKLISLGIVIQNVAALLAAFSTKLWQVYLTQGV-- 176

Query: 78  CMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFAYRR 137
                  S+ T   CF        WF K+ + +    V+G G+G +        N + +R
Sbjct: 177 -----FISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGI------VFNLSTQR 225

Query: 138 TVDDTQS 144
            +D+  S
Sbjct: 226 IIDNYDS 232

>KLLA0F00154g Chr6 (4320..5843) [1524 bp, 507 aa] {ON} similar to
           uniprot|P36032 Saccharomyces cerevisiae YKL221W MCH2
           Protein with similarity to mammalian monocarboxylate
           permeases which are involved in transport of
           monocarboxylic acids across the plasma membrane mutant
           is not deficient in monocarboxylate transport
          Length = 507

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 19  LSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLV-FTKGLSQVYKPKLMTY 77
           LS GV +   F  LY  + L    P  LI  G  + + AALL  F+  L QVY  + +  
Sbjct: 122 LSFGVGVL--FSPLYNYI-LINTSPRKLISLGIVIQNVAALLAAFSTKLWQVYLTQGV-- 176

Query: 78  CMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFAYRR 137
                  S+ T   CF        WF K+ + +    V+G G+G +        N + +R
Sbjct: 177 -----FISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGI------VFNLSTQR 225

Query: 138 TVDDTQS 144
            +D+  S
Sbjct: 226 IIDNYDS 232

>KLLA0D00143g Chr4 (4326..5849) [1524 bp, 507 aa] {ON} similar to
           uniprot|P36032 Saccharomyces cerevisiae YKL221W MCH2
           Protein with similarity to mammalian monocarboxylate
           permeases which are involved in transport of
           monocarboxylic acids across the plasma membrane mutant
           is not deficient in monocarboxylate transport
          Length = 507

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 19  LSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLV-FTKGLSQVYKPKLMTY 77
           LS GV +   F  LY  + L    P  LI  G  + + AALL  F+  L QVY  + +  
Sbjct: 122 LSFGVGVL--FSPLYNYI-LINTSPRKLISLGIVIQNVAALLAAFSTKLWQVYLTQGV-- 176

Query: 78  CMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVGKSGTQNFAYRR 137
                  S+ T   CF        WF K+ + +    V+G G+G +        N + +R
Sbjct: 177 -----FISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGI------VFNLSTQR 225

Query: 138 TVDDTQS 144
            +D+  S
Sbjct: 226 IIDNYDS 232

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 10/85 (11%)

Query: 32  LYGILALFTGR---PLDLIQWGFYVWSFAALLVFTKGLSQVYKPKLMTYCMVLTVYSL-D 87
           L GI+ +  G+    L L++W F V   +A       +S   K  ++ YC  L +  L +
Sbjct: 747 LNGIVPMTNGQYRSQLYLLKWSFIVLGISA----ADAISNFLKSYILGYCSELWIMDLRN 802

Query: 88  TVLACFFAVLFTGDWFSKEDTSSGS 112
             +A         DWFSKE+  S  
Sbjct: 803 EAMAAIMNKRL--DWFSKEENKSSE 825

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,131,437
Number of extensions: 959421
Number of successful extensions: 2961
Number of sequences better than 10.0: 33
Number of HSP's gapped: 2988
Number of HSP's successfully gapped: 33
Length of query: 221
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 116
Effective length of database: 41,441,469
Effective search space: 4807210404
Effective search space used: 4807210404
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)