Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47605.436ON47847824200.0
AER403C5.436ON48046214190.0
SAKL0G02574g5.436ON48446911011e-146
KLTH0F16016g5.436ON4844769961e-130
Kwal_55.214185.436ON4844729951e-130
KLLA0E02223g5.436ON4804649341e-121
TDEL0E018905.436ON4744837604e-95
ZYRO0F10076g5.436ON4824636901e-84
Kpol_1062.285.436ON4654723606e-37
TPHA0E017505.436ON4594752954e-28
TBLA0A028105.436ON4814882353e-20
YNL026W (SAM50)2.304ON4841731741e-12
Smik_14.3042.304ON5001731731e-12
Ecym_33422.304ON4952031678e-12
SAKL0E07194g2.304ON4952031661e-11
Suva_14.3192.304ON4841731615e-11
Skud_14.3022.304ON4841731571e-10
AGR392C2.304ON4951341517e-10
CAGL0M06853g2.304ON4662021517e-10
KLLA0E08735g2.304ON4922091482e-09
TPHA0G008302.304ON4782051472e-09
NDAI0G007102.304ON4912111473e-09
KLTH0G10824g2.304ON4951841473e-09
TBLA0B060602.304ON5031631473e-09
NCAS0G038602.304ON4612021454e-09
NCAS0G037502.304ON4612021454e-09
Kwal_27.114562.304ON4962041455e-09
KAFR0H032502.304ON4621641411e-08
ZYRO0A02310g2.304ON4921961383e-08
Kpol_1003.512.304ON4781341374e-08
TDEL0G023402.304ON4942021374e-08
KNAG0H019402.304ON4561661303e-07
CAGL0J06424g3.509ON972102713.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4760
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   936   0.0  
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   551   0.0  
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   428   e-146
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   388   e-130
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   387   e-130
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   364   e-121
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    297   4e-95
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   270   1e-84
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   143   6e-37
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    118   4e-28
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436     95   3e-20
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    72   1e-12
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    71   1e-12
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    69   8e-12
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    69   1e-11
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    67   5e-11
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    65   1e-10
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    63   7e-10
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    63   7e-10
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    62   2e-09
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    61   2e-09
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    61   3e-09
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    61   3e-09
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    61   3e-09
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    60   4e-09
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               60   4e-09
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    60   5e-09
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    59   1e-08
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    58   3e-08
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    57   4e-08
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    57   4e-08
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    55   3e-07
CAGL0J06424g Chr10 complement(614059..616977) [2919 bp, 972 aa] ...    32   3.9  

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/478 (96%), Positives = 463/478 (96%)

Query: 1   MVENNLRTNLDGHEAALAKVQTKPLFITSVYVNDVKLSPLSNSIFESILKPVLSQPFQNL 60
           MVENNLRTNLDGHEAALAKVQTKPLFITSVYVNDVKLSPLSNSIFESILKPVLSQPFQNL
Sbjct: 1   MVENNLRTNLDGHEAALAKVQTKPLFITSVYVNDVKLSPLSNSIFESILKPVLSQPFQNL 60

Query: 61  RSTLSALGTIEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQ 120
           RSTLSALGTIEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQ
Sbjct: 61  RSTLSALGTIEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQ 120

Query: 121 LVPAFYQPLSLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSL 180
           LVPAFYQPLSLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSL
Sbjct: 121 LVPAFYQPLSLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSL 180

Query: 181 KCLVPLQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRG 240
           KCLVPLQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRG
Sbjct: 181 KCLVPLQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRG 240

Query: 241 PIIYSGISILGRNLLDLKKTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFN 300
           PIIYSGISILGRNLLDLKKTE               YVFQILQNNKKFLGTLPISGWKFN
Sbjct: 241 PIIYSGISILGRNLLDLKKTEVSSSINSWVESSKVSYVFQILQNNKKFLGTLPISGWKFN 300

Query: 301 LFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKV 360
           LFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKV
Sbjct: 301 LFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKV 360

Query: 361 HIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGD 420
           HIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGD
Sbjct: 361 HIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGD 420

Query: 421 VFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
           VFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM
Sbjct: 421 VFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/462 (58%), Positives = 346/462 (74%), Gaps = 2/462 (0%)

Query: 17  LAKVQTKPLFITSVYVNDVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMY 76
           L K QTKPL+ITSV V D K  PLS+ + +SIL PVL++P Q+L STL++L TIEK LMY
Sbjct: 19  LGKSQTKPLYITSVQVEDGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMY 78

Query: 77  TGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTTR 136
           TGLY D++ITLD DKS+ ++ +L  +APKEY +ELP+P+KA ++++PA YQ LSLVTTTR
Sbjct: 79  TGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAPYQRLSLVTTTR 138

Query: 137 DSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAVF 196
           DSYA+AG  L+S+NKF  AE   LQ ++N TPFSGK+D+KL+ L+CLVP Q  PS+KAVF
Sbjct: 139 DSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVF 198

Query: 197 DINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNLLD 256
           D+NYA++DL+ Q W+ E DQHKQ QIGFNIGIQ+Q + S +   P  ++G+SI+GRNL  
Sbjct: 199 DVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWL-SKRLYSPTAFAGVSIVGRNLHG 257

Query: 257 LK-KTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVAGEK 315
           ++                   +V Q L +N+K +GT P+ G KFN  NE VL QTVAG  
Sbjct: 258 IQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGTP 317

Query: 316 QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLK 375
           QE  F K   +YE + SFLRN + TSLDLS G++   K  ++  VHIMDQFYLGGLSSLK
Sbjct: 318 QEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLK 377

Query: 376 GFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERGIPEDLATA 435
           GF RNSVG+RGG+ FY+++ KSS H+PGTPL SPLRLQAF NAGDVF+  R IPED+A A
Sbjct: 378 GFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPEDVAAA 437

Query: 436 TGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAY 477
           TG+SLVY+S +A+LDLTYALPL+ R  D+AKPGFSFGV+IAY
Sbjct: 438 TGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  428 bits (1101), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 307/469 (65%), Gaps = 8/469 (1%)

