Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47317.342ON51425510001e-130
ACL157C7.342ON5152576863e-83
SAKL0F10934g7.342ON4982575763e-67
Kwal_56.246107.342ON5082585685e-66
KLLA0C16731g7.342ON4781465658e-66
TDEL0C020507.342ON5011775529e-64
Skud_4.947.342ON4472565243e-60
YDL161W (ENT1)7.342ON4542565244e-60
KLTH0H01430g7.342ON5022575266e-60
CAGL0A03872g7.342ON5101465213e-59
Smik_12.2647.342ON6121465266e-59
Smik_4.757.342ON4601805132e-58
YLR206W (ENT2)7.342ON6131465213e-58
Suva_10.3007.342ON6181465171e-57
Suva_4.837.342ON4621485072e-57
Skud_12.2707.342ON6261705162e-57
NCAS0H006707.342ON4831485072e-57
Kpol_2001.707.342ON5331435024e-56
TBLA0E004807.342ON5991565002e-55
ZYRO0F11550g7.342ON5381444893e-54
NDAI0D006107.342ON4861534838e-54
KNAG0C038007.342ON4471724772e-53
TPHA0D045607.342ON4872564751e-52
KAFR0B008907.342ON4141424647e-52
KAFR0L014607.342ON5501364562e-49
TBLA0E020407.342ON7011544533e-48
KNAG0B026507.342ON6461404417e-47
Kpol_1001.24.346ON4181442691e-24
TPHA0B004004.346ON3991442662e-24
Kwal_47.168574.346ON3821532652e-24
KNAG0M003804.346ON4031532653e-24
KLTH0D16896g4.346ON4011442643e-24
NDAI0D032004.346ON4351442645e-24
AER155C4.346ON3641442581e-23
KLLA0B04587g4.346ON4001442582e-23
TDEL0D007104.346ON3751532562e-23
TBLA0E047604.346ON4261442564e-23
SAKL0G17952g4.346ON4151442555e-23
Smik_10.4184.346ON4091442539e-23
YJR125C (ENT3)4.346ON4081442531e-22
NCAS0A062104.346ON4231442522e-22
KAFR0B067404.346ON3991532512e-22
Skud_10.3494.346ON4101532493e-22
Suva_12.2164.346ON4101442484e-22
ZYRO0B14784g4.346ON4241442485e-22
Ecym_11334.346ON3921562244e-19
CAGL0H04323g4.346ON4121442193e-18
KLTH0E05874g4.17ON2551471832e-14
SAKL0H25762g4.17ON2621461771e-13
Kwal_55.206114.17ON2541471742e-13
Kpol_388.54.17ON2681481567e-11
TBLA0B062204.346ON3391441516e-10
TDEL0G017404.17ON2571461461e-09
TPHA0F002304.17ON2801461452e-09
ACL061C4.17ON2341361406e-09
Skud_12.304.17ON2471291371e-08
Suva_10.354.17ON2471291343e-08
ZYRO0G07876g4.17ON2591361344e-08
Ecym_84074.17ON2541361292e-07
TBLA0G006504.17ON4231511312e-07
NCAS0C058404.17ON2671281248e-07
NDAI0J009308.335ON4181691205e-06
KLLA0D03949g4.17ON2251381175e-06
KLLA0D16654g8.335ON3991651196e-06
KAFR0B058008.335ON3821661152e-05
NDAI0H002804.17ON3101521132e-05
TBLA0H012108.335ON4911681143e-05
NCAS0B036608.335ON4161661133e-05
ZYRO0F13684g8.335ON4071671134e-05
Kpol_344.88.335ON3841761124e-05
KNAG0A051008.335ON4211781091e-04
YLL038C (ENT4)4.17ON2471111061e-04
Smik_12.194.17ON247931052e-04
Kwal_YGOB_27.112618.335ON4041671062e-04
CAGL0E01199g8.335ON4121671053e-04
CAGL0E03806g4.17ON260981034e-04
KLTH0G11902g8.335ON3991671044e-04
YDR153C (ENT5)8.335ON4111761044e-04
TDEL0F045908.335ON3611671035e-04
Smik_4.3988.335ON4161761036e-04
Suva_2.3158.335ON4031761027e-04
Skud_4.4128.335ON4061761028e-04
AGR046C8.335ON3871671000.001
KAFR0I014604.17ON275152970.002
Kwal_27.11263singletonOFF275167970.002
TBLA0A040408.335ON415167970.003
Kpol_1036.768.335ON368164930.009
Skud_8.2255.84ON621137920.013
SAKL0H15290g8.335ON393167910.015
Smik_8.2455.84ON627134910.018
SAKL0H02530g5.84ON669120900.027
TPHA0C007408.335ON385189880.032
YHR161C (YAP1801)5.84ON637134890.034
TBLA0B057705.84ON680114780.64
Ecym_42648.335ON40877732.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4731
         (514 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   389   e-130
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   268   3e-83
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   226   3e-67
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   223   5e-66
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   222   8e-66
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   217   9e-64
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   206   3e-60
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   206   4e-60
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   207   6e-60
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   205   3e-59
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   207   6e-59
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   202   2e-58
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   205   3e-58
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   203   1e-57
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   199   2e-57
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   203   2e-57
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    199   2e-57
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   197   4e-56
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   197   2e-55
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   192   3e-54
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   190   8e-54
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   188   2e-53
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   187   1e-52
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   183   7e-52
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   180   2e-49
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   179   3e-48
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   174   7e-47
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...   108   1e-24
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...   107   2e-24
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...   106   2e-24
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...   106   3e-24
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...   106   3e-24
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...   106   5e-24
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...   103   1e-23
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...   103   2e-23
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...   103   2e-23
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...   103   4e-23
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...   102   5e-23
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...   102   9e-23
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...   102   1e-22
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...   101   2e-22
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...   101   2e-22
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...   100   3e-22
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...   100   4e-22
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...   100   5e-22
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    91   4e-19
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    89   3e-18
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    75   2e-14
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    73   1e-13
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    72   2e-13
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    65   7e-11
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    63   6e-10
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    61   1e-09
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    60   2e-09
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    59   6e-09
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    57   1e-08
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    56   3e-08
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    56   4e-08
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    54   2e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    55   2e-07
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    52   8e-07
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    51   5e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    50   5e-06
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    50   6e-06
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    49   2e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    48   2e-05
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    49   3e-05
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    48   3e-05
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    48   4e-05
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    48   4e-05
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    47   1e-04
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    45   1e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    45   2e-04
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    45   2e-04
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    45   3e-04
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    44   4e-04
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    45   4e-04
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    45   4e-04
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    44   5e-04
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    44   6e-04
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    44   7e-04
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    44   8e-04
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    43   0.001
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    42   0.002
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    42   0.002
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    42   0.003
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    40   0.009
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    40   0.013
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    40   0.015
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    40   0.018
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    39   0.027
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    39   0.032
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    39   0.034
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    35   0.64 
Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}...    33   2.0  

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  389 bits (1000), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 194/255 (76%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALXXXXXX 180
           QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRAL      
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALEESRIT 180

Query: 181 XXXXXXXXXXXXXXXDAEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
                          DAEELQAA                                     
Sbjct: 181 AEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQVQY 240

Query: 241 XXXPMYYDIFGNPIT 255
              PMYYDIFGNPIT
Sbjct: 241 QQQPMYYDIFGNPIT 255

 Score =  301 bits (770), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 150/187 (80%)

Query: 328 GVNNPFSLNNMHKLESENYEKTASTSFGSPPGGTAGRXXXXXXXXXXXXXXXXXXXXXXX 387
           GVNNPFSLNNMHKLESENYEKTASTSFGSPPGGTAGR                       
Sbjct: 328 GVNNPFSLNNMHKLESENYEKTASTSFGSPPGGTAGRSSSSTPLQQQPPQKPFPQTQPPS 387

Query: 388 XXXXXXXXXXXXXXATRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTET 447
                         ATRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTET
Sbjct: 388 QSQSQPQSQPQQLQATRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTET 447

Query: 448 FINSHGTGFKQVSNEPPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQ 507
           FINSHGTGFKQVSNEPPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQ
Sbjct: 448 FINSHGTGFKQVSNEPPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQ 507

Query: 508 GMSLIDL 514
           GMSLIDL
Sbjct: 508 GMSLIDL 514

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  268 bits (686), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 178/257 (69%), Gaps = 7/257 (2%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQLLRSAKNV+NGYS AQ+LVRNATSN+EYGPS+DQMEELAER+YSAVEFFEI+VMLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RL+DKPK+WRHVAKSLTVTD+LVRTGAE CVDWAREN+++ R+LTEF HVDES+G DHG
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQ-NVPETNPDGVDPDLKRALXXXX- 178
           Q+IRVKA+EL+ALLRD+ERL+EERN+RLGR  +N Q +VP    D +DPDL+RAL     
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAED-LDPDLQRALEESRI 179

Query: 179 XXXXXXXXXXXXXXXXXDAEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
                            D EEL+ A                                   
Sbjct: 180 TAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQP 239

Query: 239 XXXXXPMYYDIFGNPIT 255
                 MYYDIFGNPI+
Sbjct: 240 QA----MYYDIFGNPIS 252

 Score =  194 bits (493), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 125/193 (64%), Gaps = 6/193 (3%)

