Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47615.435ON79879841840.0
AER402C5.435ON8693897269e-83
SAKL0G02552g5.435ON8347255182e-54
Kwal_55.214225.435ON7826695031e-52
ZYRO0F10054g5.435ON6606703696e-36
TDEL0E019005.435ON7627953592e-34
KLTH0F16038g5.435ON7923953396e-32
KAFR0E038305.435ON8456963121e-28
NDAI0B056805.435ON8567382978e-27
KLLA0E02201g5.435ON8353942835e-25
Kpol_1016.55.435ON8127142683e-23
Skud_4.6385.435ON8437472665e-23
Smik_4.6355.435ON8638532246e-18
NCAS0F033905.435ON8614132085e-16
TBLA0A028205.435ON9254231683e-11
KNAG0C049005.435ON7691201647e-11
YDR369C (XRS2)5.435ON8542231648e-11
CAGL0A02838g5.435ON828811541e-09
Suva_2.5415.435ON8694071414e-08
TPHA0J025905.435ON7753301324e-07
Kwal_56.231443.124ON2889106850.22
Kwal_55.208817.137ON30477742.3
CAGL0E04906g8.424ON361120724.7
ZYRO0B09592g2.176ON145690718.1
NCAS0G014402.24ON57185709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4761
         (798 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...  1616   0.0  
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   284   9e-83
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   204   2e-54
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   198   1e-52
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   146   6e-36
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   142   2e-34
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   135   6e-32
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   124   1e-28
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   119   8e-27
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...   113   5e-25
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   107   3e-23
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   107   5e-23
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...    91   6e-18
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...    85   5e-16
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...    69   3e-11
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...    68   7e-11
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...    68   8e-11
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...    64   1e-09
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...    59   4e-08
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    55   4e-07
Kwal_56.23144 s56 complement(420001..428670) [8670 bp, 2889 aa] ...    37   0.22 
Kwal_55.20881 s55 complement(595244..596158) [915 bp, 304 aa] {O...    33   2.3  
CAGL0E04906g Chr5 complement(475578..476663) [1086 bp, 361 aa] {...    32   4.7  
ZYRO0B09592g Chr2 complement(745515..749885) [4371 bp, 1456 aa] ...    32   8.1  
NCAS0G01440 Chr7 complement(259740..261455) [1716 bp, 571 aa] {O...    32   9.2  

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 1616 bits (4184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 788/798 (98%), Positives = 788/798 (98%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVIDERGVSRTHLQLKANRNI 60
           MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVIDERGVSRTHLQLKANRNI
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVIDERGVSRTHLQLKANRNI 60

Query: 61  IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLEI 120
           IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLEI
Sbjct: 61  IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLEI 120

Query: 121 NYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLKGI 180
           NYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLKGI
Sbjct: 121 NYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLKGI 180

Query: 181 SSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVGGG 240
           SSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVGGG
Sbjct: 181 SSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVGGG 240

Query: 241 TVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFKQHD 300
           TVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFKQHD
Sbjct: 241 TVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFKQHD 300

Query: 301 TRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSGLNLN 360
           TRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSGLNLN
Sbjct: 301 TRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSGLNLN 360

Query: 361 TEGPPAKKRRINSVKPLDSLSFFAGGSIERSTRVERNSSEKQTVQPAEHNKIAETSIASI 420
           TEGPPAKKRRINSVKPLDSLSFFAGGSIERSTRVERNSSEKQTVQPAEHNKIAETSIASI
Sbjct: 361 TEGPPAKKRRINSVKPLDSLSFFAGGSIERSTRVERNSSEKQTVQPAEHNKIAETSIASI 420

Query: 421 ELLPTKSGIKEITDVVPETENEPEPMVSPKKRSPAKNESLADMRAGDNHVSIKTTLEVEK 480
           ELLPTKSGIKEITDVVPETENEPEPMVSPKKRSPAKNESLADMRAGDNHVSIKTTLEVEK
Sbjct: 421 ELLPTKSGIKEITDVVPETENEPEPMVSPKKRSPAKNESLADMRAGDNHVSIKTTLEVEK 480

Query: 481 SAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKDSTLSTQSHSSIVNAIKEIKEREVSR 540
           SAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKDSTLSTQSHSSIVNAIKEIKEREVSR
Sbjct: 481 SAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKDSTLSTQSHSSIVNAIKEIKEREVSR 540

Query: 541 IKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSRHMKTETNKRHHVRRNFKRFVK 600
           IKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSRHMKTETNKRHHVRRNFKRFVK
Sbjct: 541 IKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSRHMKTETNKRHHVRRNFKRFVK 600

Query: 601 VWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMNKNELTDDQLVDENSSEEKNDIMNET 660
           VWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMNKNELTDDQLVDENSSEEKNDIMNET
Sbjct: 601 VWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMNKNELTDDQLVDENSSEEKNDIMNET 660

Query: 661 FTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGN 720
           FTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGN
Sbjct: 661 FTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGN 720

Query: 721 SLFVVEDESDDNTAVTYHNLSATSATRTEGSDVSIQARTSRIVTRPKNNATVLKYIGNXX 780
           SLFVVEDESDDNTAVTYHNLSATSATRTEGSDVSIQARTSRIVTRPKNNATVLKYIGN  
Sbjct: 721 SLFVVEDESDDNTAVTYHNLSATSATRTEGSDVSIQARTSRIVTRPKNNATVLKYIGNEE 780

Query: 781 XXXXXXXXAPRFAFRRTR 798
                   APRFAFRRTR
Sbjct: 781 DDEDDEDEAPRFAFRRTR 798

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  284 bits (726), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 154/389 (39%), Positives = 228/389 (58%), Gaps = 11/389 (2%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVIDERGVSRTHLQLKANRNI 60
           MW+FKC YQ       L  IS  + P++ +IVGRASKS+LVI+E+GVSRTHL+L+   + 
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIEEKGVSRTHLRLEVIDDH 60

Query: 61  IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLEI 120
           + I LLG+QLK+G +   KG    F P QSP+ LEVGSHS++C L W QWEFKVP+ L  
Sbjct: 61  VNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTLLQ 120

Query: 121 NYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLKGI 180
              AL ++   LGI++V S SK T+H I+R  +  +DY+KYLFALVKG+P++ + FLK  
Sbjct: 121 EDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLKQF 180

Query: 181 SSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVGGG 240
           ++LL      F+ +++ ++ +   F  F      L GL+FIV  K +F++LKYT+E+GGG
Sbjct: 181 TALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGG 240

Query: 241 TVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFKQHD 300
           TV+ C    D      TIP +  + +K  + IS  +   K  D     E  HS G +   
Sbjct: 241 TVHFCHDINDLSACLKTIPINGALALKYDHGISAEV---KKVDDTRYCEVLHSHGIQLFT 297

Query: 301 TRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSGLNLN 360
             ELT A+L +   + L     +  +L+     + + +T +  ++  + ++S  S  N  
Sbjct: 298 VHELTKAILYDKLAQLLSKRPPTMMKLV-----EPVPSTISQTQEMKQESLSPISLGNTT 352

Query: 361 TEGPPAK---KRRINSVKPLDSLSFFAGG 386
            +  P K   ++R+   +PLDSLSFFAGG
Sbjct: 353 IKDLPRKDKTRKRLKKPQPLDSLSFFAGG 381

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 148/288 (51%), Gaps = 32/288 (11%)

Query: 526 IVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSRHMKTET 585
           IV+AIK+IKEREV+RI+TTIVE+GP+ELTE+AI +L +LA+V+ VDMLR+  +      +
Sbjct: 599 IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDT-VGS 657

Query: 586 NKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMNKNELTDDQLV 645
           +     R+N+K F KVWP Y+N+    +   A   SNR+ +PL++YE     +L    L 
Sbjct: 658 SPLTFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYE----TDLQSRTLF 713

Query: 646 DENSSEEKNDIMNETFTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSN----PELEFS 701
           ++ +   + D ++ + ++  L ++  +AS     H           +L N    PE  F+
Sbjct: 714 EDGAPPRQKDNISRSTSTSGLSND--LASNRGKDHPAPGSLFSNHALLGNDNAGPEPIFN 771

Query: 702 FSTIRNSNSSESVTNNPG------NSLFVVEDESDD-----NTAVTYHNLSATSATRTEG 750
           FS+ R+   + S T +P       N+LFVV+DE++D     +T++         AT    
Sbjct: 772 FSS-RSREDTNSPTASPAPNLTHDNTLFVVDDENEDGDGMADTSIAQRVSRERHATTKPA 830