Query: 16  ALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKL 74
           AL++  TKPL+ITSV V+ D + +PLS+++++SIL PVLSQP QN+ + ++    I+KKL
Sbjct: 18  ALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKL 77

Query: 75  MYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTT 134
            +TGL+ DV ITLD D S    D+L+E   KEYG+ELP+P  A+I L+PA Y  L L + 
Sbjct: 78  FFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTSG 137

Query: 135 TRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKA 194
           T D  ++ G  +S +N   +AET+ILQ ++N  PFSGK++EK L  K L+PLQK PS+KA
Sbjct: 138 TSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKA 197

Query: 195 VFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNL 254
           V D+NYA +DLFKQ +L   DQHKQ Q  FNIG+Q+  + +     PI+++G+S + RNL
Sbjct: 198 VIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNL 257

Query: 255 LDLKKTEXXXXXXXXXXXX--XXXYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVA 312
                                   +V QI  + +KF+G  PISG +FNL NE VL Q  +
Sbjct: 258 YGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFS 317

Query: 313 GEK---QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQFYLG 369
             K   QE+ F K   SYE ++S+L N I +SLD S G I    S + + VH MD+FYLG
Sbjct: 318 KNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAI-VHTMDRFYLG 376

Query: 370 GLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERGIP 429
           GL SLKGF+ N+VG+ GGN FY++   SS+ +P     SPLR Q F NAGD  N +R +P
Sbjct: 377 GLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLN-KRELP 435

Query: 430 EDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
           +  A ATG SLVY++ LA++DLTYALPL+ R QDVAKPGFSFGV +++ 
Sbjct: 436 QSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  388 bits (996), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/476 (45%), Positives = 304/476 (63%), Gaps = 17/476 (3%)

Query: 12  GHEAALAKVQT-KPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGT 69
           G E+++ +  + KPL+ TS+ V+ D   SPLSN+++ S+L+PVL QP Q L  +LS    
Sbjct: 13  GSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAE 72

Query: 70  IEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKE----YGLELPVPIKAQIQLVPAF 125
           I+KKL+YTGL+ DV I+LD + S   SD L+ + PK+    Y LE+P+P  A+I+L P  
Sbjct: 73  IKKKLIYTGLFRDVKISLDNEVS---SDELQSL-PKDLVKGYALEMPIPTIARIRLTPIN 128

Query: 126 YQPLSLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVP 185
               SL + T D+ ++ G   S +N F +AE + LQG+L   PF    DEK+L  K L+P
Sbjct: 129 LNRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIP 188

Query: 186 LQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYS 245
           LQK PS+KAVFD NYA +DL  Q ++ + DQH+Q Q+  N+G+Q+Q ++      P++Y+
Sbjct: 189 LQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYN 248

Query: 246 GISILGRNLLDLKKTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNEA 305
           G S++ RNL +++K                 +V Q+L +N+KF G  P SG KF++ NE 
Sbjct: 249 GFSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEY 308

Query: 306 VLGQTV---AGE--KQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKV 360
           VL ++    AG    Q  GF K+A  +E + +F  N II SL+L+ G IF     S L V
Sbjct: 309 VLSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSL-V 367

Query: 361 HIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGD 420
           H +D+FYLGG+SSLKGF+RNSVG  GG  FYK+   SSF +P TP  SPLRLQ F NAGD
Sbjct: 368 HHIDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGD 427

Query: 421 VFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIA 476
           V N ++      A ++G+SL+Y+S LA++DLTYA PL+ R QD+ KPGFSFGVS++
Sbjct: 428 VQN-KKPTQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/472 (45%), Positives = 291/472 (61%), Gaps = 8/472 (1%)

Query: 11  DGHEAALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGT 69
           +  E  L K   KPL+ TS+ V+ + KL PLS++ + S+L+PVLSQP Q L  +L+    
Sbjct: 13  EAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTE 72

Query: 70  IEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPL 129
           I+KKL+YTG++ DV I+LD+D S      L + A KE  LE PVP  A+I L P  +  L
Sbjct: 73  IKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFNKL 132

Query: 130 SLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKL 189
              ++T D+  + G   S +N   +AE + LQ E+   PF     EK L  K +VPLQK 
Sbjct: 133 CFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKN 192

Query: 190 PSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISI 249
           PS+KAVFD NYA +DL  Q ++ + DQH+Q Q+  N+G+Q+Q ++S     P+ Y+G S+
Sbjct: 193 PSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSV 252

Query: 250 LGRNLLDLKKTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQ 309
           + RNL D+                   +V Q++ +N+KF G  P SG K  L NE VL Q
Sbjct: 253 VARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQ 312

Query: 310 TVAGEKQ-----ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMD 364
               +       + GF K A S E   SF +N II SLD++ G I    + + L VH MD
Sbjct: 313 RFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASL-VHHMD 371

Query: 365 QFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNS 424
           +FYLGGL+SLKGF+RN+VG  GGN FYK+   SSF +P TP  SPLRLQ F+NAG+V N 
Sbjct: 372 KFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSN- 430

Query: 425 ERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIA 476
           E+      A ++GISL+Y+S LA++DLTYALPLS RAQDVAKPGFSFGVS++
Sbjct: 431 EKPTSVSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  364 bits (934), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 286/464 (61%), Gaps = 8/464 (1%)

Query: 23  KPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMYTGLYD 81
           K ++ T V V+ D +LSP+S+ +++SI   +L+ P Q + S   +   I+KKL++TGL+ 
Sbjct: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76

Query: 82  DVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTTRDSYAA 141
              ITLD D     S  L E  PK   +ELP+P  AQ++LVPA Y   SL TTTRD+Y++
Sbjct: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136

Query: 142 AGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAVFDINYA 201
           AG  L  +NKF  AETI LQG++N TPF+GK+DE+LL  K  +P  K PS+KA    N+ 
Sbjct: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196

Query: 202 LVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNLLDLKKTE 261
            +DLFKQ ++ ESD+HKQ+Q G + GI++  + ++       ++G++++ RN+       
Sbjct: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256