Query: 328 GVNNPFSLNNMHKLESENYEKTA---STSFGSPPGGTAGRXXXXXXXXXXXXXXXXXXXX 384
           G NNPFSL NMHKL S+  + +    ST+ G P   ++                      
Sbjct: 323 GPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRASSSPSLPQQKQQPQVLQQPGQHSS 382

Query: 385 XXXXXXXXXXXXXXXXXATRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTK 444
                             TRTGNQSI+DKY ELN LLA+GTG+DTFGNTGQ RI +QHTK
Sbjct: 383 PVPQLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTK 442

Query: 445 TETFINSHGTGFKQVSNEPPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNA-SSFQQT--A 501
           T TFINS GTG+KQV NEPPKHNPF+ TQYTGLPSTN+VPSHTGYGFGNA + FQQ+  +
Sbjct: 443 TGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNS 502

Query: 502 SKPNDQGMSLIDL 514
           +KPN+Q +SLID+
Sbjct: 503 NKPNEQNISLIDI 515

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  226 bits (576), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/257 (49%), Positives = 156/257 (60%), Gaps = 13/257 (5%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSK LLR+AKNV+NGYS  QVLVRNATSN+  GP++DQ++ELAE+TY  VEFFEIM MLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK KNWRHVAKSLTV DYLVR G+E CV W++EN++II+ L EF+H DE  G DHG
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDE-MGVDHG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDG--VDPDLKRALXXXX 178
           Q+IRVKAKEL +LLRD+ERL EERN+R  + ++     PE +  G   D DL+RAL    
Sbjct: 120 QIIRVKAKELTSLLRDEERLTEERNMR--KKRRGKTRRPERSRGGEEYDDDLQRALEESR 177

Query: 179 XXXXXXXXXXXXXXXXXDAEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
                            D ++ Q A                                   
Sbjct: 178 LTAEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQP-- 235

Query: 239 XXXXXPMYYDIFGNPIT 255
                 MYYD+FGNPIT
Sbjct: 236 ------MYYDVFGNPIT 246

 Score =  154 bits (388), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/125 (61%), Positives = 91/125 (72%), Gaps = 13/125 (10%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSIS KY +LN LLA+GTG+DTFGNTGQ RI +QHT+T  FINS GTG+KQV+N+
Sbjct: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPN-------------DQGM 509
            PK+NPFL  QYTGLPST++VPS+TGYGFGN     Q   +               DQG+
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNQQLSSQQGQQLQQQQQQQQQQRGNPDQGI 493

Query: 510 SLIDL 514
           SLIDL
Sbjct: 494 SLIDL 498

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  223 bits (568), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 123/258 (47%), Positives = 153/258 (59%), Gaps = 8/258 (3%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSK L+R AKNV+NGYS  QVL+R ATSND  GPSLD M+E+AER++ +V FFEIM MLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK KNWRHVAKSLTV DYLVR G+E CV WA+EN+++I+ L EF+H DE  G D G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDE-LGIDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALXXXXXX 180
           Q++RVKA+EL ALL DDERL+EER+LR    K  P+  P    +  D DL+RA+      
Sbjct: 120 QIVRVKARELTALLLDDERLREERSLRTKNRK--PRRRPTAGSE--DEDLQRAMEESRLT 175

Query: 181 XXXXXXXXXXXXXXXD--AEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXX 237
                          D  +++LQ A                                   
Sbjct: 176 AEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQ 235

Query: 238 XXXXXXPMYYDIFGNPIT 255
                 PMYYD+FGNPI+
Sbjct: 236 QTQAQQPMYYDVFGNPIS 253

 Score =  155 bits (392), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/115 (69%), Positives = 92/115 (80%), Gaps = 4/115 (3%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSI++K+ ELN LLA+GTG+DTFGNTGQ RI +QHTKT  FINS GTG+KQVS+ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS- 453

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPN---DQGMSLIDL 514
            PKHNPFL  QYTGLPSTN+VPS+TGYGFGN  +  Q     +   DQGMSLIDL
Sbjct: 454 TPKHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSNGADQGMSLIDL 508

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  222 bits (565), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 102/146 (69%), Positives = 124/146 (84%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSK  LRSAKN++NGYSQAQVLVR+ATSND+ GPS+DQ+EELAERT+  VEFFEIM MLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK +NWRHVAKSLT  D+LVR G+E CV W +EN++II+ L EF H DE +  D+G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 121 QLIRVKAKELIALLRDDERLKEERNL 146
           +++RVKAKEL ALLRD+ERLKEER +
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMM 146

 Score =  155 bits (391), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 68/92 (73%), Positives = 82/92 (89%)

Query: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463
           RTGNQSISDK+ ELN LLA+GTGIDTFGNTG+ R+ +QHTKT TFINS GTG+KQ++N+ 
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFGNAS 495
           PKHNPFLT+QYTG+PS+ I PS+TGYGFGN +
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFGNQA 451

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  217 bits (552), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 134/177 (75%), Gaps = 5/177 (2%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKNV+ GYS AQVLVRNAT+N+  GPS+D+++ELAE+TY +VEFFEIM M+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRH+AKSLTV DYLVR G+E CV W REN+++I+ L EF + D+  G D G
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRN-DDDGGVDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPET---NPDGVDPDLKRAL 174
           Q+IRVKAKEL  LL DDERL+EER +   +G+KN            DG D DL+RAL
Sbjct: 120 QIIRVKAKELTNLLSDDERLREEREMNR-KGRKNGTRRRRRTTGEQDGFDDDLQRAL 175

 Score =  154 bits (390), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 93/114 (81%), Gaps = 3/114 (2%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
            RTG+ ++++KYGELN LLATGTGIDTFGNTG ARI +QHTKT TFINS GTG++QV+ E
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPN--DQGMSLIDL 514
            PK NPFL +QYTG+PS+NIVP+HTGYGFGN  S Q  A +    DQG+SLIDL
Sbjct: 449 -PKKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQTADQGVSLIDL 501

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  206 bits (524), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 114/256 (44%), Positives = 142/256 (55%), Gaps = 18/256 (7%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN++ GYS  QVLVRNATSND +  S D + ELAE++Y + +FFEIM MLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRH+AK+LTV DYL+R G+E CV W +EN++II+ L EF H D+  G D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGVDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPET-NPDGVDPDLKRALXXXXX 179
           Q++RVKAKEL  LL DDERL EERN+ +    +  +    T   D  D DL+RA+     
Sbjct: 120 QIVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRM 179

Query: 180 XXXXXXXXXXXXXXXXDAEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
                            AEE +                                      
Sbjct: 180 T----------------AEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQ 223

Query: 240 XXXXPMYYDIFGNPIT 255
               PMYYDIFGNPIT
Sbjct: 224 QQQQPMYYDIFGNPIT 239

 Score =  162 bits (411), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 78/112 (69%), Positives = 92/112 (82%), Gaps = 1/112 (0%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQS++DKYG+LN LLATGTGIDTFGN G +R+ +QHTKT TFINS GTG++QVSN+
Sbjct: 337 TRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSND 396

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514
            PK NPFL +QYTGLPSTNIVP+ TGYGFGN    Q   ++ N QG +LIDL
Sbjct: 397 -PKQNPFLNSQYTGLPSTNIVPTQTGYGFGNQPQQQSQNNRSNSQGYTLIDL 447

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  206 bits (524), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 145/256 (56%), Gaps = 18/256 (7%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN++ GYS  QVLVRNATSND +  S D + ELAE++Y + +FFEIM MLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRH+AK+LTV DYL+R G+E CV W REN++II+ L EF H D+  G D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDD-EGIDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRL-GRGKKNPQNVPETNPDGVDPDLKRALXXXXX 179
           Q++RVKAKEL ALL DDERL EERN+ + GR +K  +       D  D DL+RA+     
Sbjct: 120 QIVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASRL 179

Query: 180 XXXXXXXXXXXXXXXXDAEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
                            AEE +                                      
Sbjct: 180 T----------------AEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQ 223

Query: 240 XXXXPMYYDIFGNPIT 255
               PMYYDIFGNPIT
Sbjct: 224 QLQQPMYYDIFGNPIT 239

 Score =  149 bits (376), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 75/111 (67%), Positives = 92/111 (82%), Gaps = 1/111 (0%)

Query: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463
           RTGNQS++DKY +LN LLATGTGIDTFGN G+ARI +QHTKT TFINS GTG++QVS++ 
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD- 403

Query: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514
           P HNPFL +QYTGLPST++VP+ TGYGFGN S  Q   +  N++G +LIDL
Sbjct: 404 PNHNPFLNSQYTGLPSTSVVPTQTGYGFGNQSQQQSQNNGSNNRGYTLIDL 454

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 244 PMYYDIFGNPIT 255
           PMYYD+FGNPIT
Sbjct: 263 PMYYDVFGNPIT 274

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  207 bits (526), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 153/257 (59%), Gaps = 8/257 (3%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSK L+R AKNV+NGYS  QVL+R ATSND  GPSLD M+E+AER++ +V FFEIM MLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK KNWRHVAKSLTV DYLVR G+E CV WA+EN++II+ L EF H DE +G D G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALXXXXXX 180
           Q++RVKA+EL ALL+D+ERL+EER L+     +N +     N D  D D++RAL      
Sbjct: 120 QIVRVKARELTALLQDEERLREERELK----GRNRRPRRRKNSDSYDDDMQRALEESRMT 175