Query: 751 SDVSIQARTSRIVTRPKNNATVLKYIGNXXXXXXXXXXAPRFAFRRTR 798
              + + R +R    P+ +A                   P FAF+R R
Sbjct: 831 EPDTAEPRHTRRKHAPRPSAAA---------ADSDEDGEPTFAFKRAR 869

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  204 bits (518), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 204/725 (28%), Positives = 330/725 (45%), Gaps = 93/725 (12%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANR- 58
           MWI + +Y  +       +IS  +K    Y +GR++KS L I +++ +SR H+QLK N+ 
Sbjct: 1   MWILRYRYDTEDG--NWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKE 58

Query: 59  NIIEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118
           N + +   G    +  + +    S  FHPK   LRLE+G   I   + W    +KV  DL
Sbjct: 59  NELNLLNTGKLTTLNAEVLMVDQSLNFHPK-GQLRLELGIKPIIATIEWQDQVWKVSHDL 117

Query: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178
             N +   + F   GI +  ++S  T+ QI++  Q Q  Y   LF+LVKG+ +V   FL 
Sbjct: 118 LYNSMFKRQEFNSYGISVTTTMSTRTNLQIIK--QNQDTYSNCLFSLVKGIDIVRESFLS 175

Query: 179 GISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVG 238
              S L      ++   K L ++  +FP F    +  + +  IV  K  +++ KYTIEV 
Sbjct: 176 DFQSHLYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVA 235

Query: 239 GGTVYNCITFEDFVKVTSTIPSSK-VILIKC----------SNNISPAIDTQKPTDHNIL 287
           GG +  C   E F +       SK VI++K           ++NI  + D +K  +   L
Sbjct: 236 GGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARKLEE---L 292

Query: 288 LEKAHSIGFKQHDTRELTIAVLNNNFEETL--IDSSI---SDKRLISCNSNDKL------ 336
              A S+G+K HD  +L  AVL  +  + L  I + I   S+K L       K+      
Sbjct: 293 KAAAESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITP 352

Query: 337 ---KTTSTSLEDGLKVNVSATSGLNLNTEGPPAKKRRIN--SVKPLDSLSFFAGGSIERS 391
              K + T+   G   N +A +   +  +  P K++R N   V+PLDSL FFAGG+I+  
Sbjct: 353 VPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNIQAK 412

Query: 392 TRVERNSSEKQTVQPAEHNK-----------IAETSIASIELLPTKSGIKEITDVVPETE 440
               + + E    +  E N            I E ++      P +  +K + ++     
Sbjct: 413 NEGIQKNQEFGMTRVTEGNSEGFHDVDKDDVIDEQNVEPPRKKPRRKPVKSLENL----- 467

Query: 441 NEPEPMVSPKKRSPAKNESLADMRAGDNHVSIKTTLEVEKSAEPSH---KKLKVEGIFDE 497
                M+  K ++   N+ +     G+   + K   E +K  EP       +    I  E
Sbjct: 468 -----MIREKTQAEQHNKEIGKKPTGNECANKKPGSEDKKQKEPEAVPPYAMNEISIIPE 522

Query: 498 K---VEMSN-----EQKYHLNAESKDSTLSTQS---------------HS-SIVNAIKEI 533
           +   +E SN      +  H+  +  + TLS ++               HS ++V AI++ 
Sbjct: 523 RPGQLEQSNNTASANRPRHIPVQVDNCTLSNETRIPPNTLLTHEGVHNHSTALVEAIQDT 582

Query: 534 KEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSR-HMKTETNKRHHVR 592
           K REVSR+K T+++I  +ELTE AI  LS LA+VE  D++RK   R H  +        R
Sbjct: 583 KSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISSDTCLWEGR 642

Query: 593 RNFKRFVKVWPAYLNKAICQDPMGAQRYSN------RQCVPLKVYEPMNKNELTDDQLVD 646
           +NFK+F+KV P    +    D  G     N      R+ VPLK ++P  K ++ D   ++
Sbjct: 643 KNFKKFIKVQPRRSQRETF-DSDGKNIVKNSAFLITREYVPLKKFDPNEKEQIDDTFFLN 701

Query: 647 ENSSE 651
            +++E
Sbjct: 702 HSANE 706

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  198 bits (503), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 182/669 (27%), Positives = 314/669 (46%), Gaps = 53/669 (7%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59
           MWI + QY      D    +S  +K    Y +GR++K+ L I  ++ +SR H++L+ +++
Sbjct: 1   MWILRYQYVAGNGMDV--HVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQS 58

Query: 60  I-IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118
             + + ++G   K+  K+++ G   +F   +  L  E+G+  I+  ++  Q  +K+P DL
Sbjct: 59  CNVVLRVVGKLTKVSGKSVKAGQHLQFTADEEVL-FEMGASPIKATVVKQQSFWKIPHDL 117

Query: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178
            ++  +L++      I++  SLS  TS QI++     K +   LF+L+K +P++   F+ 
Sbjct: 118 SLSQ-SLSRHLADFDIQVTNSLSSTTSIQIIKD--SSKSFSNCLFSLIKNIPILREHFIG 174

Query: 179 GISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVG 238
              + +N     F+S+   +  E + FP +     P   ++F+V  +  F I K+ I+ G
Sbjct: 175 DFVTQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAG 234

Query: 239 GGTVYNC---ITFEDFVKVTSTIPSSKVILIKCSNN---------ISPAIDTQKPTDHNI 286
            GT++ C      + F+K    I S  VIL+   NN          S  +D Q+     +
Sbjct: 235 SGTLWLCDDISNLDHFIK--HKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEA---KL 289

Query: 287 LLEKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDG 346
           L  KA ++GF+ HD  ++  AVL++NFE+ L       +R+   N   K   T   LE+ 
Sbjct: 290 LKNKAQNLGFRIHDVNDIVGAVLDHNFEKLL-------ERVPVRNLPSK-APTGFPLEEA 341

Query: 347 LKVNVSATSGLNLNTEGPPAKKRRIN-SVKPLDSLSFFAGGSIERSTRVERNSSEKQTVQ 405
              +V  ++    +T  P  K++R N  V PLDSL+FF GGS   S +      E +   
Sbjct: 342 TNKSVIKSA----DTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGH 397

Query: 406 PAEHNKIAETSIASIELLPTKSGIKEITDV-VPETENE--PEPMVSPKKRSPAKNESLAD 462
               N   E   A  E  P K+ I  +    +P    E   EP+V  + +  ++  +   
Sbjct: 398 ETSQNTTTE--FAEGEPSPKKARIGALRKPDIPNVSEERVKEPVVQTRSKRASERSADTS 455

Query: 463 MRAGDNHVSIKTTLEVEKS---AEPSHKKLKVE-GIFDEKVEMSNEQKYHLNAESKDSTL 518
           +    N    + TL+  +     E  +  L +E G   +    S   +          T 
Sbjct: 456 ILVQANPKRSRKTLQASEGHTILENDNNSLNIESGPLPKTKSTSLGNEAAQAQADAVQTR 515

Query: 519 STQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQS 578
             +   S   A+KE K  EV R++  IV +  +ELTEEAI KL  LA+VE+ D++R  + 
Sbjct: 516 EAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETKDLMRADRE 575

Query: 579 RHM--KTETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYS----NRQCVPLKVYE 632
             +  ++  +++   R+NFK+FVK+WP+  ++        A R       R+ VPL+ YE
Sbjct: 576 YAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYVPLRPYE 635

Query: 633 PMNKNELTD 641
             N N   D
Sbjct: 636 GQNANNQDD 644

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  146 bits (369), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 172/670 (25%), Positives = 299/670 (44%), Gaps = 107/670 (15%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59
           MWI + QY  +     L  +S  ++  + Y +GR+SK+ L I +++ +SR H+ +  +  
Sbjct: 1   MWILRYQYDLEDG--NLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGK 58

Query: 60  IIEITLL--GAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSD 117
             ++ L+  G    +  K ++ G S  F      + +E+G+  ++ +L W    + VP  
Sbjct: 59  DRQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG 118

Query: 118 LEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFL 177
              ++ AL     +LGI++   LS E S   +     Q++Y ++L+ LVK +PL+ + FL
Sbjct: 119 SRSDHSALE----ELGIEV---LSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFL 171

Query: 178 KGISSLLNSDTLKFESKVKELEREFSI-FPEFNPIPNPLKGLYFIVPEKDEFDILKYTIE 236
             +S  ++    +F+S   ++  + S+ +  +      L+ L F+   KDE   L   IE
Sbjct: 172 NVVSQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL--AIE 229