Query: 262 XXXXXXXXX--XXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVAGEK---Q 316
                            ++ ++  ++++F    P+SG +  LF+E +L Q     K    
Sbjct: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPH 316

Query: 317 ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKG 376
           ES F K++ SYE +  F    ++TSL L  G IF +K+ S+  VH++D FYLGG  SLKG
Sbjct: 317 ESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKG 376

Query: 377 FQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSER--GIPEDLAT 434
           F+RN VG RGG  FYK+   SSF +P TP+ SPLRLQ+F+N GDV N+ R   +    A 
Sbjct: 377 FERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKPAL 436

Query: 435 ATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
           +TGISL+Y +  A+LDL+Y+LPL +R  D+AKPG +FG+ +++ 
Sbjct: 437 STGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  297 bits (760), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 268/483 (55%), Gaps = 14/483 (2%)

Query: 1   MVENNLRTNLDGHEAALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQN 59
           M+ ++L +++ G E       TKPL+I+ + ++ D  LSPLS S++++IL   LS P QN
Sbjct: 1   MLFHDLASDIQGSE-------TKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQN 53

Query: 60  LRSTLSALGTIEKKLMYTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQI 119
           + S+L   G I +KL+ TGLY DV ITL+QD     S++  + +PKEYG+E P+   A+I
Sbjct: 54  VGSSLYTFGDIRRKLLCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARI 113

Query: 120 QLVPA-FYQPLSLVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLL 178
            L P+  Y   +  T+  D  A+  I  S +N   +A++      L   P + K + K L
Sbjct: 114 ILKPSGVYNSTAGTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSL 173

Query: 179 SLKCLVPLQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKF 238
                +PL K PS++A  + +   V+   +S++ E+D H + Q   + G+Q++ I     
Sbjct: 174 KGSFSLPLAKNPSVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTN 233

Query: 239 RGPIIYSGISILGRNLLDLKKTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWK 298
             P  Y+GI+   R++  L                      +   + +K+ GT P+SG++
Sbjct: 234 SVPNFYAGITSTNRDISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYE 293

Query: 299 FNLFNEAVLGQTVAGEK---QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSG 355
             + NE V+ QT    +   QE  F K  FS + ++S  +N +  SLDL FG I  +   
Sbjct: 294 LLVNNEYVISQTKGSSQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEK 353

Query: 356 SELKVHIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAF 415
           +E  VH MD++YLGGL S+KGFQ N VG  G + FYKVA  +S  +  TP+ SPLRL  F
Sbjct: 354 TE--VHPMDKWYLGGLDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFF 411

Query: 416 VNAGDVFNSERGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSI 475
           +N G+ FN         A ATGISL Y++  A++DLTYA PL+ R+QD+ KPGFSFGV+ 
Sbjct: 412 MNLGNAFNDLNTATNSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTF 471

Query: 476 AYM 478
           +Y 
Sbjct: 472 SYF 474

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  270 bits (690), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/463 (35%), Positives = 251/463 (54%), Gaps = 7/463 (1%)

Query: 21  QTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMYTGL 79
           +TKPL+I+ + ++ D   SPLS+S+  +I    L+QP Q++ ++++    I KKL++TGL
Sbjct: 22  ETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTGL 81

Query: 80  YDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTTRDSY 139
           + DVNITLD+D        L +   + YG+E P+  +A++ L    Y  +S  TT  D  
Sbjct: 82  FSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTLSDDN 141

Query: 140 AAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAVFDIN 199
            +     +  N   QA+   L+   N  P + + D K       +PL K+PS++A+ +  
Sbjct: 142 ISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAIVEAE 201

Query: 200 YALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNLLDLKK 259
                L  + ++   D+H Q Q     G Q++ I +     P++Y+G+S++ RNL + K 
Sbjct: 202 GIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLNEFKP 261

Query: 260 TEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVAGEKQ--- 316
           T                +V     + ++F+G  P+SG +F L NE V+ Q+    KQ   
Sbjct: 262 TASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNH 321

Query: 317 ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELK-VHIMDQFYLGGLSSLK 375
           ++ F K AF  E ++S  ++ I  S  L  G I  Y  GSE + VH +D+F LGGL+SLK
Sbjct: 322 DNNFNKTAFHLEHHASHWKDKITRSFQLQGGGI--YPLGSEAQTVHPLDRFQLGGLNSLK 379

Query: 376 GFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERGIPEDLATA 435
           GF  N VGT G N FYK+    S  +  TP  SPLRLQ F N G+  +  + I    A A
Sbjct: 380 GFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNSYAAA 439

Query: 436 TGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
           TG+SLVY++  A LDLTYA PL+ R QD++KPG S GVS+ + 
Sbjct: 440 TGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  143 bits (360), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 122/472 (25%), Positives = 218/472 (46%), Gaps = 33/472 (6%)

Query: 17  LAKVQTKPLFITSVYV-NDVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLM 75
           ++  +TKPL+I+ V V ND    PLS+S  +++L+ V+S P QN+ + L +   I++ L+
Sbjct: 17  ISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLL 76

Query: 76  YTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTT 135
           +TGLY+DV++TL  DK   + +   ++   + G+E  VP  A I+L     +P  LVT  
Sbjct: 77  FTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRL-----KPNDLVTNL 131

Query: 136 RDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKID-------EKLLSLKCLVPLQK 188
           + ++     +  S+N  +     +   +     F  K +       +K    + ++P  K
Sbjct: 132 QTTFTTTS-NDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTK 190

Query: 189 LPSMKAVFDINYALVDLFKQSWLPESDQHKQN-QIGFNIGIQEQQISSSKFRGPIIYSGI 247
           +PS++ V  ++ +           +   H Q     +  GIQ+  +       P+ YSG+
Sbjct: 191 VPSLRTVLSVDVS----------EDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGL 240

Query: 248 SILGRNLLDLKKTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNEAVL 307
           SI+    +   +                 ++    +++ K+LG+ P SG   NL NE VL
Sbjct: 241 SIVNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVL 300