Query: 181 XXXXXXXXXXXXXXXD--AEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
                          D  A++LQ A                                   
Sbjct: 176 AEQEEAERRRKLEMYDNSADDLQTA-LQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQ 234

Query: 239 XXXXXPMYYDIFGNPIT 255
                PMYYD+FGNPI+
Sbjct: 235 QQTQQPMYYDVFGNPIS 251

 Score =  161 bits (407), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 81/116 (69%), Positives = 97/116 (83%), Gaps = 4/116 (3%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQS++DK+ +LN LLA+GTG+DTFGNTGQ RI +QHTKT TFINS GTG+KQVSN 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 463 PP-KHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQT-ASKPN--DQGMSLIDL 514
           P  KHNPFL  QYTGLPST++VPS+TGYGFGN +  +QT  ++ N  DQG+SLIDL
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  205 bits (521), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 96/146 (65%), Positives = 117/146 (80%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           M  QL+RSAKN++ GYS  QV+VR+AT+ND   PS+  +E+LA++TY  VEFFEIM MLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W +EN++II+ L EF H DE SG+D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 121 QLIRVKAKELIALLRDDERLKEERNL 146
           Q+IRVKAKEL +LL DDERL+EER L
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERAL 146

 Score =  160 bits (406), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 84/90 (93%), Gaps = 1/90 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSISDKY ELN LLA+GTGIDTFGNTG+ARI +QHTKT TFINS GTG+KQV+NE
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFG 492
            PK+NPFL++QYTGLPSTNIVPSHTGYGFG
Sbjct: 421 -PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  207 bits (526), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 96/146 (65%), Positives = 120/146 (82%), Gaps = 1/146 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN+M GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNL 146
           Q+IRVKAKEL++LL DDERL+EER++
Sbjct: 120 QIIRVKAKELVSLLNDDERLREERSM 145

 Score =  155 bits (391), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 1/91 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSISDKY +LN LLATGTG DTFGNTG+ARI +QHTKT TFINS GTG+KQV NE
Sbjct: 429 TRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINE 488

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493
            PK+NPFL+ QYTGLPSTNIVP+ TGYGFGN
Sbjct: 489 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 518

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  202 bits (513), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 102/180 (56%), Positives = 128/180 (71%), Gaps = 11/180 (6%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN++ GYS  QVLVRNATSND +  S D + ELAE++Y + +FFEIM MLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRH+AK+LTV DYL+R G+E CV W +EN++II+ L EF H D+  G D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGIDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNL------RLGRGKKNPQNVPETNPDGVDPDLKRAL 174
           Q++RVK+KEL ALL DDERL EERN+      R GR ++        N    D DL+RAL
Sbjct: 120 QIVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDN----DNDLQRAL 175

 Score =  159 bits (403), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 78/112 (69%), Positives = 92/112 (82%), Gaps = 1/112 (0%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQS++DKY +LN LLATGTGIDTFGN G AR+ +QHTKT TFINS GTG+KQVSN+
Sbjct: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514
            PK+NPFL+ QYTGLPSTN+VP+ TGYGFGN    Q   +  N+QG +LIDL
Sbjct: 410 -PKYNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQSQNNHLNNQGYALIDL 460

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/12 (100%), Positives = 12/12 (100%)

Query: 244 PMYYDIFGNPIT 255
           PMYYDIFGNPIT
Sbjct: 228 PMYYDIFGNPIT 239

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  205 bits (521), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 120/146 (82%), Gaps = 1/146 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN+M GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNL 146
           Q+IRVKAKEL++LL D+ERL+EER++
Sbjct: 120 QIIRVKAKELVSLLNDEERLREERSM 145

 Score =  158 bits (399), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 83/91 (91%), Gaps = 1/91 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSISDKY +LN LLATGTGIDTFGNTG+ARI +QHTKT TFINS GTG+KQV+NE
Sbjct: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493
            PK+NPFL+ QYTGLPSTNIVP+ TGYGFGN
Sbjct: 488 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 517

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  203 bits (517), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 119/146 (81%), Gaps = 1/146 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN++ GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNL 146
           Q+IRVKAKEL++LL DDERL+EER +
Sbjct: 120 QIIRVKAKELVSLLNDDERLREERTM 145

 Score =  152 bits (383), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 1/91 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSISDKY +LN LLATGTG DTFGNTG++RI +QHTKT TFINS GTG+KQV NE
Sbjct: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493
            PK+NPFL +QYTGLPST+IVP+ TGYGFGN
Sbjct: 497 -PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  199 bits (507), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 93/148 (62%), Positives = 117/148 (79%), Gaps = 1/148 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQL+RSAKN++ GYS  QVLVRNATSND    S D + ELAE++Y + +FFEIM MLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRH+AK+LTV DYL+R G+E CV W +EN++II+ L EF H D+  GTD G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH-DDDEGTDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRL 148
           Q++RVKAKEL +LL D+ERL EERN+ +
Sbjct: 120 QIVRVKAKELTSLLSDEERLNEERNMNI 147

 Score =  160 bits (406), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 76/112 (67%), Positives = 89/112 (79%), Gaps = 1/112 (0%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQS++DKY +LN LL TGTGIDTFGN G  R+ +QHTKT TFINS GTG++QVSN+
Sbjct: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514
            PKHNPFL +QYTGLPSTN+VP+ TGYGFGN    Q   +  N QG +LIDL
Sbjct: 412 -PKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQSQTNGTNSQGYALIDL 462

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 3/170 (1%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           M KQ +RSAKN++ GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QLIRVKAKELIALLRDDERLKEER--NLRLGRGKKNPQNVPETNPDGVDP 168
           Q+IRVKAKEL++LL DDERL+EER  N R     K P+  P     G +P
Sbjct: 120 QIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNP 169

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 1/91 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSISDKY +LN LLATGTG+DTFGNTG+ARI +QHTKT TFINS GTG+KQV++E
Sbjct: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493
            PK+NPFL+ QYTGLPSTNIVP+ TGYGFGN
Sbjct: 514 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  199 bits (507), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 1/148 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN++ GYS  QVLVR+ATSND   PS + + ELA+R++ +V+FFEIM MLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W +EN++II+ L EF H D+  G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD-GGADQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRL 148
           Q+IRVKAKEL +LL D+ERLKEER + L
Sbjct: 120 QIIRVKAKELTSLLLDEERLKEERTINL 147

 Score =  158 bits (399), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 7/117 (5%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSI+DKY +LN LLATGTGIDTFGNTG+ RI +QHT+T TFINS GTG++QV+N+
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASS-----FQQTASKPNDQGMSLIDL 514
            PK+NPFL +QYTGLPSTNIV + TGYGFGNA S      QQ   +P DQG SLIDL
Sbjct: 429 -PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRP-DQGFSLIDL 483

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  197 bits (502), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 91/143 (63%), Positives = 115/143 (80%), Gaps = 1/143 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           M KQ +RSAKNV+ GYS  QV+VRNATSND  GP +D ++ LAE+TY +VEFFEIM MLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K W+H+AKSLTV DYLVR G+E CV W +EN++II+ L EF ++D+S   D G
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDH-DQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEE 143
           Q+IRVKAKEL +LL D+ERL++E
Sbjct: 120 QIIRVKAKELTSLLNDEERLRDE 142

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 1/91 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQ I+DK+GELN LLA+GTGIDTFGNTG+ARI +QHTKT TFINS GTG++QV+N+
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493
            PK+NPFL +QYTGLPSTNIVPSHTGYGFGN
Sbjct: 443 -PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  197 bits (500), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 122/156 (78%), Gaps = 3/156 (1%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ LRS KN++ GYS  Q+LVR+AT+NDE  PS+D ++++AE+TY +V+FFEIM MLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFV---HVDESSGT 117
           +RLNDK K W+HVAKSLTV DYL+R G+E CV W +EN+++I+ L EF     +D ++G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 118 DHGQLIRVKAKELIALLRDDERLKEERNLRLGRGKK 153
           D GQ++RV+A EL +LL DDERL+EER+L    G++
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRR 156

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 74/102 (72%), Positives = 83/102 (81%), Gaps = 1/102 (0%)

Query: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463
           RTGNQ ISDKY  LN LLATGTGIDTFGNTG  RI +QHT T TFINS GTG+KQ  N+ 
Sbjct: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIND- 529

Query: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPN 505
           PK+NPF++ QYTGLPSTN+VPS+TGYGFGN    Q TAS+PN
Sbjct: 530 PKNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQTTASQPN 571

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  192 bits (489), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 92/144 (63%), Positives = 113/144 (78%), Gaps = 1/144 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           M  Q +RSAKN + GY+ AQVLVR+AT+N+  GPS+D ++ELA R+Y +VEFFEIM M+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN++II+ L EF H D+ +  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGT-QDGG 119

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
           Q+IRVKAKEL  LL DDERL+ ER
Sbjct: 120 QIIRVKAKELTNLLMDDERLRMER 143