Query: 237 VGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGF 296
             GG     ++ E+  +            +K   ++S           N+++        
Sbjct: 230 AAGGKYSAVLSVEELREA-----------VKRKGDLS-----------NVVI-------L 260

Query: 297 KQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSG 356
           K H T    +A L   F    +  +I             LK    SL++G+   V+    
Sbjct: 261 KSHLTPAEELAPLGKTFTVQDVVEAI-------------LKDEVNSLKNGVIGEVAKRPE 307

Query: 357 LNLNTEGPPAKKRRINS--VKPLDSLSFFAGGSIERSTRVER----NSSEKQTVQPAEHN 410
             +  E P  KKRR+N   VKPLD LSFFAGG   + ++ E     NS E+++  P +  
Sbjct: 308 AEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEESKDPRKLE 367

Query: 411 KIAETSIASIELLPTKSGIKEITDVVPETENEPEPMVSPKKRSPAKNESLADMRAGDNHV 470
              E S  S E+L  +         VP+  NE        K  P + +S  + +A +N  
Sbjct: 368 DPKEESKESKEVLQPE---------VPKEFNEY------SKEEPGQ-KSYEESKADENEK 411

Query: 471 SIKTTLEVEKSAEPSHKKLKV-EGIFDEKVEMSNEQKYHLNAESKDSTLS------TQSH 523
           S+      E++ EP+   L+V E       E  N  + H     +  TLS      + S 
Sbjct: 412 SL------EETVEPT---LQVTEPPPTSAAEKPNNARPH-----RKPTLSDYRKGESPSQ 457

Query: 524 SSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSRHMKT 583
           + ++  I++ K  EV R+ +TI+++G +ELTE+AI +L  L +V+  D L + + R    
Sbjct: 458 NDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTV 517

Query: 584 ET-NKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYSN------RQCVPLKVYEPMNK 636
           ++ N   + R+NFK FVKVWP Y  +        +    N      RQ VP + Y   + 
Sbjct: 518 DSHNPNWNNRKNFKNFVKVWPKYGGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDS 577

Query: 637 NELTDDQLVD 646
           ++   + L D
Sbjct: 578 SKQAQEDLYD 587

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  142 bits (359), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 190/795 (23%), Positives = 338/795 (42%), Gaps = 131/795 (16%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59
           MWI K  Y+ +    T+  +SS +   + + +GR+SK+ L I +++ +SR H+ +  +  
Sbjct: 1   MWILKYTYELEDG--TIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSE 58

Query: 60  IIEITLL--GAQLKIGHKTIEKGISCEFHPK---QSPLRLEVGSHSIECKLLWTQWEFKV 114
           +  I L+  G     G K ++ G S +F  K   + P+ +E+G+  I+ +++W    F +
Sbjct: 59  VKLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDL 118

Query: 115 PSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEV 174
           PS L             +GI +        S  I+ + + +  Y K LF L+ G  +   
Sbjct: 119 PSQLS----QFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAY-KCLFGLINGAVIRNS 173

Query: 175 GFLKGISSLLNSDTLKFESKVKEL--EREFSIFPE-FNPIPNPLKG--LYFIVPEKDEFD 229
            FL  ++++L+  T  FE     L     + ++P    P    LKG   Y I  +     
Sbjct: 174 QFLVEVTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMA 233

Query: 230 ILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLE 289
            ++  +E G G                     ++I+++ +  +   +  +  TD  I+L+
Sbjct: 234 YVQEALERGNG---------------------ELIVVENTEQLLDRLKQENSTDDLIVLK 272

Query: 290 KAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKV 349
              +        +  T+  L N      + + +     +     D + +   +L    K 
Sbjct: 273 AEETTKIPGDKIKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTL---TKT 329

Query: 350 NVSATSGLN----------LNTEGPPAKKRRINSVKPLDSLSFFAGGSIERSTRVERNSS 399
            VS++  L+             E PP K+RR N VKPLDSL FFAGG  + ST       
Sbjct: 330 EVSSSQSLSNKEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG--DYSTEEPEQEI 387

Query: 400 EKQTVQPAEHNKIAETSIASIELLPTKSGIKEIT-------DVVPETENEPEPMVSPKKR 452
             Q V PA  +  A+TSI +   +P     +E +       ++V   +N  +P+      
Sbjct: 388 STQPVNPAASD-TAKTSITTQINVPENDASQESSAFDKFQPNIV--LKNSAKPLTI---D 441

Query: 453 SPAKNESLADMRAGDNHV-SIKTTLEV-----EKSAEPSHKKLKVEGIFDEKVEMSNEQK 506
           SP    +  ++   + HV  I   +E+     E+ +E ++  + VE            Q 
Sbjct: 442 SPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNM-VETTPRPTARKKTLQD 500

Query: 507 YHLNAESKDSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAV 566
           +     + D++ S  S   +V+ IK+ K REV R+K+T+V++  DELTE+AI +L  LA+
Sbjct: 501 FKSTVNNPDNSAS--STEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAI 558

Query: 567 VESVD-MLRKTQSRHMKTETNKRH---HVRRNFKRFVKVWPAYLNKAICQDPM-GAQRY- 620
           V+  D ++R+ +    +T  N +H     R+NFK FVKV   Y  + + ++   G+  + 
Sbjct: 559 VQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFI 618

Query: 621 ------SNRQCVPLKVYEPMNKNELTDDQLVDENSSEEKNDIMNETFTSDPLDHNIQMAS 674
                   RQ VP K+Y   +  E+ D     E +S +                      
Sbjct: 619 RNSGYLLTRQYVPSKIYTKESSKEMQDFPEASEQTSRQ---------------------- 656

Query: 675 KSIPRHHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGNSLFVVEDESDDNTA 734
            S+P            QV+ +PE    F+  R+++ + +      N LFVV+++   N  
Sbjct: 657 FSVP------------QVIDDPEDAEPFTFTRHTSGTPA-----NNGLFVVDEDDSQNDV 699

Query: 735 VTYHNLSATSATRTE 749
           V    L+A  + R E
Sbjct: 700 V----LAARESIRPE 710

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  135 bits (339), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 112/395 (28%), Positives = 193/395 (48%), Gaps = 26/395 (6%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59
           MWI + QY ++   +    +S  +K    Y+VGR+ KS L I  ++ +SR H+QL+  +N
Sbjct: 1   MWILRYQYIDETGSEI--RVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN 58

Query: 60  I-IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118
             +E+   G   KIG   ++     EF   QS + LE+G+  ++  + +    +K+P DL
Sbjct: 59  SKLEVLNAGKLTKIGGDNVKMDQMLEFGADQS-VALEMGAGPVKGTVTYEPAIWKIPHDL 117

Query: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178
            I   +L        I++  SL+ +TS QI++  + QK +   LFALVK +P++  GF+ 
Sbjct: 118 AITE-SLKNHLSLYDIQVTNSLTSKTSVQIIK--EHQKSHGNCLFALVKKIPIMCEGFIG 174

Query: 179 GISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVG 238
              S      + F++K +++  + + F E        KGL F+V  +  F I K  I+ G
Sbjct: 175 DFVSQFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAG 234

Query: 239 GGTVYNCITFEDF-VKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNI-----LLEKAH 292
            G ++ C    +    +   I S  V+++      +PA+ +++    +I     L  KA 
Sbjct: 235 SGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKAR 294

Query: 293 SIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVS 352
           S+GFK  D  ++  AVL N+   +L+D  +  ++ +  NS       S  L D +     
Sbjct: 295 SLGFKTRDVNDIVDAVLKNDI-LSLLD-RVPQEKALEENSAGGSIAGSQVLADIV----- 347

Query: 353 ATSGLNLNTEGPPAKKRRINSVKPLDSLSFFAGGS 387
                NL  +    +KR    ++PL+SL+FF GGS
Sbjct: 348 -ADAPNLRNK----RKRANRQIQPLNSLAFFGGGS 377

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 177/696 (25%), Positives = 303/696 (43%), Gaps = 126/696 (18%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59
           MWI +  Y+N+ +  TL  +S  ++  K Y +GR+SK+ L I +++ +SR H+ ++ + N
Sbjct: 1   MWILR--YENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCN 58

Query: 60  ------IIEITLLGAQLKIGHKTIEKGISCEFHPKQ-SPLRLEVGSHSIECKLLWTQ--W 110
                 ++ +   G    I    ++   S  F  +  S + +++G+  +  ++ WT   W
Sbjct: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFW 118