Query: 308 GQTVAGEKQ-ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQF 366
            Q  +  K   +   +   ++E Y S L + +IT++ ++ G  F++      +   + + 
Sbjct: 301 SQLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGG--FQFPIDESTRSTFVGES 358

Query: 367 YLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSER 426
           +    S +K    N          +K  F SSF +P T L SPLRLQ      + F    
Sbjct: 359 WDKRNSLIKDIILNKSDMN-----FKCGFISSFKLPNTELDSPLRLQISALTENKFKGLA 413

Query: 427 GIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
              +  A  TG+SLVY++   ++ L+Y +PL   +   A  GFSF ++I Y 
Sbjct: 414 NYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITYC 465

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  118 bits (295), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 115/475 (24%), Positives = 215/475 (45%), Gaps = 44/475 (9%)

Query: 21  QTKPLFITSVYV-NDVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMYTGL 79
            TKP+++T V V N      LS++ +E+IL  V+S P ++++        I   L+ +GL
Sbjct: 10  DTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGL 69

Query: 80  YDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTT--TRD 137
           Y +V++ LD D+   + ++  +++ ++ G+E  VPI A + + P +  P     T  T +
Sbjct: 70  YKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTSN 129

Query: 138 SYAAAGIHLSSLNKFQQAE--TIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAV 195
           +  +  ++   +N F  ++  TI L  +LN T    +ID+K +  K  +PL +  S++ +
Sbjct: 130 TQNSVSLNRDWINLFGTSDTGTIKLSADLNQT--KSEIDKKSIDAKFTMPLLRNSSIRTI 187

Query: 196 FDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRN-- 253
            +   ++         P +D  KQ ++  NIG+ + ++       PI YSG++I  +   
Sbjct: 188 LESKCSIAK-------PRNDTMKQFEL--NIGLTKLKLIGGIKSLPIFYSGLNIQRKQTT 238

Query: 254 ---LLDLKKTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQT 310
              L D +                     + + +++ +    P  G  F L ++ VL +T
Sbjct: 239 LGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNET 298

Query: 311 VAGEKQ-ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMD----Q 365
            +   + +     +  S+E + S L + I +S       IF    G  L+    +    +
Sbjct: 299 NSISNEIKKNISNINMSFEKHISTLNDQITSSF------IFDGHVGVPLQSTFANLNSGE 352

Query: 366 FYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSE 425
           F+       K   +N +        +KV   SSF +P  P+ SP+R Q  V      N  
Sbjct: 353 FWDNEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLG---INKS 404

Query: 426 RGIPEDL---ATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAY 477
           + + E L   +  TG+SLVY+   + + L+Y +PL +   D    G SF V++ Y
Sbjct: 405 KRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 125/488 (25%), Positives = 213/488 (43%), Gaps = 58/488 (11%)

Query: 22  TKPLFITSVYVNDVKLSP-LSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMYTGLY 80
           TKPL+I+ V +        +S+S  +S+L PVLS P QNL++TL     IE KL  T L+
Sbjct: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80

Query: 81  DDVNITLD--QDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLS------LV 132
           +DV I+LD  Q  S  I    ++++  +  ++ P+PI A I + P   +PL        +
Sbjct: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPN--KPLVDPNYTWTI 138

Query: 133 TTTRDSYAAAGIHLSSLNKFQQAE-TIILQGELNCTPFSG-KIDEKLLSLKCLVPLQKLP 190
           +  +  ++ +   ++SLN+  Q         +L+ T +   K D   LS   LVP   + 
Sbjct: 139 SNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDG--LSTYPLVPFTSVK 196

Query: 191 SMKAVFDINYALVDLFKQS-----WLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYS 245
           S+  +     +L    +QS     +L ES   K  +    +G++    SS+ + G  I  
Sbjct: 197 SVSGI-----SLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVK----SSNLYTGLAING 247

Query: 246 GISILG-RNLLDLKKTEXXXXXXXXXXXXXXXYVFQILQNNKKFLGTLPISGWKFNLFNE 304
            I   G  N L L KT                 + +   +++ F+  +P  G  FN++ E
Sbjct: 248 AIKDEGNNNCLVLNKT----ILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYE 303

Query: 305 AVLGQTVAGEK------QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGT-------IFR 351
            VL      +K        S   +   ++E Y +  ++ I+ SL +  GT       +F 
Sbjct: 304 YVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFN 363

Query: 352 YKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLR 411
           +    E K    ++F +      +  ++N      G +FY V   +S  +      SPLR
Sbjct: 364 W----ETKRREANEFPVPSYLEERPHEKN-----DGIAFYNVCLNASVPLFSKCKFSPLR 414

Query: 412 LQAFVNAGDVFNSERGIPEDLATATG-ISLVYQSHLASLDLTYALPLSLRAQDVAKPGFS 470
            Q  +   + +N+     +     TG + LVY+S  A  D+ Y LP+   A    K GF+
Sbjct: 415 FQNSIQL-ERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFA 473

Query: 471 FGVSIAYM 478
              SI+++
Sbjct: 474 MNASISFL 481

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 80/173 (46%), Gaps = 16/173 (9%)

Query: 322 KVAFSYEGYSSFLRNHIIT-SLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQRN 380
           K         S++ +  IT S  +  G +    S   L VHI D+F  GG S ++GFQ  
Sbjct: 312 KTQLELNSVKSWMNDDFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSGGPSDIRGFQTF 371

Query: 381 SVGTR------GGNSFYKVAFKSSFHIPGTPL-ASPLRLQAFVNAGDVFNSERG------ 427
            +G R      GG++F          +P   +  S  RL  F N G + N +        
Sbjct: 372 GLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLVNHDNTSLGNCI 431

Query: 428 --IPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
             + ++ +T+TGI LV +  +A  +L + LP++    D+ + GF FG+ +A++
Sbjct: 432 GQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDLIRKGFQFGLGLAFL 484

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 16/173 (9%)