 Score =  147 bits (370), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 88/117 (75%), Gaps = 6/117 (5%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
            RTGNQSISDKY +LN LLA  TG+DTFGN G ARI +QHTKT TFINS GTGFKQ SNE
Sbjct: 423 VRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE 482

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN-----ASSFQQTASKPNDQGMSLIDL 514
            PK NPFL TQ+TG+P++++VPSHTGYGFGN         Q    +  DQG+SLIDL
Sbjct: 483 -PKKNPFLPTQFTGIPTSSVVPSHTGYGFGNQQAQNQQISQPPQQQQADQGVSLIDL 538

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  190 bits (483), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 118/153 (77%), Gaps = 2/153 (1%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKN+M GYS  QVLVR+ATSND   PS + + E+++R++ +V+FFEIM MLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K W+H+AKSLTV DYLVR G+E CV W ++N++II+ L EF   D++   D  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN--VDES 118

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKK 153
            +IRVKAKEL ALL+DDERLKEER++ L   ++
Sbjct: 119 SIIRVKAKELTALLQDDERLKEERSINLKNNRR 151

 Score =  152 bits (385), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 77/89 (86%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTGNQSISDKY ELN LLA+GTGIDTFGNTG  RI +QHT+T TFINS GTG+KQ+ N+
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGF 491
           P K NPFL  QYTGLPS+NIVPSHTGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  188 bits (477), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 127/172 (73%), Gaps = 3/172 (1%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN 64
           +LRSAKN++ GYS  +VLVR+AT+N+   PS + +++LA+++Y++VEFFEI+ MLD+R+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIR 124
           DK K WRHVAK+LTV DYLVR G+E CV W +EN++II+ L EF H D + G D G++IR
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED-AGGEDEGKIIR 119

Query: 125 VKAKELIALLRDDERLKEER--NLRLGRGKKNPQNVPETNPDGVDPDLKRAL 174
           VKAKEL +LL D+ERLKEER  N+R   G K          +  D DL+RA+
Sbjct: 120 VKAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAI 171

 Score =  140 bits (352), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 66/91 (72%), Positives = 78/91 (85%), Gaps = 1/91 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TR+GNQ+ISDKY  LN LLA+GTGIDTFGNTG+ RI +QHT+T TFINS GTG++QV+N+
Sbjct: 338 TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND 397

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493
             K NPFL  QYTGLPSTNIVP+ TG+GFGN
Sbjct: 398 -DKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 244 PMYYDIFGNPIT 255
           PMYYD+FGNPIT
Sbjct: 229 PMYYDVFGNPIT 240

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  187 bits (475), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/256 (44%), Positives = 148/256 (57%), Gaps = 20/256 (7%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MS Q +RS KNV+ GYS  QVLVRNAT+N+  GP++D + ++AE+TY + +FFEIM MLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESS-GTDH 119
           +RLNDK K W+H+AKSLTV DYLVR G+E CV W +EN+++I+ LTEF + DE+S G D 
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 120 GQLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALXXXXX 179
           GQ+IRVKAKEL ALL DDERL+EER L     +   +N      +G D DL+RAL     
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLN--NRRDRNRNRRPPARNGSDEDLQRAL---EE 175

Query: 180 XXXXXXXXXXXXXXXXDAEELQAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
                           D  +LQAA                                    
Sbjct: 176 SRRTAEEDERKRRLNQDDSDLQAA--------------LQLSKEEEELKRLQELQSSMHM 221

Query: 240 XXXXPMYYDIFGNPIT 255
               P+YYD+FGNPI+
Sbjct: 222 QQQQPVYYDVFGNPIS 237

 Score =  134 bits (337), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%), Gaps = 4/114 (3%)

Query: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463
           RTGN+ +++KY ELN LLA+GTGIDTFGNTG+ RI +QHT+T TFINS GTG++Q S E 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGE- 433

Query: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFG---NASSFQQTASKPNDQGMSLIDL 514
            K NPFL+ QYTGLPS+NI+P+ TGYGFG       +QQ   + N+QG+SLIDL
Sbjct: 434 SKVNPFLSNQYTGLPSSNIIPTQTGYGFGNQPQQQQYQQQQQQNNNQGVSLIDL 487

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  183 bits (464), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 86/142 (60%), Positives = 109/142 (76%), Gaps = 1/142 (0%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN 64
           +LRSAKN++ GYS  Q LVR+ATSN    P +DQ+ ELAE TY+ +EFFEIM MLD+R+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIR 124
            K K W+HV KSL V DYLVR G+E CV W +EN++II+ L EF + DE SG D GQ++R
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDE-SGMDQGQMVR 119

Query: 125 VKAKELIALLRDDERLKEERNL 146
           V+AKEL +LL D+ERL+EER L
Sbjct: 120 VRAKELTSLLMDEERLREERAL 141

 Score =  139 bits (349), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (82%), Gaps = 1/93 (1%)

Query: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462
           TRTG+QSISDKY  LN LLATGTGIDTFGNTG  RI +QHTKT TFINS GTG+KQVS  
Sbjct: 314 TRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTN 373

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNAS 495
              +N FL +QYTGLPS+NIVPS TGYGFGN++
Sbjct: 374 -GFNNVFLNSQYTGLPSSNIVPSQTGYGFGNST 405

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/12 (100%), Positives = 12/12 (100%)

Query: 244 PMYYDIFGNPIT 255
           PMYYDIFGNPIT
Sbjct: 217 PMYYDIFGNPIT 228

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  180 bits (456), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 108/136 (79%), Gaps = 1/136 (0%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MSKQ +RSAKNVM GYS  QVLVR+ATSND    ++D ++++A R+Y +V+FFEIM MLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLNDK K W+H+ KSLTV DYLVR G+E CV W +EN+++I+ L EF + D+ +G D G
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDD-TGIDQG 119

Query: 121 QLIRVKAKELIALLRD 136
           Q+IRVKAKEL +LL+D
Sbjct: 120 QIIRVKAKELTSLLQD 135

 Score =  150 bits (379), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 69/90 (76%), Positives = 78/90 (86%)

Query: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463
           RTGN+ I++KY ELN LLA GTG+DTFGNTGQ RI +QHTKT TFINS GTG+KQV+NE 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493
            K+NPFL TQYTGLPS+NIVPS TGYGFGN
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFGN 478

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  179 bits (453), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 2/154 (1%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MS Q +RS KN+  GYS  QVLVR+AT+N++ G S+D +++L E +Y   EF +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           RR++DKPK WRHVAKSLTV DYLVR G+EACV WAR+N   +  L +F + D S+G D G
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD-SAGIDQG 119

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKN 154
           QLIRVKA ELI LLRD ERL  ER + + RG++N
Sbjct: 120 QLIRVKAAELIDLLRDPERLATERGMNM-RGRRN 152

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 67/111 (60%), Gaps = 6/111 (5%)

Query: 405 TGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQV-SNEP 463
           TGN  IS KY  LN LLA GTGIDTFGN G  RI +QHTKT TFINS GTG+KQV S+  
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514
           P   P L TQYTGLP+   V   +      +    QT      QG +L+DL
Sbjct: 656 PI--PLLPTQYTGLPAQTAVHVPSPSPLQPSEKEHQTQQT---QGFTLVDL 701

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  174 bits (441), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 107/140 (76%)

Query: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60
           MS+Q +RSAKNVM GYS  QVLVR+AT+ND   P LD +E++A  ++ +V+FFEIM +L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           +RLND  K WRH+ KSLTV DYLVR G+E C DWAR+++F+++ L  F  VD+  G D G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 121 QLIRVKAKELIALLRDDERL 140
           Q++RVKA++L+ LL+  E+L
Sbjct: 121 QIVRVKARDLVELLQSGEQL 140

 Score =  134 bits (338), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 65/96 (67%), Positives = 76/96 (79%), Gaps = 2/96 (2%)

Query: 405 TGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE-- 462
           TGNQ +++KY ELN LLA GTG+DTFGN G  RI +QHT+T TFINS GTGFKQV++E  
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQ 498
            P  NPFL +QYTGLPST IVP++TGYGFGN S  Q
Sbjct: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSDQQ 591

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 93/144 (64%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NVM  Y++ +  VR AT+N+ +G S   ME++++ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDKPKN-WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K  + WR + K+L + +YL++ G+E  +D  R ++ +I+ L  F ++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R KA+ L ALL+DDE+++ ER
Sbjct: 134 INVRNKAQSLTALLKDDEQIRAER 157

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score =  107 bits (266), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 91/144 (63%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NVM  Y+  +  VR AT+N+ +G S   M+++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-PKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + KSL +TDYL++ G+E  +D  R ++ +I+ L  F ++D S G D G
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R KA+ L+A L+DD+ ++ ER
Sbjct: 134 INVRNKAQSLVAFLKDDDLIRAER 157

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score =  106 bits (265), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 91/153 (59%), Gaps = 2/153 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   ME++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-PKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL+R GAE  +D  R N+ +I+ L  F ++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKK 153
             +R +A EL  LL DD +++ ER       KK
Sbjct: 134 INVRNRAHELALLLDDDAKVRAERKKARETAKK 166