Query: 111 EFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVK-GL 169
                 DL  +++   K    +GI      S      +V + + + ++ + +FAL+K   
Sbjct: 119 ------DLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDE-KSNWSRIMFALLKQNC 171

Query: 170 PLVEVGFLKGISSLLNSDT-LKFESKVKELEREFS---IFPEF----NPIPNPLKGLYFI 221
            LV+   L  + ++L +D    F+    +L   FS   ++P F    N I    + + F 
Sbjct: 172 TLVKPVLLSEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFY 231

Query: 222 VP---EKDEFDILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDT 278
                  D+   LK T+    G   +  T +D V    T+  +   L+KC      A+  
Sbjct: 232 TVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHN---LLKC-----IALKQ 283

Query: 279 QKPTDHNILLEKAHSIGFKQHDTRELTIAVLNNNFEET---LIDSSISDKRLISCNSNDK 335
           + P    I        G K +  +E+  A+L+ NF+     +  S+ S KR    N  D 
Sbjct: 284 EDPAPDEIQ-------GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKR----NFTDS 332

Query: 336 LKTTSTSLEDGLKVNVSATSGLNLNTE-----------------------GP-PAKKRRI 371
           +   +   +    V+   TS LN NT                        GP P K+RR+
Sbjct: 333 ISHYNEDAQRNSHVHPDNTSTLNTNTHATISAAAEASREGGESLEPPTVMGPSPTKRRRL 392

Query: 372 --NSVKPLDSLSFFAGGSI-----------------------ERSTRVERN---SSEKQT 403
              +VKPLDSLSFFAGGS                        E+  +VE     ++ ++ 
Sbjct: 393 VRRTVKPLDSLSFFAGGSTNPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRD 452

Query: 404 VQPAEHNKIAETSIASIELLPTKSGIKEITDVVPETENEPEPM--VSPKKR-------SP 454
            Q  +   + +T++ S+   PT +   +   ++  TEN  E +   S K+R       SP
Sbjct: 453 EQTNDQVDVVQTALQSLSSQPTTNRSIQNKGIL-RTENNDEMLTNASIKRRNMPLKPLSP 511

Query: 455 AKNESLADMRAGDN-HVSIKTTL---EVEKSAEPSHKKLKV-EGIFDEKVEMSNEQKYHL 509
             + +L       N +VS +T +    +E +   S+   +V   I   K E S   K+ +
Sbjct: 512 DVDTNLLIQPIDSNSNVSQETNVPKESMEDNDNSSNTLSEVNRNILSRKSE-SGPHKFDV 570

Query: 510 NAESKDSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVES 569
           +      T  ++S ++ + A++  K REV RI+T IV++ P EL+EEAI KLS L +VES
Sbjct: 571 SL-----TKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVES 625

Query: 570 VDMLRKTQSRHMKTETNKRHHVRRNFKRFVKVWPAY 605
              L + +        N     RRNFK+F KVWP +
Sbjct: 626 NPNLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQH 661

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  119 bits (297), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 176/738 (23%), Positives = 321/738 (43%), Gaps = 121/738 (16%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKAN-R 58
           MWI + QY  +     +  +S  ++    Y +GR+SK+ L I +++ +SR H+ +K    
Sbjct: 1   MWILRYQYGLEDG--GIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPS 58

Query: 59  NIIEITLLGAQLKIGHKTIEKGISCEFHPKQSP-LRLEVGSHSIECKLLWTQWEFKVPSD 117
             + +   G    +  + +    S  F+   +  L + +G++ +  ++ W      +P+ 
Sbjct: 59  GQLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN- 117

Query: 118 LEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFL 177
               Y     +  + GI++   + +E SH I        DY   L AL  G+P+ +  +L
Sbjct: 118 ---MYEQFRGLLTKYGIEVTSDILQEDSH-ITAVVMTPNDYYVPLLALALGIPVFKSQYL 173

Query: 178 KGISSLLNSDTLKFESKVKELE--REFSIFPEF---NPIPNPLKGLYFIVP--------E 224
             +S++L  D + F++ V+++       + P F   N   N  +  +FI+          
Sbjct: 174 TEVSNMLRPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEH 233

Query: 225 KDEFDILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKV-ILIKCSNNISPAIDTQKPTD 283
            D+  IL+ ++++ GG        E+ +K  + + +S   IL     NI    D      
Sbjct: 234 ADKSFILRKSLQLIGGE-------EEIIKDPTELQNSVTKILSTSGKNIVIVTDEDN--- 283

Query: 284 HNILLEKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNS-----NDKLKT 338
                 K   + F+  + +++  + + N  +  L+ S++++  ++S  +     N+KL  
Sbjct: 284 -----GKRMIMNFECRNVKDIFDSFVKN--DPKLLKSNLTETGVVSPKAPEIFENEKLMV 336

Query: 339 TSTSLEDGLKVNVSATSGLNLNTEGPP-------AKKRRI--NSVKPLDSLSFFAGGSIE 389
                     +   +TS  NL    PP        KKRR+    VKPL+SL FF GGS  
Sbjct: 337 EIQEPPIEAAITEESTSSKNL-KHTPPEPVTTHIVKKRRLARKRVKPLESLDFFVGGST- 394

Query: 390 RSTRVERNSS--EKQTVQPAEHNKIAETSIASIELLPTKSGIKEITDVVPETENEPEPMV 447
             T  E +S+  +++ ++P    K+ + +    E +      K I        NEP   +
Sbjct: 395 TGTPFETSSTTLQQEIIEP----KVPDVAPILNEQIQQSQVNKSI--------NEPAKDI 442

Query: 448 -----SPKKRSPAKNESLADMRAGD----------NHVSIK---TTLEVEKSAEPSHKK- 488
                S +K + A   +  D    +           H+ I     + E EK +  S K  
Sbjct: 443 YSIGGSDRKETAALTYATIDKHMQEPTQQIDDIPSQHIDISPHGNSNEQEKRSNSSEKSP 502

Query: 489 LKVEGIFDEKVE-MSNEQKYHLNAESKDSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVE 547
           +  + + DEK E +SN +   +         S  +  S+V  I++IK REV+R++++I  
Sbjct: 503 MITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAH 562

Query: 548 IGPDELTEEAICKLSTLAVVES-VDMLRKTQSR---HMKTETNKRH----------HVRR 593
           +  +ELTE+AI + S LA+VES   ++R+T++    +  T +  RH            RR
Sbjct: 563 VDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRR 622

Query: 594 NFKRFVKVWPAYL-NKAICQDPMGAQRYSN----------RQCVPLKVYEPMN-----KN 637
           NFKRFVKV+P Y+ NK    +  G    S+          R  VPLK Y   +     KN
Sbjct: 623 NFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKN 682

Query: 638 ELTDDQLVDENSSEEKND 655
              D++++++   E  N+
Sbjct: 683 GFNDEEMLEKEYVEYDNE 700

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 108/394 (27%), Positives = 183/394 (46%), Gaps = 37/394 (9%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVID-ERGVSRTHLQLKANRN 59
           MWI    + ++ +    + +   ++    Y +GR++K +  I  ++ +SR HL +K + +
Sbjct: 1   MWIVSFIFDDEAEKS--HKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS 58

Query: 60  IIEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLE 119
            + IT  G   K   + I    +   H + + +   +G   I+  + +   E+K+P  LE
Sbjct: 59  DLIITNKGKLTKFNEEIIPLDETIVVHNQNTVI--NIGGMPIDVNVRYFYEEWKIPHRLE 116

Query: 120 INYIALTKMFV-QLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178
           +N    TK  V   G+K+  S SK+T+ QI         Y   LFAL+KG+P+V + FL 
Sbjct: 117 LNE---TKSLVSDFGVKLSESFSKKTTTQICSD---SSSYSGCLFALLKGVPVVSIEFLN 170

Query: 179 GISSLLN-SDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEV 237
            +  LL   + L F+S  + L     +FP +  +PN L  +  IV E+  +D L+YTIEV
Sbjct: 171 QMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEV 230

Query: 238 GGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFK 297
           GGG         +  K  ST     V+L    ++IS  ++++      +L E   SI   
Sbjct: 231 GGGDAKLLANSSELDKFLSTNHEPAVVL---GSSISQKMNSEST---KLLEEFDKSIAET 284

Query: 298 --QHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATS 355
             +H  + L I    N F   L+++ I+          D +  TS S     K+  +  S
Sbjct: 285 SLRHGVKLLNI----NQFVNILLENKIN-----GLKKRDVVDLTSPSPVQQKKIQSAKAS 335