Query: 322 KVAFSYEGYSSFLRNHIIT-SLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQRN 380
           K  F      S+L +  IT S     G +    S   L VHI D+F  GG + ++ FQ  
Sbjct: 328 KTQFELNSVKSWLNDDFITFSTTFKTGYLKNISSQQSLPVHICDKFQSGGPNDIRSFQTF 387

Query: 381 SVGTR------GGNSFYKVAFKSSFHIPGTPL-ASPLRLQAFVNAGDVFNSERG------ 427
            +G R      GG++F          +P   +  S  RL  F N G + N +        
Sbjct: 388 GLGPRDLYDAIGGDAFVSYGVSMFSRLPWKKVEKSNFRLHWFFNGGKLINHDNTSLSNCI 447

Query: 428 --IPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
             +  + +T+TGI LV +  LA  +L ++LP++    D+ + GF FG+ +A++
Sbjct: 448 GQLSREHSTSTGIGLVLRHPLARFELNFSLPITAHENDLMRKGFQFGLGLAFL 500

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 27/203 (13%)

Query: 292 LPISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIIT-SLDLSFGTIF 350
            P  G    LFNE  LG           + K    +    S+L    IT S  +  G I 
Sbjct: 304 FPSRGQYIKLFNELSLGT----------YWKSILEFTDAKSWLDKDFITMSTTIKGGYIA 353

Query: 351 RYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSFYKVAFKSSFHIPGT 404
              S ++  +H+ D+F+ GG + ++GFQ+  +G R      GG++F          +P  
Sbjct: 354 NLNSDNKF-IHMKDKFHSGGSNDVRGFQQMGLGPRDIYDSIGGDTFVAYGISVFSRLPVN 412

Query: 405 PLA-SPLRLQAFVNAGDVFNSER----GIPEDLAT----ATGISLVYQSHLASLDLTYAL 455
             + S  RL  F+N G + N       G+ + L      ATGI ++++  +A  +L + L
Sbjct: 413 KWSNSGFRLHWFLNGGRLINHNNSDLSGVLDQLCMEHSIATGIGILFKHPVARFELNFTL 472

Query: 456 PLSLRAQDVAKPGFSFGVSIAYM 478
           PL+  + D  + GF +G+ ++++
Sbjct: 473 PLAAHSSDSVRKGFQYGIGLSFL 495

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 95/203 (46%), Gaps = 29/203 (14%)

Query: 293 PISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIIT-SLDLSFGTIFR 351
           P  G    L NE  LG+          F K    +   +S+  N  IT +  L  G I  
Sbjct: 305 PTRGNYAKLLNELALGK----------FWKTTLEFSQTNSWFTNDFITMTGTLKGGYISN 354

Query: 352 YKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSF--YKVAFKSSFHIPG 403
           +   S+  +H+ D+F+ GG + ++GFQ   +G +      GG++F  Y V+  S   +  
Sbjct: 355 FHPKSQ-PLHMGDKFHNGGSNDVRGFQAMGLGPKDLYDSMGGDAFVAYGVSLFSRLPVR- 412

Query: 404 TPLASPLRLQAFVNAGDVFNSE--------RGIPEDLATATGISLVYQSHLASLDLTYAL 455
               S  RL  FVN G + N          + + ++ +T+TG+ LV++  +A  +L + +
Sbjct: 413 RWYESNFRLHWFVNGGRLINHNNTNLSSCIKSLAQEHSTSTGVGLVFKHPVARFELNFTV 472

Query: 456 PLSLRAQDVAKPGFSFGVSIAYM 478
           P+S  + D  + GF +G+ + ++
Sbjct: 473 PISAHSSDSVRKGFQYGIGLTFL 495

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 78/173 (45%), Gaps = 16/173 (9%)

Query: 322 KVAFSYEGYSSFLRNHIIT-SLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQRN 380
           K         S+L +  IT S     G +    S   L VHI D+F  GG + ++ FQ  
Sbjct: 312 KTQLELNNVKSWLNDDFITFSTTFKTGYLKNISSQQSLPVHICDKFQNGGPNDIRSFQTF 371

Query: 381 SVGTR------GGNSFYKVAFKSSFHIPGTPL-ASPLRLQAFVNAGDVFNSER------- 426
            +G R      GG++F          +P   +  S  RL  F N G + N +        
Sbjct: 372 GLGPRDLYDAIGGDAFVSYGVSVFSRLPWKKVQKSNFRLHWFFNGGKLINHDNMSLSNCI 431

Query: 427 -GIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
             + ++ +T+TGI LV +  +A  +L ++LP++    D+ + G  FG+ +A++
Sbjct: 432 GQLSKEHSTSTGIGLVLRHPMARFELNFSLPIAAHENDLMRKGLQFGIGLAFL 484

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 16/173 (9%)

Query: 322 KVAFSYEGYSSFLRNHIIT-SLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQRN 380
           K         S+L +  IT S     G +    S   L +HI D+F  GG + ++ FQ  
Sbjct: 312 KTQLELNNVKSWLNDDFITFSTTFKTGYLENISSQRSLPIHICDKFQSGGPNDIRSFQTF 371

Query: 381 SVGTR------GGNSFYKVAFKSSFHIPGTPLA-SPLRLQAFVNAGDVFNSER------- 426
            +G R      GG++F          +P   +  S  RL  F N G + N +        
Sbjct: 372 GLGPRDLYDTIGGDAFVSYGVSVFSRLPWEKVKKSNFRLHWFFNGGKLINHDNMSLSNCM 431

Query: 427 -GIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
             + ++ +T+TG+ LV +  +A  +L ++LP++    D+ + GF FG+ + ++
Sbjct: 432 GRLSKEHSTSTGLGLVLRHPMARFELNFSLPIAAHENDLMRKGFQFGLGLVFL 484

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 66/134 (49%), Gaps = 15/134 (11%)

Query: 360 VHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSFYKVAFKSSFHIPGTPLA-SPLRL 412
           +HI D+F+ GG + ++GFQ   +G +      GG++F          +P    A S  RL
Sbjct: 362 IHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAFLTYGLSLFSRLPVQRWAGSDFRL 421