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score =  106 bits (265), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 93/153 (60%), Gaps = 2/153 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  +++ +  VR AT+N+ +G S   ME++A+ TY+  E  E+M+ML R
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL+R G+E  +D  R  + I+R L  F ++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKK 153
             +R +AK+++ LL+DD  +++ R       KK
Sbjct: 134 VNVRNRAKQIVELLQDDAAVRDARKKARETAKK 166

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score =  106 bits (264), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 91/144 (63%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+N++  Y++ +  VR AT+N+ +G S   ME++++ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDKPKN-WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K  + WR + K+L + DYL+R GAE  +D  R N+ +I+ L  F ++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +A EL+ LL DD +++ ER
Sbjct: 134 INVRNRAHELVLLLDDDGKIRTER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score =  106 bits (264), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 92/144 (63%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   ME++A+ TY+  E +EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL++ G+E  +D  R ++ +I+ L  F ++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYID-SEGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +AK L+ LL+DD  +++ER
Sbjct: 134 INVRNRAKLLVELLQDDSNIRQER 157

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score =  103 bits (258), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 88/144 (61%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NVM  Y+  +  VR AT+N+ +G S   M ++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDKPKN-WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K  N WR + KS+ + +YLV+ G+E  +D  R N+ +IR L  F ++D S G D G
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R + K L+ LL DDE ++ ER
Sbjct: 134 INVRNRTKALVKLLEDDELIRAER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 90/144 (62%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   ME +A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-PKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + +YLV+ G+E  +D  R N+ +++ L  F ++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +A +L+ LL  DE++++ER
Sbjct: 134 INVRNRASQLVKLLESDEQIRQER 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 91/153 (59%), Gaps = 2/153 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y+  +  VR AT+N+ +G S   ME++++ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDKPKN-WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           RL +K  N WR + K+L + DYL+R  +E  +D  R ++ +I+ L  F ++D S G D G
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKK 153
             +R +AK L  LL DDE ++ ER       KK
Sbjct: 134 INVRNRAKALAELLSDDETIRAERKKARETAKK 166

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 88/144 (61%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y+  +  VR AT+N+ +G S   ME++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDKPKN-WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K  N WR + K+L + +YL+  GAE  +D AR ++ +IR L  F +VD S G D G
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVD-SEGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +A+ + +LL  D+ ++  R
Sbjct: 134 ANVRSRAQAMTSLLSSDDAIRSAR 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score =  102 bits (255), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 92/144 (63%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   ME+++  TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDKPKN-WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K  + WR + K+L + +YL++ G+E  +D +R N+ +I+ L  F H  +S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESF-HYTDSQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +A+EL+ LL +D++++ ER
Sbjct: 134 INVRNRAQELVKLLNNDDQIRAER 157

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score =  102 bits (253), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 89/144 (61%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   M+++++ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL++ G+E  +D  R ++ +IR L  F ++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R + K LI LL DD +++ ER
Sbjct: 134 INVRTRVKALIDLLSDDNKIRAER 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 89/144 (61%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   M+++++ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL++ G+E  +D  R ++ +IR L  F ++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R + K LI LL DD +++ ER
Sbjct: 134 INVRTRVKALIELLSDDNKIRAER 157

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score =  101 bits (252), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 89/144 (61%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   ME++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL++ G+E  +D  R ++ +++ L  F ++D + G D G
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYID-AEGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +   LI LLRDD  +++ER
Sbjct: 134 INVRNRVTTLIELLRDDNSIRQER 157

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 91/153 (59%), Gaps = 2/153 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   ME++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + KSL + DYL+R G+E  +D  R ++ +I  L  F ++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKK 153
             +R +AK L  LL DD ++++ER       KK
Sbjct: 134 INVRNRAKALGELLSDDTKIRQERKKARETAKK 166

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score =  100 bits (249), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 91/153 (59%), Gaps = 2/153 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   M+++++ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL++ G+E  +D  R ++ +I+ L  F ++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKK 153
             +R + K LI LL DD +++ ER       KK
Sbjct: 134 INVRTRVKTLIELLSDDNKIRAERKKARETAKK 166

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score =  100 bits (248), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 88/144 (61%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   M+++++ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + DYL++ G+E  +D  R ++ +I+ L  F H  +S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESF-HYTDSQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R + K L+ LL DD +++ ER
Sbjct: 134 INVRTRVKALVELLSDDSKIRAER 157

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score =  100 bits (248), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 89/144 (61%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y++ +  VR AT+N+ +G S   ME +A+ TY+  E  EI+ M+ R
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDKPKN-WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K  N WR + K+L + +YL++ G+E  +D  R ++ +++ L  F +VD S G D G
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVD-SQGRDQG 168

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +AK L  LL DD +++ ER
Sbjct: 169 INVRTRAKALTELLGDDNKIRAER 192

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 90/156 (57%), Gaps = 6/156 (3%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y+  +  VR AT+N+ +G     M ++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-PKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + KS+ + +YL+  G+E  +D  R  + +I+ L  F ++D S G D G
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQ 156
             +R + + L+ LL +DE+++ ER     + ++N Q
Sbjct: 134 INVRNRTQALVQLLNNDEQIRIERK----KARRNAQ 165

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 87/144 (60%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR 61
           +K+  R A+NV+  Y+  +  VR AT+N+ +G S   ME++A+ TY+  E  EI+ M+ R
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDKP-KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R  +K    WR + K+L + +YL++ G+E  +D  R ++ I++ L  F ++D S G D G
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYID-SQGRDQG 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             +R +A  L ALL DD  ++ ER
Sbjct: 134 VNVRNRAAALTALLADDSSIRAER 157

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 80/147 (54%), Gaps = 9/147 (6%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           LLR+ ++   G SQ ++  +NAT++DEY G +   M E++  TYS+    EI  ++ +RL
Sbjct: 3   LLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRL 60

Query: 64  ---NDKP--KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTD 118
              N K   KN  H+ K+LT+T YL+  G+   V W R  +++I  L EF  +       
Sbjct: 61  SGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFT-IGSRGQER 119

Query: 119 HGQLIRVKAKELIALLRDDERLKEERN 145
               IR  A  L  +LRDDE L++ R+
Sbjct: 120 MAVQIRSLASTLSVILRDDELLRQRRS 146

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 78/146 (53%), Gaps = 9/146 (6%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
            +RS +N+  G S  +V V+ AT +DEY G +   M E++  TYSA    EI  ++ RRL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  N-----DKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTD 118
           +        +N  H+ K+LT+  YL+  G+   V W R+  +++  L EF +V       
Sbjct: 61  SGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF-NVSADKDRK 119

Query: 119 HGQLIRVKAKELIALLRDDERLKEER 144
             + +R+ + +L  LL+DD  L+E R
Sbjct: 120 MAEQVRMLSIKLSKLLKDDLMLQERR 145

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 80/147 (54%), Gaps = 9/147 (6%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           LL++ +N+  G S  +V  RNAT++DE+ G +   M EL+  TYS     EI  ++ +RL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTD 118
           +        KN  H+ K+LT+  YL+  G++  V W R  +++I  L EF     +    
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 HGQLIRVKAKELIALLRDDERLKEERN 145
             Q IR  A  L A+LRD+E L++ R+
Sbjct: 121 ASQ-IRNLASSLAAILRDEELLRQRRS 146

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (50%), Gaps = 13/148 (8%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           +  S +N +   ++A+V  + AT ++E  G +   M E++  TYS     EI+ +L +RL
Sbjct: 3   IFDSVRNFVQSATEAKV--KEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRL 60

Query: 64  NDKPK-----NWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEF--VHVDESSG 116
               K     N  H+ K++T+  YL+  G+   + WAR N+ I   L +F  +H D+   
Sbjct: 61  TGSSKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKM 120

Query: 117 TDHGQLIRVKAKELIALLRDDERLKEER 144
            +    IR  A +L  L+ DDE L+  R
Sbjct: 121 AEQ---IRYIAGDLCILINDDELLEARR 145

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 73/144 (50%), Gaps = 2/144 (1%)

Query: 2   SKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIM-VMLD 60
           +K+  R A+N +   +  +  VR AT+ND +G S+  M ++   T+   +  +I+ ++L+
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120
           R L      WR + KS+ +  YL+  G+   V   + N+ +I+ L  F  +D+  G +  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDD-QGYNQS 133

Query: 121 QLIRVKAKELIALLRDDERLKEER 144
             I    + LI L+ DD  L + R
Sbjct: 134 SKISKATERLIELMTDDHLLNDLR 157

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 77/146 (52%), Gaps = 9/146 (6%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNAT-SNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           LL S + ++   S  ++ V+ AT  N+  G +   M E++  TYS     EI+ ++ +RL
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 64  -----NDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTD 118
                 +  K   H+ K+LT+  YL+  G+   + W R NM ++  L EF +V + +   
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEF-NVQDRNDEK 119

Query: 119 HGQLIRVKAKELIALLRDDERLKEER 144
            GQ IR  +++L  L++DD+ L+  R
Sbjct: 120 IGQQIRAMSQDLCTLIKDDDLLENRR 145

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 72/146 (49%), Gaps = 9/146 (6%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           L  S +N +   ++++V  R AT +DE  G +   M E++  TYS     EI+ +L +RL
Sbjct: 3   LFDSVRNFVQSPTESKV--RQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRL 60