Query: 356 GLNLNTEGPPAKKRRINSVKPLDSLSFFAGGSIE 389
                T+  P       +++ LDSL+FF GG++E
Sbjct: 336 VNGKKTKSKP-------NIQSLDSLNFFGGGNLE 362

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 515 DSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLR 574
           ++ L  +S ++I+ AI E K++EV R++  I+E+   ELTE A+      A + ++ +  
Sbjct: 583 ETDLQVRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKP 642

Query: 575 KTQSRHMKTETNKRHHVRRNFKRFVKVWPAYLNK---AICQDPMGAQRYSNRQCVPLKVY 631
           +  +    +  N +   R+NFK+F K WP+YL +    +C D    Q    R+ + ++ Y
Sbjct: 643 RVLASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ--IGREYITMRKY 700

Query: 632 E 632
           +
Sbjct: 701 D 701

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 183/714 (25%), Positives = 309/714 (43%), Gaps = 131/714 (18%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSL-VIDERGVSRTHLQLKANRN 59
           MW+ + QY    D  ++  IS  I+ ++ Y +GR+SK+ L V +++ +SR  + ++ +R+
Sbjct: 1   MWVLRYQYS--LDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRD 58

Query: 60  --IIEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSD 117
              I +  LG    +  + +  G +  F  K   + +++G+  I   L    WE K    
Sbjct: 59  KDCIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNL---SWEVK---- 111

Query: 118 LEINYIALTKMFVQLGIKIVFS-LSKETSHQIVRSRQGQKDY--DKYL--FALVKGLPLV 172
              NY+      V L     F   + E SH +    Q       DKYL  ++++    L+
Sbjct: 112 -RCNYMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILI 170

Query: 173 EVGFLKGISSLLNSDTLKFESKVKELEREFSIFPE----FNPIPNPLKGLYFIV--PEKD 226
               L+ I +     T KF+S   +L    S           +   LKG++  +  PE  
Sbjct: 171 NSKTLRDILTNNIIMTKKFDSYWVKLNSHESNIQNHTINVTKLAKSLKGMHMFLLDPES- 229

Query: 227 EFDILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNI 286
                           YNC  FE F++    IP  K + I   N++   ++TQ      +
Sbjct: 230 ----------------YNCEYFEKFLEEIGCIPR-KFLNI---NDLETYLETQFKGGEFL 269

Query: 287 LLEKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDG 346
           LL  A  +  +    R ++I +      E+ +D  +        + N   + +   +E  
Sbjct: 270 LLSSAK-LENQSRLERFISIPL------ESFLDKLLFLDLDFGQSINRSKEESKNVIEPV 322

Query: 347 LK-VNVSATS-----GLNLNTEGPPAKKRRINS--VKPLDSLSFFAGG-----------S 387
           LK V V  T+       N+    P  KKRR+N   VKPLDSL+FFAGG            
Sbjct: 323 LKEVGVEQTTEAVPISKNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLP 382

Query: 388 IERSTRVERNSSEKQTVQPAEHNKI-AETSI---ASIELLPTKSGIKE-ITDVVPETENE 442
           +E +  + R   +K+ ++     +I  ET +    + ELL T S  K+  +DV  + E  
Sbjct: 383 VEEANNITR-KKDKEVIKSQGKGEINIETEMDESGNGELLSTASEFKKPKSDVQHKLEKR 441

Query: 443 PEPMVSPKKRSPAKNESLADMRAGDNHVSIKTTL--EVEKSAEPSHKKLKVEGIFDEKVE 500
            +  +    RSP   E +   +  +N +SI+  L  +V+ +++ S        + + ++ 
Sbjct: 442 MQVAID---RSP---EKIKKPKLEEN-ISIQQLLSNKVKSTSDTSS------VLIETQIA 488

Query: 501 MSNEQKYHLNAESKDSTLSTQSHSS----------IVNAIKEIKEREVSRIKTTIVEIGP 550
             +  K     + +  TL+   H+S          +V+AI++IKERE  R+KT+IVEI  
Sbjct: 489 KESNTKAIEYGKVRQKTLTDYKHTSDERIERPSVDLVHAIQDIKERETLRVKTSIVEIKE 548

Query: 551 DELTEEAICKLSTLAVVESVDMLRKTQSRHMKTETNKRHH-----VRRNFKRFVKVWPAY 605
           +ELTEEAI K S L VV+    L K +S  +    N   +      ++NFK+FVK+ P Y
Sbjct: 549 NELTEEAINKFSDLTVVDINTRLFKDKSLDINKPANSNQNNMDWSGKKNFKKFVKMVPKY 608

Query: 606 LNKAICQDPMGAQRYSN--------------RQCVPLKVYEPM----NKNELTD 641
                 +   G  ++++              R  VP+K Y  +    N NE+TD
Sbjct: 609 ------KRSQGNGQHADSCSTFIRNSAMLITRNFVPMKQYSKLDNNSNSNEMTD 656

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 182/747 (24%), Positives = 312/747 (41%), Gaps = 177/747 (23%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTH-------- 51
           MW+ +  YQN  +   ++ IS  ++  K+Y +GR+SK+SL+I +++ +SR H        
Sbjct: 1   MWVIR--YQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEIN 58

Query: 52  --LQLKANR----NIIEITLLGAQ-LKIGHKTIEKGISCEFHPKQSPLR-LEVGSHSIEC 103
             L LKA+     N  ++T +  + LK+G K I       + P+ S L  +E+G+     
Sbjct: 59  GGLNLKASHLSLINQGKLTSINKKFLKVGEKFII------YAPEVSNLTTIELGTSPFHI 112

Query: 104 KLLWTQWEFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYD-KYL 162
           ++ W    + +PS L            Q GI    S+     + ++       D   + L
Sbjct: 113 EVAWVSEIWNIPSHL----TEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMREL 168

Query: 163 FALVKGLPLVEVGFLKGISSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIV 222
           +ALV  +PL ++  L  +   L                          +P  ++ L F  
Sbjct: 169 YALVNAIPLKKLRLLVDVCKTL--------------------------LPASVRNLKFDE 202

Query: 223 PEKD-----EFDILKYTIEVGGGT------VYNCITFEDFVKVTSTIPSSKVILIKCSN- 270
             KD     EF++  +   V          +    T  +  ++++T+    V L+   N 
Sbjct: 203 MWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTSNERRLSATLRGLNVKLLNFDNM 262

Query: 271 -NISPAIDTQKPTDHNILLEKAHSI--GFKQHDTRELTIAVLNNNFEETLIDSSISDKRL 327
            ++   +D  KP+   ++L   +    G  Q     L  +V+    E+ L   +I++ + 
Sbjct: 263 KSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLITSVI----EDAL--PAITNTKS 316

Query: 328 ISCN-SNDKLKTTSTSLEDGLKVNVSATSGLNLNT---EGPPA----KKRRINSVKPLDS 379
           + C   N K +  S          V +TS   L+T   E  PA    ++     V+PLDS
Sbjct: 317 VPCEIQNKKFERVS---------EVQSTSSKTLHTPEIEVGPAILKKRRLNRRRVQPLDS 367

Query: 380 LSFFAGGSIERSTRVERNSSEKQTVQPA----------------EHNKIAETSIASIELL 423
           LSFFAGG   +S+   ++ ++ + + P                 E + +A  +I  ++  
Sbjct: 368 LSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVRNIQKVDEN 427

Query: 424 PTKSGIKEITDVV----PE---------TENEPEPMVSP--------------KKRSPAK 456
             K   ++ T  +    PE         +E++P P +SP               + +PA 
Sbjct: 428 NEKENGQKSTGAIVISSPELYAEHISEDSEDKP-PRLSPLTVTRPGLQSNPLISRTTPA- 485

Query: 457 NESLADMRAGDNHVSIK-TTLEVEKSAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKD 515
              + D R  +N+ + K +T ++ ++ E +H          E  E S E+  +   + K 
Sbjct: 486 -HYMEDKRIAENYENGKSSTRDIIQTLEENH----------EPPEQSQEKNSYSQVDRKS 534

Query: 516 ST------LSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE- 568
                     + +  S V AI+E K REV R K+TIV++  DEL+EE I +L  LA+VE 
Sbjct: 535 PVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEP 594

Query: 569 SVDMLRKTQ--------SRHMKTETN---KRHHVRRNFKRFVKVWPAYL-----NKAICQ 612
           + D+LRK Q        +R  K E+    +  H R+NFK F+KVWP +      NK   Q
Sbjct: 595 NEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQ 654

Query: 613 DP---MGAQRYSNRQCVPLKVYEPMNK 636
           +      A     R  VPL+ Y   NK
Sbjct: 655 NSDFIRSAAFLITRNYVPLRKYSKNNK 681