Query: 413 QAFVNAGDVFNSERGIPEDLAT--------ATGISLVYQSHLASLDLTYALPLSLRAQDV 464
             F+N G + +       D+ T        + G  L++Q  +A  +L + LPL+  + D 
Sbjct: 422 HWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLLFQHPVARFELNFTLPLATHSSDT 481

Query: 465 AKPGFSFGVSIAYM 478
           A+ GF +G+ ++++
Sbjct: 482 ARKGFQYGIGVSFL 495

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 87/202 (43%), Gaps = 27/202 (13%)

Query: 293 PISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRY 352
           P  G  F L NE  LG+          + K  F      S+ +N  IT+     G     
Sbjct: 276 PNRGNLFKLNNEVALGK----------YWKSQFELSKVQSWFKNDFITTTTTLKGGYLGN 325

Query: 353 KSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSF--YKVAFKSSFHIPGT 404
               +  +HI D+F  GG + ++ FQ   VG +      GG++F  Y V+  S   I   
Sbjct: 326 FHPDKKTLHINDKFMSGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYGVSIFSKLPIKKF 385

Query: 405 PLASPLRLQAFVNAGDVFNSE--------RGIPEDLATATGISLVYQSHLASLDLTYALP 456
              S  RL  F N G + N +          +    +T+ G  +V +  +A  +L ++LP
Sbjct: 386 E-DSHFRLHWFFNGGKLINHQNKPVIDTLHDLSRQHSTSVGCGIVLRHPVARFELNFSLP 444

Query: 457 LSLRAQDVAKPGFSFGVSIAYM 478
           L++  +D  + GF FG+ ++++
Sbjct: 445 LTVSTEDSLRKGFQFGLGMSFL 466

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 88/209 (42%), Gaps = 41/209 (19%)

Query: 293 PISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYE-GYSSFLRNHIITSLDLSFGTIFR 351
           P SG  +   NE  LG+          F K    Y    S F RN I  S  +  G I  
Sbjct: 302 PSSGQMWKFINEVSLGK----------FWKTNLEYNFTKSWFNRNFITMSSTVKAGYIHN 351

Query: 352 YKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNS--------FYKVAFKS 397
           + + +   +H+ D+FY GG + ++ FQ   +G +      GG++        F ++ FK 
Sbjct: 352 FHAKT-YPLHLADKFYNGGSNDVRSFQLMGLGPKDIYDYVGGDTSLSYGLSLFSRLPFKR 410

Query: 398 SFHIPGTPLASPLRLQAFVNAGDVFNSERGIPEDL--------ATATGISLVYQSHLASL 449
            +        S  RL  F N G + N       D         + +TG  LV++  +A  
Sbjct: 411 FY-------DSNFRLHLFFNGGRLINRNNANTTDTLMQMLSQHSLSTGFGLVFRHPVARF 463

Query: 450 DLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
           +L + +P++    D  + GF +G+ I+++
Sbjct: 464 ELNFTVPITAHTSDATRKGFQYGIGISFL 492

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 93/205 (45%), Gaps = 29/205 (14%)

Query: 292 LPISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIIT-SLDLSFGTIF 350
           +P  G    +FNE  L +          + K         SFL+N +IT +  +  G I 
Sbjct: 285 IPTYGSFLKVFNEVALNR----------YLKSQIEVNTAMSFLKNSLITVNGTMRLGYIS 334

Query: 351 RYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSFYKVAFKSSFHIP-G 403
              S +   +HI D+F LGG + ++ FQ   +G +      GGNS+          +P  
Sbjct: 335 NISS-TLRPLHIGDRFQLGGGNDVRSFQPMGLGPKDIYDSIGGNSYTAYGISVFTALPFK 393

Query: 404 TPLASPLRLQAFVNAGDVFNSE----------RGIPEDLATATGISLVYQSHLASLDLTY 453
           + + S  ++  F+N G + N            + + ++ + +TG+ ++++  +A  +L +
Sbjct: 394 SLMTSNFKIHTFINGGKLINHNSSNGTFTDAVKDLIKENSLSTGVGIIFKHPVARFELNF 453

Query: 454 ALPLSLRAQDVAKPGFSFGVSIAYM 478
            LPL     D+ + GF +G+ I+++
Sbjct: 454 TLPLITHKSDMVRKGFQYGIGISFL 478

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 92/211 (43%), Gaps = 26/211 (12%)

Query: 292 LPISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIF- 350
            P +G  F  FNE       +       F K    +    S+L N  IT ++ +F T + 
Sbjct: 283 FPSNGQLFKWFNELNFIGNRSSTANGGPFWKNQLEFTQIRSWLPNDFIT-MNCTFRTGYI 341

Query: 351 -------RYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSF--YKVAF 395
                    + GS   +HI D+F  GG + ++ FQ   +G +      GG++F  Y ++ 
Sbjct: 342 KQLLTKNEVQKGSSSFLHISDKFQNGGPNDIRSFQTMGLGPKDIFNSIGGDAFVSYGISI 401

Query: 396 KSSFHIPGTPLASPLRLQAFVNAGDVFNSE--------RGIPEDLATATGISLVYQSHLA 447
            S   I      S  RL  F+N G + N            +    + +TG+ ++ +  +A
Sbjct: 402 FSKLPIKDWS-KSNFRLHWFLNGGKLINHNGMSINNCFTDLSRQHSISTGVGILLRHPMA 460

Query: 448 SLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
             +L +++PL++   D  + GF FGV ++++
Sbjct: 461 RFELNFSVPLTIHQGDDVRKGFQFGVGLSFL 491

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 82/184 (44%), Gaps = 18/184 (9%)

Query: 311 VAGEKQESGFGKVAFSYEGYSSFLRNHIIT-SLDLSFGTIFRYKSGSELKVHIMDQFYLG 369
           +  E   S + K  F      S+ +N   T S  L  G I  + +   L  HI D+F+ G
Sbjct: 314 LTNELSPSKYWKCFFEASKVKSWRKNDFFTASFTLKGGYINNFSASKPL--HISDKFHNG 371