Query: 64  -----NDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTD 118
                 +  KN  H+ K+LT+  YL+  G+   + W R N+ +   L  F  V       
Sbjct: 61  TGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNF-EVQNLEDEK 119

Query: 119 HGQLIRVKAKELIALLRDDERLKEER 144
            GQ I     ++  ++ DD+ L+++R
Sbjct: 120 MGQQIVFICNDICNIINDDDMLEQKR 145

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 7/136 (5%)

Query: 15  GYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-----DKPK 68
           G S     VR AT ++E+ G S   + E+   TYS     ++  +L +RL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  NWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAK 128
           N  H+ K+LT+T+YL+  G+E  V W +    ++R+L +F   +E       Q IR  + 
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQ-IRSFSL 129

Query: 129 ELIALLRDDERLKEER 144
            L+ L+++   L++ R
Sbjct: 130 SLLELMQNPALLEDHR 145

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 8/129 (6%)

Query: 23  VRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL------NDKPKNWRHVAK 75
           V+ ATS DE  G +   M E++  TYS     EI+ ++ +RL       +  +N   V K
Sbjct: 19  VKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAKELIALLR 135
           +LT+  YL+  G+   + W + NM +I  L  F H+ +       + IR  ++ L+ LL+
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILENF-HIQDVRDERKREEIRKLSRNLLELLQ 137

Query: 136 DDERLKEER 144
           DD  L+++R
Sbjct: 138 DDGLLEKQR 146

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 8/129 (6%)

Query: 23  VRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL------NDKPKNWRHVAK 75
           V+ ATS DE  G +   M E++  TYS     EI+ ++ +RL       +  ++   V K
Sbjct: 19  VKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRSCIQVMK 78

Query: 76  SLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAKELIALLR 135
           +LT+  YL+  G+   + W + NM +I  L +F    ++    +G+ IR  ++ L  LL+
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILEDF-QAQDARDDRNGEEIRKLSRNLHELLQ 137

Query: 136 DDERLKEER 144
           DDE L+ +R
Sbjct: 138 DDELLERQR 146

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 66/136 (48%), Gaps = 7/136 (5%)

Query: 15  GYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRLND-----KPK 68
           G S  ++ VR AT+ DE  G +   M E++  TYS     EI  +L RRL+        K
Sbjct: 11  GPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTSHK 70

Query: 69  NWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAK 128
           N  H+ K+LT+  YL+  G+E  V W R N+     L     V +       + IR  + 
Sbjct: 71  NSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKS-CEVSQKRDEPLAKQIRSMSN 129

Query: 129 ELIALLRDDERLKEER 144
           ++   ++DDE L+ ++
Sbjct: 130 QICDCVKDDELLENKK 145

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 65/136 (47%), Gaps = 7/136 (5%)

Query: 15  GYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL-----NDKPK 68
           G S   V V+ AT + E+ G     M E+A  TYS     EI  +L +RL         K
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRLVGNYKKTPSK 70

Query: 69  NWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAK 128
              ++ K+LT+  +LV  G+E C+ W R ++ +IR   +F   D        Q I++ + 
Sbjct: 71  RAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQMVNQ-IQLLSC 129

Query: 129 ELIALLRDDERLKEER 144
           +L  LL D   L++ R
Sbjct: 130 KLCQLLTDSNLLEDMR 145

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDE-YGPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           +  S +N +   S  ++ VR AT ++E  G +   M E++  TYS     EI+ +L +RL
Sbjct: 3   IFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRL 60

Query: 64  N-----DKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTD 118
                    +N  H+ K+LT+  YL+  G+   + W  EN  +   +  F    E S T 
Sbjct: 61  TGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNF----EVSDTI 116

Query: 119 HGQLIRVKAKEL----IALLRDDERLKEERN 145
           H +   ++ ++L    + L+ + E L+++RN
Sbjct: 117 HDEKFAIQIRDLSERILELINNRELLEQKRN 147

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 7/128 (5%)

Query: 23  VRNATSNDE-YGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-----DKPKNWRHVAKS 76
           V+ AT+ DE  G +   M E++  TYS     EI+ +L +RL+        KN   + K+
Sbjct: 19  VKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNCIFIIKT 78

Query: 77  LTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAKELIALLRD 136
           LT+  YL+  G+   V W R N  +I  L     V+       G  I+  A +L+ L++D
Sbjct: 79  LTLMAYLINNGSNEFVAWIRNNSSLISNLIS-EKVEYPKDDKMGPEIKSIAADLMELIQD 137

Query: 137 DERLKEER 144
           D+ L+E R
Sbjct: 138 DDLLEERR 145

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 72/169 (42%), Gaps = 36/169 (21%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   QV +R AT+ D +GP+   ++++    Y    +  +   L R ++  
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRYQVPLYLMVEYTLKRLVDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEF 108
             KPKN               WR V K LTV +YL+       VD   E   ++R L   
Sbjct: 81  AVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLN-----VDDGDELNQVVRCLDTH 135

Query: 109 VHV-------------DESSGTDHGQLIRVKAKELIALLRDDERLKEER 144
            H+             ++     H + IR K ++++  L D   LK+ER
Sbjct: 136 KHILTREIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLEDPSFLKQER 184

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 71/138 (51%), Gaps = 9/138 (6%)

Query: 15  GYSQAQVLVRNAT-SNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRL---NDKPKNW 70
           G S  Q+ V+ AT SN+ YG +   M EL+  TYS     EI  ++ +RL   + + KN 
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 71  R----HVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVK 126
                 V K+LT+ +YL+  G+E  V W R ++  I  L ++ H          + I+  
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDY-HCSNDKDKSKVKQIKSL 129

Query: 127 AKELIALLRDDERLKEER 144
           ++++   L++D+ L++ R
Sbjct: 130 SEDISKNLKEDDFLEKRR 147

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 69/165 (41%), Gaps = 26/165 (15%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR---RL 63
           R A+NV+  Y   Q+ +R AT+ D +GP+   + ++    Y    F      L R    +
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTLKRLVDHM 80

Query: 64  NDKPKN---------------WRHVAKSLTVTDYLVRTG-----AEACVDWARENMFIIR 103
             +PKN               WR V K L + +YL+         +  +   + +  I+ 
Sbjct: 81  AKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHILT 140

Query: 104 KLTEFVHVDESSGTD---HGQLIRVKAKELIALLRDDERLKEERN 145
           K T    VD SS      H + I+ K + +I L+ D   LK ER+
Sbjct: 141 KETMQYRVDFSSDGKMELHERGIKKKCEHIIQLIEDTSYLKRERS 185

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 74/166 (44%), Gaps = 30/166 (18%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   Q+ VR AT+ D +GP+   +E++    +    +     +L R ++  
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRFQVPMYLVTEYILKRLIDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENMF 100
             KPKN               WR V K LTV +YL   V  G E     +C+        
Sbjct: 81  ATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLLLNVNDGDELNQIKSCL--LTHKHI 138

Query: 101 IIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEER 144
           + R++  F     + G    H + IR K ++++ +L D   LK+ER
Sbjct: 139 LTREVLNFKIKFSNDGKMEVHERSIRKKGEKILQMLDDSRFLKQER 184

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 78/152 (51%), Gaps = 14/152 (9%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           L  + KN +   ++++V  + AT ++E  G +   M E++  TYS     +I+ ++ +RL
Sbjct: 3   LFDTVKNFVQTPTESKV--KQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRL 60

Query: 64  NDKP--------KNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTE---FVHVD 112
           +           K   ++ K+LT+  YL+  G+   ++W R N +++  +T+   F   D
Sbjct: 61  SSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQD 120

Query: 113 ESSGTDHGQLIRVKAKELIALLRDDERLKEER 144
            S+ +     I+V A+++  L+ ++  L++ R
Sbjct: 121 NSADSKMIGQIKVIAEDMTNLINNENLLEQRR 152

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 80/168 (47%), Gaps = 31/168 (18%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPS---LDQMEELAERTYSAVEFF--EIMVMLDR 61
           R A+N++  Y   Q+ +R AT+ D +GP+   LDQ+  L +R    +      IM  L  
Sbjct: 21  RYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQI--LLDRNKVPLRKIVDYIMKRLMD 78

Query: 62  RLNDKPKN---------------WRHVAKSLTVTDYL---VRTGAEA--CVDWARENM-F 100
            +N +P+N               WR V KSL V  +L   V  G +    V++   +  F
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLLLNVDPGEQLDDLVEYLLNHYGF 138

Query: 101 IIRKLTEFVHVDESS-GTD--HGQLIRVKAKELIALLRDDERLKEERN 145
               + E   V  SS G D  H ++I++K +E+I L+ D++ L ++ +
Sbjct: 139 FKHDILEIYQVQNSSDGKDSKHQEVIQLKCQEIIELINDEKLLLQKHD 186

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 72/166 (43%), Gaps = 30/166 (18%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-- 64
           R A+NV+  Y   QV +R AT+ D +GP+   + ++    Y    +  +   L R ++  
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRYQVPLYLMVEYTLKRLVDHI 80

Query: 65  -DKPKN---------------WRHVAKSLTVTDYLVRTGAE--------ACVDWARENMF 100
             +PKN               WR V K L V D+L+   +E        +C+   +    
Sbjct: 81  ASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSCLTTHKH--I 138