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 204/853 (23%), Positives = 360/853 (42%), Gaps = 157/853 (18%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVID-ERGVSRTHLQLK---- 55
           MW+ +  YQN  +  T++ IS  ++  K+Y +GR+SK+ L+I  ++ +SR H+ LK    
Sbjct: 1   MWVVR--YQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSN 58

Query: 56  ----ANRNIIEITLLGAQLKIGHKTIEKG--ISCEFHPKQSPLRLEVGSHSIECKLLWTQ 109
               +N N + +   G    I +K ++ G     E     +   +E+G+  I  ++ W  
Sbjct: 59  SGSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKN 118

Query: 110 WEFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYD-------KYL 162
             + +PS L     AL++          F +S ETS   V +     DY        + L
Sbjct: 119 QVWNIPSHLAQFRTALSQ----------FGISTETSINEVPTNIMISDYPSSDDNVIREL 168

Query: 163 FALVKGLPLVEVGFLKGISSLLNSDT---LKFESKVKELEREFSIFPEFNPIPNPLKGLY 219
            AL + +PL +   L  + + L S +   L F+ +  ++ +                   
Sbjct: 169 CALAENIPLKKSQLLVKLCNTLLSASITDLTFDERWNDIVKS------------------ 210

Query: 220 FIVPEKDEFD-----ILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISP 274
              PE D FD     +    +++   T+   I+ E ++       + K+      N++  
Sbjct: 211 ---PEYDVFDANPDLLFSKFMKLSDITILTTISNEPYLPSILRRFNIKLFDFVDINSLYK 267

Query: 275 AIDTQKPTDHNILLEKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSND 334
            +D+ KP+   ++L    S+  K++     T   L  +  +  + S I+ K +     N+
Sbjct: 268 HVDSLKPSTKYLILT---SMNKKENGQILCTTKCLLTSLIKDTLASVINTKSVSFEAPNN 324

Query: 335 KLKTTSTSLEDGLKVNVSATSGLNLNTEGPPA----KKRRINSVKPLDSLSFFAGG---- 386
           +     T + D  K++ ++     + TE  P     ++     V PLDSL+FFAGG    
Sbjct: 325 E-----TPVRDPEKLSSASKIHHTIETEASPVILKKRRLNRRRVLPLDSLNFFAGGLNVK 379

Query: 387 ---------------------SIERSTRVERNSSEKQTVQPAEHNKIA---------ETS 416
                                S+  S  + R + EK ++   +  K+A          ++
Sbjct: 380 ASSESKDITDVKESRCGLDSKSVISSPIIGR-AEEKHSLISQDTQKVAGDIEKENGHNST 438

Query: 417 IASIELLPTKSGI---KEITDVVPETENEPEPMVSPKKRSP-------AKNESLADMRAG 466
            A I   P    +   K   D+ P+  +        +K+S        A   S+ + +A 
Sbjct: 439 GAIIVSSPESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKAT 498

Query: 467 DNH-VSIKTTLEVEKSAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKDSTLSTQSHS- 524
             + ++   T  V +++E SH+      +F+   ++S   K  L +  K+ +   +S + 
Sbjct: 499 KAYSITGHPTHSVTQTSEGSHE------LFNYSQKLSFPLKADLESPVKEVSFREKSSAP 552

Query: 525 -SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVES-VDMLRKTQSRHMK 582
            S V AI++ K+REV R+K+TIVE+  DEL+EEAI +L  LA+VE+  D+LRK     + 
Sbjct: 553 HSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLN 612

Query: 583 TETN-----------KRHHVRRNFKRFVKVWPAY-------LNKAICQDPM-GAQRYSNR 623
           T ++           +    R+NFK FVK WP +        N     D + GA     R
Sbjct: 613 TVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITR 672

Query: 624 QCVPLKVYEPMNKNELTDDQLVDE-NSSEEKNDIMNETFTSDPLDHNIQMASKSIPRHHD 682
             VPLK Y   NK    D +  D+ ++  E   I +  + SD  +           R   
Sbjct: 673 NYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTTIHKRPQTQR--- 729

Query: 683 SIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGN-SLFVVEDESDDNTAVTYHNLS 741
            I+ S  E    N E E SFS  R S+++ +    PG   LF+ +D  +DN +   ++  
Sbjct: 730 -IFIS--EDSSDNGE-EDSFSFSRGSDAAPNA--QPGTIKLFITDDNGNDNKSDRVYDKG 783

Query: 742 ATSATRTE-GSDV 753
           ++    TE G+D+
Sbjct: 784 SSFKLVTESGTDL 796

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 112/413 (27%), Positives = 191/413 (46%), Gaps = 53/413 (12%)

Query: 364 PPAKKRRINS--VKPLDSLSFFA-GGSIERSTRVERNSSEKQTVQPAE------HNKIAE 414
           P  KKRR+N   VKPLDSL+FFA G S +  +   + +++    + AE      +N + +
Sbjct: 372 PIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDESAESDKFRTNNGLTQ 431

Query: 415 TSIASIELLPTKSGI-KEITDV-----VPETENEPEPMVSPKKRSPAKNESLADMRAGDN 468
            S  S  L+ ++  + KE+ +      + E      P++  K   P +            
Sbjct: 432 PSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLE------------ 479

Query: 469 HVSIKTTLEVEK-SAEPSHKKLKVEGIFDEKV-EMSNEQKYHLNAESKDS--TLSTQSHS 524
           H       E+   +A P+ + L   G+      ++ + Q    N + K +  + S +   
Sbjct: 480 HTEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPK 539

Query: 525 SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE-SVDMLRKTQSR---- 579
           S V AI+E K REV+R+K+T+VEI  DELTE AI +L +L +VE +  ++RK  SR    
Sbjct: 540 SFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECR 599

Query: 580 ----HMKTETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYS----NRQCVPLKVY 631
                   +T +    R+NFK+FVK++P Y+ K    D     R +     R  VP+K +
Sbjct: 600 TPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKF 659

Query: 632 EPMNKNELTDDQLVDENSSEEKNDIMN--ETFTSDPLDHNI----QMASKSIPRHHDSIY 685
                N   DD+ + E+   E+ +I N        P+ ++     Q++ + +     S  
Sbjct: 660 TGQYNNVPNDDEDMYEHHDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSAR 719

Query: 686 QSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGNSLFVVEDESDDNTAVTYH 738
               +   S+ E + SFS  R+  +++  T N  N LFVV+++  D+  +  H
Sbjct: 720 IKDTQPDFSDDEGQ-SFSFRRSMANAKKTTAN--NGLFVVDEDDLDSINIPNH 769

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 92/201 (45%), Gaps = 8/201 (3%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLK-ANR 58
           MW+ + QY + +D  T   IS  I+    Y +GR++K+ L I +++ +SR HL LK  +R
Sbjct: 1   MWVLRYQY-DLEDGST-QKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDR 58

Query: 59  NIIEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDL 118
           N I I   G    IG + ++ G S  F    S L +++G+  +   L +    + +P+ L
Sbjct: 59  NDIHIINQGKLTYIGEQYLDVGQSLTFGNVNS-LSIKLGTKPVMVHLEFYSSNWLIPNGL 117

Query: 119 EINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178
              +  L    V +  +I     K     IV    G       L+  +K +P+ +  F  
Sbjct: 118 TQFHETLKDFGVNVATQIPVD-QKTQIDLIVDEINGSGLIP--LWGFMKDIPVKKPQFFS 174

Query: 179 GISSLLNSDTLKFESKVKELE 199
               +L+S+   F++    L+
Sbjct: 175 TACEILSSNDNDFDNSWHRLQ 195

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 101/423 (23%), Positives = 177/423 (41%), Gaps = 56/423 (13%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLK---A 56
           MWI    Y++  D  TL  +S  +K ++ Y +GR+ KS L + +++ +SR H+       
Sbjct: 1   MWIISYSYKSADD--TLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGN 58

Query: 57  NRNIIEITLLGAQLKIGHKTIEKGISCEFHPK-QSPLRLEVGSHSIECKLLWTQWEFKVP 115
             N + +   G   ++  + +    +  F+   + P  +E+G+  +     WT   + +P
Sbjct: 59  LNNQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIP 118

Query: 116 SDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYL-----FALVKGLP 170
               I +          G  I F   K  +   V   + +   + ++     ++LV    
Sbjct: 119 ----IEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSI 174