Query: 370 GLSSLKGFQRNSVGTR------GGNSFYKVAFKSSFHIPGTPLA-SPLRLQAFVNAGDVF 422
           G + ++ FQ   +G +      GG++F          +P    + S  RL AF N   + 
Sbjct: 372 GSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSLFSRLPFKRWSDSNFRLHAFFNGARLI 431

Query: 423 NSE--------RGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVS 474
           N+           +  + +T+TGI LV    +A  +L + +PL+    D A+ GF +G+ 
Sbjct: 432 NTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGIPLTAHTSDSARKGFQYGIG 491

Query: 475 IAYM 478
           ++++
Sbjct: 492 LSFL 495

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 77/163 (47%), Gaps = 17/163 (10%)

Query: 332 SFLRNHIIT-SLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR----- 385
           SF R+  IT +     G I  +   S+  +H  D+F  GG + ++GFQ   +G +     
Sbjct: 342 SFFRDDFITMACTFKTGYIHNFFPNSK-AIHRNDKFQNGGANDIRGFQFMGLGPKDRFDS 400

Query: 386 -GGNSFYKVAFKSSFHIPGTPL-ASPLRLQAFVNAGDVFNSE--------RGIPEDLATA 435
            GG++F    F     IP      S  R   FVN G + NS           + +  + +
Sbjct: 401 VGGDAFISYGFSVMNKIPIWKFYDSNFRFHWFVNGGKLINSNGKGLLNTFNDLSKQNSMS 460

Query: 436 TGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
            G+ +V++  +A  +L +A+P+   + D+ + GF +G+ ++++
Sbjct: 461 VGMGIVFRHPMARFELNFAIPVVTHSGDITRKGFQYGIGLSFL 503

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 94/202 (46%), Gaps = 29/202 (14%)

Query: 293 PISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRY 352
           P  G     FNE  +G+          + K         S+  N  +T +  +F T + +
Sbjct: 273 PNRGQSLKWFNELSVGR----------YWKNQLELSHLKSWFDNDFVT-MSCNFKTGYIH 321

Query: 353 KSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSF--YKVAFKSSFHIPGT 404
              S+  VHI D+F  GG + ++ FQ   +G +      GG++F  Y V+  S   I   
Sbjct: 322 SLSSQ-SVHISDKFQSGGPNDIRSFQSMGLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKW 380

Query: 405 PLASPLRLQAFVNAGDVFNSE-RGIPEDLA-------TATGISLVYQSHLASLDLTYALP 456
             AS  RL  F+N G++ +   + + + LA       T+ G+ ++ +  +A  +L +++P
Sbjct: 381 S-ASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAGVGIILRHPMARFELNFSVP 439

Query: 457 LSLRAQDVAKPGFSFGVSIAYM 478
           L++ + D  + G  FGV ++++
Sbjct: 440 LTMHSGDDVRKGLQFGVGLSFL 461

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 94/202 (46%), Gaps = 29/202 (14%)

Query: 293 PISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRY 352
           P  G     FNE  +G+          + K         S+  N  +T +  +F T + +
Sbjct: 273 PNRGQSLKWFNELSVGR----------YWKNQLELSHLKSWFDNDFVT-MSCNFKTGYIH 321

Query: 353 KSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSF--YKVAFKSSFHIPGT 404
              S+  VHI D+F  GG + ++ FQ   +G +      GG++F  Y V+  S   I   
Sbjct: 322 SLSSQ-SVHISDKFQSGGPNDIRSFQSMGLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKW 380

Query: 405 PLASPLRLQAFVNAGDVFNSE-RGIPEDLA-------TATGISLVYQSHLASLDLTYALP 456
             AS  RL  F+N G++ +   + + + LA       T+ G+ ++ +  +A  +L +++P
Sbjct: 381 S-ASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAGVGIILRHPMARFELNFSVP 439

Query: 457 LSLRAQDVAKPGFSFGVSIAYM 478
           L++ + D  + G  FGV ++++
Sbjct: 440 LTMHSGDDVRKGLQFGVGLSFL 461

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 89/204 (43%), Gaps = 29/204 (14%)

Query: 292 LPISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFR 351
            P++G    + NE  L +          F K +F +    S+  N   T+     G    
Sbjct: 305 FPLAGSFLKISNEIALNK----------FWKSSFEFSNVRSWCNNDFFTASGTVKGGYIN 354

Query: 352 YKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSF--YKVAFKSSFHIPG 403
                   +H+ D+F+ GG + ++ FQ   +G +      GG++F  Y V+  S   I  
Sbjct: 355 NFHPQTKPLHVSDKFHNGGSNDVRSFQLMGLGPKDLYDSMGGDAFVSYGVSIFSRLPIKR 414

Query: 404 TPLASPLRLQAFVNAGDVFNSERGIP---------EDLATATGISLVYQSHLASLDLTYA 454
               S  RL AF N   + N+  G P          + +T+TG+ LV+   +A  +L + 
Sbjct: 415 WS-ESNFRLHAFFNGARLINTN-GTPFKSSLSTLASEHSTSTGVGLVFGHPVARFELNFC 472

Query: 455 LPLSLRAQDVAKPGFSFGVSIAYM 478
           +PL+  + D  + GF +G+ ++++
Sbjct: 473 VPLTAHSSDSIRKGFQYGIGLSFL 496

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 81/164 (49%), Gaps = 21/164 (12%)

Query: 332 SFLRNHIIT-SLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR----- 385
           S+L++  IT S  + FG I   K+ S+  +H  D+F  GG + ++ FQ   +G R     
Sbjct: 303 SWLKDDFITMSNTIKFGYI---KNLSQDYIHFTDKFQNGGPNDIRSFQSMGIGPRHNSYS 359

Query: 386 -GGNSF--YKVAFKSSFHIPGTPLASPLRLQAFVNAG--------DVFNSERGIPEDLAT 434
            GG++F  Y V+  S   I      S  RL  F N G         ++N  + +  + +T
Sbjct: 360 LGGDAFLSYGVSIFSKLPIQKFH-DSNFRLHWFFNGGKLINHDNASIWNCMQNLTIENST 418