Query: 101 IIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEER 144
           + R++  F     + G    H + IR K ++++  + D   LK+ER
Sbjct: 139 LTREIPNFKVKFSNDGKMEIHERGIRKKGEDILQYMEDPHFLKKER 184

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 76/167 (45%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+N++  Y   QV VR AT+ D +GP+   +E++    Y  V  + I     +RL D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRYQ-VPMYLITEYTLKRLIDH 79

Query: 66  ---KPKN---------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENM 99
              +PKN               WR V K LTV +YL   V  G E     +C+   +   
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLLLNVSDGDELNQVRSCLTTHKH-- 137

Query: 100 FIIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEER 144
            + R++ E+     + G    H + I+ K + +I +L D + LK ER
Sbjct: 138 ILSREVLEYRVKFSNDGKMEVHERGIKKKCEFIIQMLEDSQFLKRER 184

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 79/176 (44%), Gaps = 34/176 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR---RL 63
           R  +N++  Y   Q+ +R AT+ D +GP+   ++++    YS   +     +L R    L
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYSVPLYLMTEYVLKRIVDHL 80

Query: 64  NDKPKN---------------WRHVAKSLTVTDYLVRTGAE--------ACVDWARE--N 98
             +PKN               WR + K L V +YL+   +E        +C++  ++  N
Sbjct: 81  AKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIFN 140

Query: 99  MFIIRKLTEFVHVDESSGTDHGQLIRVKAKELIALLRDDERLKEERNLRLGRGKKN 154
             I+    EF   ++     H + I+ K + +I L+ D E L+EER     + KKN
Sbjct: 141 SNILNYKIEF--CNDGKMEVHERGIQKKCEVIINLVDDPEFLREER----SKNKKN 190

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 77/178 (43%), Gaps = 33/178 (18%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   QV +R AT+ D +GP+   + ++    Y    +     +L R ++  
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRYQVPMYLMTEYILKRLVDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYLVRTGAEAC-VDWARENM-----FII 102
             +PKN               WR V K LTV ++L+    E   ++  R ++      + 
Sbjct: 81  ATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLMLNVDEGDELNQIRSSLQTHKHILT 140

Query: 103 RKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNV 158
           R++ ++     + G    H + IR K + ++  + D   LK ERN       KN QN 
Sbjct: 141 REVAQYRVKFSNDGKMEVHERGIRKKGETIVQFMEDPHFLKRERN-------KNKQNA 191

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 9/111 (8%)

Query: 5   LLRSAKNVMNGYSQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL 63
           LL + K+ +   ++++V  + AT+ DE  G +   M E++  TYS     EI+ ++ +RL
Sbjct: 3   LLDTFKSFIQSPTESKV--KQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRL 60

Query: 64  ------NDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEF 108
                  +  +N   V K+LT+  YL+  G+   + W + NM +I  L +F
Sbjct: 61  LLGQNRRNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDF 111

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 7/93 (7%)

Query: 23  VRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRL------NDKPKNWRHVAK 75
           V+ AT+ DE  G +   M E++  TYS     EI+ ++ +RL       +  +N   V K
Sbjct: 19  VKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRNCIQVMK 78

Query: 76  SLTVTDYLVRTGAEACVDWARENMFIIRKLTEF 108
           +LT+  YL+  G+   + W + NM ++  L +F
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKSNMILVEILEDF 111

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 71/167 (42%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-- 64
           R A+NV+  Y   QV +R AT+ D +GP+   + ++    Y           L R ++  
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 65  -DKPKN---------------WRHVAKSLTVTDYL---VRTGAEA-----CVDWARENMF 100
             +PKN               WR V K L V +YL   V +G+E      C+        
Sbjct: 81  ASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCL--TTHKRI 138

Query: 101 IIRKLTEFVHVDESSGTD---HGQLIRVKAKELIALLRDDERLKEER 144
           + R + +F  VD S+      H + I+ K ++++  L D   LK ER
Sbjct: 139 LSRDVMQF-RVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRER 184

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   QV VR AT+ D +GP+   + ++    Y  V  + I   + +RL D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRYQ-VPLYLITEYILKRLIDH 79

Query: 66  ---KPKN---------------WRHVAKSLTVTDYL---VRTGAEACVDWARENMFIIRK 104
              +PKN               WR V K L V +YL   V  G E  ++  R  +   + 
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLLMNVDDGDE--INQVRSCLLTHKH 137

Query: 105 LT--EFVHVDESSGTD-----HGQLIRVKAKELIALLRDDERLKEER 144
           L   E ++       D     H + IR K + ++  + D + LK+ER
Sbjct: 138 LISKEVLNFKIKFSNDGKMEVHERGIRKKGELIMQFIEDSKFLKQER 184

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 17  SQAQVLVRNATSNDEY-GPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-----DKPKNW 70
           S  ++ VR AT ++E  G +   M E++  TYS     +++ ++ +RL+     +  +  
Sbjct: 13  SPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRNSHRTC 72

Query: 71  RHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEF 108
            HV K+LT+  YL+  G+   + W + + ++I  L+ F
Sbjct: 73  LHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 70/167 (41%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDR---RL 63
           R A+NV+  Y   QV +R AT+ D +GP+   + ++    Y           L R    +
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 64  NDKPKN---------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENMF 100
             +PKN               WR V K L V +YL   V  G+E     +C+        
Sbjct: 81  ASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCL--LTHKHI 138

Query: 101 IIRKLTEFVHVDESSGTD---HGQLIRVKAKELIALLRDDERLKEER 144
           + R + +F  VD S+      H + I+ K +++I  + D   LK ER
Sbjct: 139 LTRDVMQF-RVDFSADGKMEVHERGIKKKCEQMIQYIEDPAYLKRER 184

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 34/176 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   Q+ +R AT+ D +GP+   + ++    Y    +      L R ++  
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRYQVPLYLMTEYTLKRLVDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENMF 100
             +PKN               WR V K L V ++L   V TG E     +C+        
Sbjct: 81  ATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVDTGDELNQIRSCL--LTHKHI 138

Query: 101 IIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEERNLRLGRGKKN 154
           + R++ +F     + G    H + IR K + ++  L D + LK+ER     + KKN
Sbjct: 139 LTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLEDSQFLKKER----AKNKKN 190

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 75/167 (44%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+N++  Y   Q+ +R AT+ D +GP+   +E++    Y  V  + +     +RL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRYQ-VPLYLLTEYTLKRLVDH 79

Query: 66  ---KPKN---------------WRHVAKSLTVTDYLVRTGAE--------ACVDWARENM 99
              +PKN               WR V K L V ++L+   A+        +C+       
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVADGDELNQVRSCL--VTHKH 137

Query: 100 FIIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEER 144
            + R++ ++     + G    H + IR K + ++ LL D + LK+ER
Sbjct: 138 LLSREVAQYRVAMSNDGKMEVHERGIRKKCENILQLLDDTQYLKKER 184

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 34/176 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   Q+ +R AT+ D +GP+   + ++    Y    +      L R ++  
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRYQVPLYLMTEYTLKRLVDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENMF 100
             +PKN               WR V K L V ++L   V TG E     +C+        
Sbjct: 81  ATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLLLNVDTGDELNQIRSCL--LTHKHI 138

Query: 101 IIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEERNLRLGRGKKN 154
           + R++ +F     + G    H + IR K + ++  L D + LK+ER     + KKN
Sbjct: 139 LTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLEDAQFLKKER----AKNKKN 190

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 76/176 (43%), Gaps = 34/176 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   QV +R AT+ D +GP+   + ++    Y    +      L R ++  
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRYQVPLYLMTEYTLKRLVDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENMF 100
             +PKN               WR V K L V ++L   V TG E     +C+        
Sbjct: 81  ATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLLLNVDTGDELNQIRSCL--LTHKHI 138

Query: 101 IIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEERNLRLGRGKKN 154
           + R++ +F     + G    H + IR K + ++  L D + LK+ER     + KKN
Sbjct: 139 LTREIAQFKLKFSNDGKMEVHERGIRKKGELILQYLEDPQFLKKER----AKNKKN 190

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 34/176 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-- 64
           R A+NV+  Y   QV +R AT+ D +GP+   + ++    Y    +      L R ++  
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRYQVPLYLMTEYTLKRLVDHI 80

Query: 65  -DKPKN---------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENMF 100
             +PKN               WR V K L V ++L   V  G E     +C+        
Sbjct: 81  ASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLLMNVDVGDELNQIRSCL--LTHKHI 138

Query: 101 IIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEERNLRLGRGKKN 154
           + R++ +F     + G    H + IR K + ++  L + + LK+ER    G+ KKN
Sbjct: 139 LTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLENPQFLKKER----GKNKKN 190

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   QV VR AT+ D +GP+  QM ++  R  + V  + I     +RL D 
Sbjct: 21  RFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVM-RHKNHVPMYLITEYTMKRLVDH 79

Query: 66  ---KPKN---------------WRHVAKSLTVTDYLV---RTGAE-----ACVDWARENM 99
              +PKN               WR V K L V ++L+    +G E     +C++  +   
Sbjct: 80  MAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLILNSSSGQELDQVLSCINTHKH-- 137