Query: 171 LVEVGFLKGISSLLNSDTLKFESKVKELEREFSI--FPEFN--PIPNPLKGLYFIVPEKD 226
           +++  FL  + +LLN +   F    + L     I  F   N   +   L G+  IV   +
Sbjct: 175 ILKSSFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDN 234

Query: 227 EFDILKYTIEVGGGTVYN--CITFED---FVKVTSTIPSSKVILIKCSN----------- 270
             D++ +   +    V N   IT ED   F+    +    ++IL+  SN           
Sbjct: 235 TTDLIYF---IAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHIETIKVHT 291

Query: 271 --NISPAIDTQKPTDHNILLEKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLI 328
             +    I  Q   +H I + K  S    + ++RE TI++ N N   + +   I D   +
Sbjct: 292 FKDFYQGIKNQN-INHLIQVIKKDSPHTIERNSRE-TISLNNENQTYSQLSPYIEDNNKV 349

Query: 329 SCN--SNDKLKTTSTSLEDGLKVNVSATSGLNLNTEGPPAKKRRIN--SVKPLDSLSFFA 384
           + N  S+  LK TS  ++    VN  A        E PP K+RR+N   V+PLDSL FF 
Sbjct: 350 NSNTISDSLLKQTSELIKPS--VNDHA-------PEKPPVKRRRLNRKRVQPLDSLHFFV 400

Query: 385 GGS 387
           GG+
Sbjct: 401 GGN 403

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 11/120 (9%)

Query: 521 QSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE-SVDMLRKTQSR 579
           ++ SS+V  I+ +K+ E  R++ T+  + P ELT+EAI   S +A+VE +V+++RK  + 
Sbjct: 542 RNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPA- 600

Query: 580 HMKTETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYS-NRQCVPLKVYEPMNKNE 638
            M TE++ R   R NFK+F+KVWP         D +    Y   R  VP+K Y   N+NE
Sbjct: 601 -MVTESSIRSD-RPNFKKFMKVWPKARKG---NDSLRNNAYLITRDYVPMKAY---NRNE 652

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 86/424 (20%), Positives = 168/424 (39%), Gaps = 81/424 (19%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKS-SLVI-DERGVSRTHLQLK-AN 57
           MWI +  Y+++ D  T+  +S  ++  +NY +GR+SK+ +LVI +++ +SR H+  +  +
Sbjct: 1   MWILRYSYESE-DHGTV-YVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS 58

Query: 58  RNIIEITLLGAQLKIGHKTIEKGISCEFHPKQSP-LRLEVGSHSIECKLLWTQWEFKVPS 116
            + ++I   G    I    ++   +       S    ++VGS  +   L+W         
Sbjct: 59  HDYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVW--------E 110

Query: 117 DLEINYIALTKMFVQLGIKIVF------SLSKETSHQIVRSRQGQKDYDKYLFALVKGLP 170
           D+ I+   ++     L +  ++       ++ E + + +  +  +  +   L AL++G  
Sbjct: 111 DVFIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGAN 170

Query: 171 LVEVGFLKGISSLLNSDTLKFESKVKEL------EREFSIFPEFNPIPNPLKGLYFIVPE 224
            +    L  + +    D+ +  S   E+        ++  +P F    N  +    I  +
Sbjct: 171 RLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFD 230

Query: 225 KDEFDI--LKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPT 282
            ++ DI  ++  +E  GGT+ + +  E F K  ST                        T
Sbjct: 231 NNDSDISGVRSCVEFCGGTLLSFVNNESFEKYAST----------------------NET 268

Query: 283 DHNILLEKAHSIGFKQH-----------DTRELTIAVLNNNFEETLIDSSISDKRLISCN 331
            HN+LL ++                    T     AV  NN   TL+   +  +R     
Sbjct: 269 LHNVLLLRSERFQVSHPVYEILNKIDICSTGSFFKAVTENNVS-TLVHRELFLRRYTDI- 326

Query: 332 SNDKLKTTSTSLEDGLKVNVSATSGLNLNTEGPPAKKRRIN--SVKPLDSLSFFAGGSIE 389
           +  +++     +ED                   P KKRR+N   V+PL+ L FFAGG   
Sbjct: 327 TQKEMRRPKEPVEDT----------------AVPLKKRRLNRRKVQPLNPLEFFAGGDTA 370

Query: 390 RSTR 393
            +T+
Sbjct: 371 TTTK 374

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 108/223 (48%), Gaps = 52/223 (23%)

Query: 525 SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE-SVDMLRKTQSRHMKT 583
           + V AI+E K REV R+K+TIVE+  +EL+EEAI +L  LA+VE S ++LRK+      +
Sbjct: 558 AFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKS----FDS 613

Query: 584 ETNK---------------RHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYSN------ 622
           E NK                 H R+NFK FVKV P   +KA  ++     + S+      
Sbjct: 614 EGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPK--SKAHKEEGKNNTQSSDFIRNAA 671

Query: 623 ----RQCVPLKVYEPMNKNELTDDQLVDENSS----EEKNDIMNETFTSDPLDHN-IQMA 673
               R  VPLK Y   +K + T     +EN       E     + TF SD ++ N IQ  
Sbjct: 672 FLITRNYVPLKKY---SKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNINSNTIQKR 728

Query: 674 SKSIPR--HHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESV 714
           S+++ R  + DS          SN   E SFS  R S ++ SV
Sbjct: 729 SQALNRFTNEDS----------SNEGEEDSFSFSRCSGTAASV 761

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 103/227 (45%), Gaps = 24/227 (10%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59
           MW+ +  YQN  +  +++ IS  ++  K Y +GR+SK+ L+I +++ +SR H+  K   N
Sbjct: 1   MWVVR--YQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEIN 58

Query: 60  --------IIEITLLGAQLKIGHKTIEKGISCEFHPKQ--SPLRLEVGSHSIECKLLWTQ 109
                    + +   G    +  K ++ G +   +         +E+G+  I  +  W  
Sbjct: 59  NSSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWIN 118

Query: 110 WEFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYD-KYLFALVKG 168
             + +P  L         M  + GI    S++   ++ ++      +D   + L+ALV  
Sbjct: 119 EVWNIPPHL----TQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVST 174

Query: 169 LPLVEVGFLKGISSLL---NSDTLKFESKVKEL--EREFSIFPEFNP 210
           +P+ +  FL  + + L   +   LKF+    ++    E+++F +F+P
Sbjct: 175 IPMKKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVF-DFDP 220

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 526 IVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESV-DMLRKTQSRHMKTE 584
           IV  ++  KE EV R+ +TIV+I   ELTEEAI KL+ L +VE V D++R          
Sbjct: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNT 612

Query: 585 TNKRHHVRRNFKRFVKVWPAY 605
           T ++   R+NFK+FVK+ P Y
Sbjct: 613 TQQQWKNRKNFKKFVKICPKY 633

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 178/407 (43%), Gaps = 53/407 (13%)

Query: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLK---- 55
           MW+ +  YQN  +  ++N+IS  ++  K+Y +GR+SK+ LVI +++ +SR H+  K    
Sbjct: 1   MWVIR--YQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEIN 58

Query: 56  ----ANRNIIEITLLGAQLKIGHKTIEKGISCEFHPKQ--SPLRLEVGSHSIECKLLWTQ 109
                  N + +   G    I  K ++ G +      +  +   +E+G+  I  K  W  
Sbjct: 59  DSLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWID 118

Query: 110 WEFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYD-KYLFALVKG 168
             + +PS+L         +  Q GI    S+  +++  ++       D   + L+ALV  
Sbjct: 119 EIWNIPSNL----AQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHT 174

Query: 169 LPLVEVGFLKGI-SSLLNSDT--LKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEK 225
           +PL +   L  + +SLL+S    LKF+     +  +  +F  F+  P+ L   +  +   
Sbjct: 175 IPLKKSQLLVDLCNSLLSSSVMNLKFDETWNNMVNK-PLFKVFDYDPSVLFSKFMRLD-- 231

Query: 226 DEFDILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHN 285
              +++  T      T+ N     + ++  +     ++    C N++   +D  KP++  
Sbjct: 232 ---NVITLT------TIGNESGLPNILRRLNV----RLFHFDCLNDLYKHVDLLKPSEKY 278

Query: 286 ILL--EKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSL 343
           ++L        G K    + L  +++++    ++I++      +   N+ +K+    T++
Sbjct: 279 LILTFTNKRENGQKLCTLQNLITSIIDDTL-PSVINTKAVPFEVQENNTPEKVFEGHTAI 337