Query: 435 ATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
           + G+ +V +  +A  ++ +A+P++    D+ + GF FG+   ++
Sbjct: 419 SAGVGVVLRHPMARFEMNFAVPITDHQDDLTRKGFQFGLGFEFL 462

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 87/196 (44%), Gaps = 27/196 (13%)

Query: 299 FNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIIT-SLDLSFGTIFRYKSGSE 357
           F  +NE  LG+          F K         S+ R+  +T +  L  G I  +   S+
Sbjct: 308 FRWYNELSLGK----------FWKSQIELSKAQSWFRDDWLTVNGTLKTGYIHNFHPTSQ 357

Query: 358 LKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSFYKVAFKSSFHIPGTPLA-SPL 410
             ++I D+F  GG + ++ FQ   +G +      GG++F          +P   ++ S  
Sbjct: 358 -SLNICDKFQNGGGNDVRSFQYMGLGPKDIYDSIGGDAFVSYGVSVFTRLPFHKISHSNF 416

Query: 411 RLQAFVNAGDVFNSERGIPEDL--------ATATGISLVYQSHLASLDLTYALPLSLRAQ 462
           RL  F+N G + N      +D+        +T+ G  LV +  +A  +L +ALP++    
Sbjct: 417 RLHWFLNGGKLINHNNSSLQDVIKNLSTQHSTSIGFGLVLKHPVARFELNFALPVTCHTG 476

Query: 463 DVAKPGFSFGVSIAYM 478
           D  + GF +G+ ++++
Sbjct: 477 DCIRKGFQYGIGLSFL 492

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 67/134 (50%), Gaps = 15/134 (11%)

Query: 360 VHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSFYKVAFKSSFHIPGTPLA-SPLRL 412
           +HI D+F+LGG + ++GFQ   +G +      GG+ F          +P    + S  RL
Sbjct: 345 LHISDKFHLGGSNDVRGFQLMGLGPKQINDAIGGDMFSAYGISLFSKLPFKKFSDSNFRL 404

Query: 413 QAFVNAGDVFNSE--------RGIPEDLATATGISLVYQSHLASLDLTYALPLSLRAQDV 464
            AF N G + N          + + ++ + A G  ++++  +A  +L + LPL+  + D 
Sbjct: 405 HAFFNGGKLVNQNTNTFDRNLQSLFKENSLAIGTGIIFKHPVARFELNFTLPLTSYSTDH 464

Query: 465 AKPGFSFGVSIAYM 478
            + GF +G+ ++++
Sbjct: 465 VRKGFQYGIGMSFL 478

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 27/202 (13%)

Query: 293 PISGWKFNLFNEAVLGQTVAGEKQESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRY 352
           P  G    L NE  +GQ          F K        +S+L++  + S         + 
Sbjct: 304 PSRGSLLKLTNELAIGQ----------FWKGQIEVSQNNSWLKDDFLGSCCTLRSGYIQN 353

Query: 353 KSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR------GGNSF--YKVAFKSSFHIPGT 404
            S S   ++  D+F+ GG + ++ F    +G +      GG++F  Y V+F S   I   
Sbjct: 354 LSSSRKPINTFDKFHNGGANDIRSFHIMGLGPKDLYDSIGGDAFVAYGVSFFSRLPIKRW 413

Query: 405 PLASPLRLQAFVNAGDVFNSERG----IPEDLA----TATGISLVYQSHLASLDLTYALP 456
              S  RL  F N G + N        I E LA    T+ G  ++ +  +A  +L + LP
Sbjct: 414 S-HSNFRLHWFFNGGKLINHNNAPFTNILEQLASEHSTSVGFGILLRHQVARFELNFTLP 472

Query: 457 LSLRAQDVAKPGFSFGVSIAYM 478
           L+  + D  + GF +G+ I+++
Sbjct: 473 LTCHSGDALRKGFQYGIGISFL 494

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 77/166 (46%), Gaps = 22/166 (13%)

Query: 331 SSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTR----- 385
           S F R+ I  S  L  G I +  + ++  +H  D+F  GG + ++ FQ N +G R     
Sbjct: 295 SWFPRDFITLSTTLRSGYI-KNLNPAKSYIHFTDKFQNGGPNDVRNFQLNGIGPRHMHHS 353

Query: 386 -GGNSFYKVAFKSSFHIPGTPLA----SPLRLQAFVNAGDVFNSE--------RGIPEDL 432
            GG++F  +A+  S      PL     S  RL  + N G + N          R +  + 
Sbjct: 354 MGGDAF--IAYGVSL-FSKIPLKRFQDSNFRLHWYFNGGKLINHNNLPIHTLLRELTLEH 410

Query: 433 ATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478
           +T+ G  +V +  +A  +L + +PL+    D+ + GF FG+   ++
Sbjct: 411 STSIGAGIVMRHPMARFELNFGVPLTSHVGDLQRKGFQFGLGFEFL 456

>CAGL0J06424g Chr10 complement(614059..616977) [2919 bp, 972 aa]
           {ON} highly similar to uniprot|P53091 Saccharomyces
           cerevisiae YGL201c MCM6
          Length = 972

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 46/102 (45%), Gaps = 15/102 (14%)

Query: 292 LPISGWKFNLFNEAVLGQTVAGEK--------------QESGFGKVAFSYEGYSSFLRNH 337
           +P+ GW+   FN     + V GEK              Q S  G++   Y     F++ +
Sbjct: 91  MPMQGWRKRTFNHIKKVEDVTGEKVREAFEQFLDEFTIQSSDTGELQKVYRAQIEFMKLY 150

Query: 338 IITSLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKGFQR 379
            +++L + +  +   ++G+ L + I +Q+Y      +KG +R
Sbjct: 151 DLSTLYIDYQHLSMRENGA-LAMAISEQYYRFSPFLIKGLKR 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,753,668
Number of extensions: 2049062
Number of successful extensions: 5235
Number of sequences better than 10.0: 37
Number of HSP's gapped: 5306
Number of HSP's successfully gapped: 38
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)