Query: 100 FIIRKLTEFVHVDESSGT--DHGQLIRVKAKELIALLRDDERLKEER 144
            + R   +F     S G    H + IR K ++++    D   LK  R
Sbjct: 138 ILARDTMQFKVEFSSDGKMEVHERGIRKKCEQVLQYTEDAGYLKRVR 184

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 72/152 (47%), Gaps = 17/152 (11%)

Query: 8   SAKNVMNGYSQAQVLVRNATSNDEYGPSLDQ-MEELAERTYSAVEFFEIMVMLDRRLN-- 64
           S +N++  YSQ ++ VR AT  +E   S    M E++  TYSA    EI+ +L ++L+  
Sbjct: 6   SVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKLSLL 63

Query: 65  ---------DKPKNWRHVAKSLTVTDYLVRTGAEACVDWAREN---MFIIRKLTEFVHVD 112
                       K    V K+ T+  YL+  G+   ++W + N   + I+ K+    H+ 
Sbjct: 64  YGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNNHIT 123

Query: 113 ESSGTDHGQLIRVKAKELIALLRDDERLKEER 144
           +          +   K++I L+ D++ L++ R
Sbjct: 124 DDEDLHILNQAQKITKDIILLINDNKLLEKRR 155

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 71/167 (42%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-- 64
           R A+NV+  Y   QV +R AT+ D +GP+   + ++    Y           L R ++  
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 65  -DKPKN---------------WRHVAKSLTVTDYL---VRTGAEA-----CVDWARENMF 100
             +PKN               WR V K L V +YL   V +G+E      C+        
Sbjct: 81  ASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCL--TTHKRI 138

Query: 101 IIRKLTEFVHVDESSGTD---HGQLIRVKAKELIALLRDDERLKEER 144
           + R + +F  VD S+      H + I+ K ++++  L D   LK ER
Sbjct: 139 LSRDVMQF-RVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRER 184

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 74/167 (44%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+NV+  Y   Q+ +R AT+ D +GP+   + ++    Y    +     +L R ++  
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRYQVPLYLMTEYILKRIVDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYL---VRTGAEACVDWARENMFIIRK- 104
             +PKN               WR V K L V D+L   V  G E  ++  +  M   +  
Sbjct: 81  AVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEE--LNQVKSCMLTHKHI 138

Query: 105 LTEFVHVDESSGTDHGQL------IRVKAKELIALLRDDER-LKEER 144
           LT  V   +   ++ G++      IR K+ ELI    DD R L+EER
Sbjct: 139 LTSQVASYKIPFSNDGKMEIHERGIRKKS-ELILQYMDDPRFLREER 184

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 74/164 (45%), Gaps = 26/164 (15%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLN-- 64
           R A+N++  Y   Q+ +R AT+ D +GP+   ++++    Y    +     +L R ++  
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKYHVPVYLMTEYILKRLIDHI 80

Query: 65  -DKPKN---------------WRHVAKSLTVTDYL---VRTGAE--ACVDWARENMFIIR 103
             KPKN               WR V K L + ++L   V  G E    +   ++++ I+ 
Sbjct: 81  ASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLLMNVSDGDELHQVLTCLKKHIHILS 140

Query: 104 KLTEFVHV---DESSGTDHGQLIRVKAKELIALLRDDERLKEER 144
           + T    +   ++     H + I  K++ ++ L+ D + L ++R
Sbjct: 141 RETTTYRIPFSNDGKMEIHERGIHKKSELIVQLIEDPDFLNQQR 184

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 22/137 (16%)

Query: 22  LVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLNDKPKNWRHVAKSLTVTD 81
           LV+ AT      P    ++ +   T S  +F+EI+  LD R+ND    W  V K+L V  
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRTG-AEACVDWARENMFIIRKLTEFVHVDE---SSGTDHGQLIRVKAKELIALLRDD 137
            ++R G  +  + +   N+       EF  ++    SSG+  G        ++ AL R D
Sbjct: 65  LMMREGKKDVALRYYSRNL-------EFFSIENIRGSSGSASG--------DMRALDRYD 109

Query: 138 ERLKEERNLRLGRGKKN 154
             LK  R+   G+ KK+
Sbjct: 110 NYLK-VRSREFGKIKKD 125

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 72/167 (43%), Gaps = 32/167 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
           R A+N++  Y   QV +R AT+ D +GP+   + ++    +    +     +L R ++  
Sbjct: 21  RFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVMRNRFQVPLYLMTEYILKRLVDHI 80

Query: 66  --KPKN---------------WRHVAKSLTVTDYL---VRTGAEA-----CVDWARENMF 100
             +PKN               WR V K L + +++   V  G E      C+        
Sbjct: 81  ATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHMLLNVDVGNELDQVVNCI--LTHKHI 138

Query: 101 IIRKLTEFVHVDESSGTD---HGQLIRVKAKELIALLRDDERLKEER 144
           + R + ++ HVD S+      H + I+ K ++++  + D   LK ER
Sbjct: 139 LTRDIMQY-HVDFSNDGKMEVHERGIKKKCEQILQYVEDLNYLKRER 184

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 16/134 (11%)

Query: 22  LVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLNDKPKNWRHVAKSLTVTD 81
           LV+ AT      P    ++ +   T S  +F+EI+  L+ R+ND    W  V KSL V  
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRTGA-EACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAKELIALLRDDERL 140
            ++R GA +  + +   N+       EF  ++   G++        + ++ AL R D  L
Sbjct: 65  LMIREGAKDVALRYYSRNL-------EFFDIENIRGSNGS-----ASGDMRALDRYDNYL 112

Query: 141 KEERNLRLGRGKKN 154
           K  R    G+ KK+
Sbjct: 113 K-VRCREFGKIKKD 125

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 49/120 (40%), Gaps = 14/120 (11%)

Query: 22  LVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLNDKPKNWRHVAKSLTVTD 81
           LV+ AT      P    ++ +   T  + EF EIM  L+ R+ND    W  V KSL V  
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAKELIALLRDDERLK 141
            ++R G          +     +L +  H   SSG            +L AL R +E LK
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRDVFHSKLSSG------------DLQALKRYNEYLK 112

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 78/189 (41%), Gaps = 36/189 (19%)

Query: 7   RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLNDK 66
           R  +N++  Y   Q+ VR A++ D +GP+   ++++    YS   +      L R ++  
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKYSVPLYLITEYTLKRLIDHI 80

Query: 67  PKN------------------WRHVAKSLTVTDYL---VRTGAE-----ACVDWARENMF 100
             N                  WR V K L + D+L   V  G E     +C+   +++  
Sbjct: 81  ATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLLLNVNDGDELQQITSCL---KKHKH 137

Query: 101 IIRKLTEFVHVDESSGTD---HGQLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQN 157
           I+ K T    +  S+      H Q IR K + +++ L + E L  ER     + KKN   
Sbjct: 138 ILNKETMNYKIQFSNDGKMEIHEQSIRTKCEVILSYLSEPEILNVER----LKHKKNQMK 193

Query: 158 VPETNPDGV 166
           +  +N   +
Sbjct: 194 IQRSNESAI 202

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 61/134 (45%), Gaps = 16/134 (11%)

Query: 22  LVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLNDKPKNWRHVAKSLTVTD 81
           LV+ AT      P    ++ +   T +  +F+EI+  LD R+ND    W  V KSL V  
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRTGA-EACVDWARENMFIIRKLTEFVHVDESSGTDHGQLIRVKAKELIALLRDDERL 140
            ++R G+ +  + +   N+       EF  ++   G++        + ++ AL R D  L
Sbjct: 65  LMIREGSKDVALRYYSRNL-------EFFDIENIRGSNGS-----ASGDMRALDRYDNYL 112

Query: 141 KEERNLRLGRGKKN 154
           K  R    G+ KK+
Sbjct: 113 K-VRCREFGKIKKD 125

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 22  LVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLNDKPKNWRHVAKSLTVTD 81
           LV+ AT      P    ++ +   +    +F EI+  L  R++D    W  V KSL VT 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82  YLVRTG-AEACVDWARENM--FIIRKL--TEFVHVDESSGTDHGQLIRVKAKEL 130
            L+R G  +  +D+   N+  F +  +  ++F   D  +   + Q + V+AKE 
Sbjct: 65  LLIREGEKDITLDYLSNNLDFFNLNGINTSKFSSGDVRALERYNQYLLVRAKEF 118

>Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AGR046C
          Length = 408

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 7  RSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLDRRLND- 65
          R A+N++  Y   QV +R AT+ D +GP+  Q+ ++    Y  V  + I     +RL D 
Sbjct: 21 RFAQNMIIQYEPYQVDIRRATNTDSWGPTPKQLAKVMRNRYQ-VPMYLITEYTMKRLVDH 79

Query: 66 ---KPKNWRHVAKSLTV 79
             +PKN    A+   V
Sbjct: 80 MAKRPKNLYEKARKEYV 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,821,750
Number of extensions: 1393104
Number of successful extensions: 3570
Number of sequences better than 10.0: 106
Number of HSP's gapped: 3531
Number of HSP's successfully gapped: 142
Length of query: 514
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 400
Effective length of database: 40,409,475
Effective search space: 16163790000
Effective search space used: 16163790000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)