Query: 344 EDGLKVNVSATSGLNLNTEGPPA----KKRRINSVKPLDSLSFFAGG 386
              +             TE  PA    ++     V+PLDSL+FFAGG
Sbjct: 338 SKTVHT---------PETEATPAVLKKRRLNRRRVQPLDSLNFFAGG 375

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 15/116 (12%)

Query: 502 SNEQKYHLNAESKDSTLSTQSHS--SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAIC 559
           S++Q  H N+  ++ +L  QS++  S V AI++ K REV R+K+TIVE+  DEL+EEAI 
Sbjct: 551 SHQQAGH-NSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAIN 609

Query: 560 KLSTLAVVE-SVDMLRKTQS-----------RHMKTETNKRHHVRRNFKRFVKVWP 603
           +L+ LA+VE S ++LR  +S           R  K    +    R+NFK F KVWP
Sbjct: 610 QLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWP 665

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 146/330 (44%), Gaps = 66/330 (20%)

Query: 362 EGPPAKKRRIN--SVKPLDSLSFFAGG------SI----------ERSTRVERNSSEKQT 403
           E P  K+RR+N   VKPLD+LSFFAGG      SI           + T  + N+S+ ++
Sbjct: 330 EPPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKPSNDVQSHQETEKDVNNSKIES 389

Query: 404 VQPAEHNKIAETSIASIELLPTKSGIKEITDVVPETENEPEPMVSPKKRSPAKNESLADM 463
           +Q  E N+       S EL  +K+  K   D + ++  E     +P  ++P+ + S+ D 
Sbjct: 390 IQDVESNQDQTKYDKSTELQKSKAVSKNADDKLQDSTAEKPINFNPTTKTPSFSPSINDK 449

Query: 464 RAGDNHVSIKTTLEVEK-SAEPSHKKLKVEGIFDEKV--EMSNEQKYHLNAESKDSTL-- 518
              +++ ++  T+E  + + +P+    K   + D K+  E  NE    L+A++ D+ +  
Sbjct: 450 AIENSNANLDPTMEKTRVNKKPASLDTK-NNLLDNKLIAEQINEA---LSAKTNDAPVVR 505

Query: 519 -----------STQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVV 567
                         S + +V  I+ +K R V R+ + IV +  +EL EE + K   + VV
Sbjct: 506 RRRTLLDYGNTDKSSSTDLVRTIQNVKSRGVDRVNSKIVTVDENELNEEELNKFFDVVVV 565

Query: 568 ESVDMLRKTQSRHMKT------ETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYS 621
           +  D L K      K       + N     R+++K F K  P +      Q  +  Q +S
Sbjct: 566 DVNDKLMKKHPNAQKVIDNANIDHNSNFKNRKDYKLFKKSIPKW------QSKLNKQHHS 619

Query: 622 -------------NRQCVPLKVYEPMNKNE 638
                        NR  +PL+ Y   N+NE
Sbjct: 620 MTSDNGENLVVSKNRNKIPLRKY---NENE 646

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 83/183 (45%), Gaps = 8/183 (4%)

Query: 7   QYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQL-----KANRN- 59
           +Y+N      +N +S  +  D  Y +GR+SK+   I +++ +SR H+ L       ++N 
Sbjct: 5   RYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSDDKNV 64

Query: 60  IIEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLE 119
           II+I   G    I  K + +  + +F      L + +G+  I  ++   +       D++
Sbjct: 65  IIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPITLEIFNQEVVCNSIEDIQ 124

Query: 120 INYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLKG 179
            +   L    + +      +L +E    I++      D    LF+ V G+P+V +  L+G
Sbjct: 125 NSDSKLILNNLNILQDDPLTLKREGPTIIIK-ENSYTDILLELFSNVFGIPIVTIEELRG 183

Query: 180 ISS 182
           I++
Sbjct: 184 IAN 186

>Kwal_56.23144 s56 complement(420001..428670) [8670 bp, 2889 aa]
           {ON} YOL081W (IRA2) - encodes a GTPase activating
           protein, highly homologous to Ira1p, homologue of
           neurofibromin [contig 183] FULL
          Length = 2889

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 4/106 (3%)

Query: 453 SPAKNESLADMRAG--DNHVSIKTTLEVEKSAEPSHKKLKVEGIFDEKVEMSNEQKYHLN 510
           SP   +SL  MR+     H S+K+ L   +S EPS + L+   +   +V+ S E      
Sbjct: 789 SPEGEKSLHGMRSQLESIHKSVKSPLRFSRSREPSDESLQPMSLQSLQVKTSGESSSVFT 848

Query: 511 AESKDSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEE 556
            ++  + L T + +++VN I  + +R V     T+ ++GP  +TE+
Sbjct: 849 HKATHTDL-TDARATLVNII-SVYQRMVQYYFVTLDDVGPPRVTED 892

>Kwal_55.20881 s55 complement(595244..596158) [915 bp, 304 aa] {ON}
           YEL005C (VAB2) - Vac8p binding protein of 31 kDa [contig
           137] FULL
          Length = 304

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 655 DIMNETFTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSNP-ELEFSFSTIRNSNSSES 713
           DI +ET  +D ++H +Q++ + + RH+  + + + +  L+   E+E   S  +    S S
Sbjct: 75  DISSETAQTDRIEHQLQVSMEKLQRHYKKVTRKRAKHELTTEREIEGCVSVTKEIEDSLS 134

Query: 714 VTNNPGNSLFVVEDESD 730
           V  N  +SL +   + D
Sbjct: 135 VLKNKADSLVLKAAQKD 151

>CAGL0E04906g Chr5 complement(475578..476663) [1086 bp, 361 aa] {ON}
           similar to uniprot|Q12449 Saccharomyces cerevisiae
           YDR214w
          Length = 361

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 54/120 (45%), Gaps = 24/120 (20%)

Query: 457 NESLADMRA--GDNHVSIKTTLEVEKSAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESK 514
            E L  + A  GD  +S+ +   V+   E S +K KV  +FD K+ ++ + +  L  +  
Sbjct: 25  QEKLVGLAAQEGDCQLSVTSVKTVDGDCEVSQRKGKVISLFDLKIVLAYDGE--LAGDKF 82

Query: 515 DSTLST---------QSHSSIVNAIKE-----------IKEREVSRIKTTIVEIGPDELT 554
           + T+S          + +  +V   +E           I+ER V ++++   + GPD LT
Sbjct: 83  EGTVSVPEVAFDSDPEDYQFVVTIFQETSKLNERVKPLIRERLVPQLRSAFQQFGPDLLT 142

>ZYRO0B09592g Chr2 complement(745515..749885) [4371 bp, 1456 aa]
           {ON} similar to uniprot|P13382 Saccharomyces cerevisiae
           YNL102W POL1 Catalytic subunit of the DNA polymerase
           alpha- primase complex required for the initiation of
           DNA replication during mitotic DNA synthesis and
           premeiotic DNA synthesis
          Length = 1456

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 45/90 (50%), Gaps = 13/90 (14%)

Query: 418 ASIEL-LPTKSG--IKEITDVVPETENEPEPMVSPKKRSPAKNESLADMRAGDNHVSIKT 474
           AS++L  PTK    I E  D++ E ENEP  MV P    P     L+      N+ S+K 
Sbjct: 119 ASVQLNKPTKKAKDIDEFDDILGEYENEP--MVKPTHIRPV----LSPPSINRNNTSVKR 172

Query: 475 TLEVEKSAEPSHKKLKV--EGIFDEKVEMS 502
              +  S E S+K+LKV  E   DE  EM+
Sbjct: 173 N--IPASQEVSNKRLKVDLENNADEDFEMN 200

>NCAS0G01440 Chr7 complement(259740..261455) [1716 bp, 571 aa] {ON}
           Anc_2.24 YNL219C
          Length = 571

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 4/85 (4%)

Query: 589 HHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMNKNELTDDQLVDEN 648
           HH  R+ +RF K W   L  A+           N    P+K+YE  NK ++T D+ ++  
Sbjct: 353 HHSLRHIRRFFK-WVTMLLIALQATSRIVALIENYT-APIKLYEEFNKMDVTTDEKINVC 410

Query: 649 SSEEKNDIMNETFTSDPLDHNIQMA 673
           +  E     N  F   P  H +Q  
Sbjct: 411 TGREWYHFPNSFFL--PESHRLQFV 433

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,701,767
Number of extensions: 4009522
Number of successful extensions: 16462
Number of sequences better than 10.0: 404
Number of HSP's gapped: 17479
Number of HSP's successfully gapped: 434
Length of query: 798
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 680
Effective length of database: 39,950,811
Effective search space: 27166551480
Effective search space used: 27166551480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)