Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47297.344ON32632617590.0
KLLA0D12474g7.344ON31230310111e-137
SAKL0F11242g7.344ON3093049441e-127
TDEL0C020307.344ON3113019181e-123
KLTH0H01386g7.344ON3073048931e-119
Kwal_56.246247.344ON3073048711e-116
YLR205C (HMX1)7.344ON3173198681e-116
ZYRO0F11594g7.344ON3093088621e-115
Smik_12.2637.344ON3182938521e-113
Suva_10.2997.344ON3202938421e-112
Skud_12.2687.344ON3182718311e-110
ACL154W7.344ON3192907921e-104
NCAS0E028907.344ON3153057781e-102
TPHA0F029207.344ON3202947291e-94
Kpol_530.367.344ON3113067227e-94
NDAI0E045007.344ON3273297142e-92
CAGL0A03905g7.344ON2822547093e-92
KAFR0L014707.344ON3002785706e-71
KNAG0B026407.344ON3023075662e-70
CAGL0K11088g8.462ON972129800.20
TPHA0P007507.272ON971150694.9
Ecym_71075.199ON17964664.9
Kpol_513.108.518ON55484685.4
TBLA0H03480singletonON58487685.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4729
         (326 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   682   0.0  
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   394   e-137
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   368   e-127
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   358   e-123
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   348   e-119
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   340   e-116
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   338   e-116
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   336   e-115
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   332   e-113
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   328   e-112
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   324   e-110
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   309   e-104
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   304   e-102
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   285   1e-94
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   282   7e-94
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   279   2e-92
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   277   3e-92
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   224   6e-71
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   222   2e-70
CAGL0K11088g Chr11 complement(1079157..1082075) [2919 bp, 972 aa...    35   0.20 
TPHA0P00750 Chr16 (151647..154562) [2916 bp, 971 aa] {ON} Anc_7....    31   4.9  
Ecym_7107 Chr7 (209079..209618) [540 bp, 179 aa] {ON} similar to...    30   4.9  
Kpol_513.10 s513 (28142..29806) [1665 bp, 554 aa] {ON} (28142..2...    31   5.4  
TBLA0H03480 Chr8 (852885..854639) [1755 bp, 584 aa] {ON}               31   5.5  

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/326 (100%), Positives = 326/326 (100%)

Query: 1   MVYKETMNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRH 60
           MVYKETMNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRH
Sbjct: 1   MVYKETMNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRH 60

Query: 61  GFIYRQGILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLE 120
           GFIYRQGILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLE
Sbjct: 61  GFIYRQGILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLE 120

Query: 121 FFYHHEYPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGK 180
           FFYHHEYPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGK
Sbjct: 121 FFYHHEYPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGK 180

Query: 181 VMRSNIYRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREG 240
           VMRSNIYRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREG
Sbjct: 181 VMRSNIYRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREG 240

Query: 241 LDENQKLEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSE 300
           LDENQKLEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSE
Sbjct: 241 LDENQKLEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSE 300

Query: 301 VKQALAIAVFFINFLMIYFTLRTIFW 326
           VKQALAIAVFFINFLMIYFTLRTIFW
Sbjct: 301 VKQALAIAVFFINFLMIYFTLRTIFW 326

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  394 bits (1011), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 233/303 (76%)

Query: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81
           IPSPTDVGALANRINF TRDMH K +A++  KMA AMRHGFIYRQGI+A+YY+FHA+EQ+
Sbjct: 9   IPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQE 68

Query: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141
           IDRLLE P T ++ ++  IL+QFWCEEFRRS +L+ DL+  Y+ EYP   +LQ+FL+ F+
Sbjct: 69  IDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDGFQ 128

Query: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201
           LP KLQ FVD I     + P TILAYCHVLY ALFAGG+VM+SN+YR+IGLFPK   +S 
Sbjct: 129 LPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHLSP 188

Query: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261
            E  R  TNFFTFS++GVD+EN+LRWQYKK YELATR  L E +KL II+VS   FQ  M
Sbjct: 189 KELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQRNM 248

Query: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321
           +++ EIGE N+ ELM  FS+KL++FLS EW+Y++KL+ EVK+ +  A+   N + +Y  L
Sbjct: 249 EVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVYTIL 308

Query: 322 RTI 324
           R +
Sbjct: 309 RRL 311

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 220/304 (72%)

Query: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81
           IPSPTDVGALANRINF TRD H K +A +  K+A AM+HG IYRQGILAFYYIF AVEQ+
Sbjct: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65

Query: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141
           ID LL+  ST  ELQ   IL QFWCEEFRRS  + +DLE  Y  EY T+ EL  FL+D  
Sbjct: 66  IDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNV 125

Query: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201
           LPP+ Q FV++I     E P TILAYCHVLY ALFAGGK+M+SNIYR+ GLFPK + ++ 
Sbjct: 126 LPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTP 185

Query: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261
            +  R GTNFFTFS++G D E KLRW+YKK YELATR+ L E QK EII VS   F   M
Sbjct: 186 EQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNM 245

Query: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321
           D++GE+GE N+ ELM  FSFKL++F+  EW+Y++KLS E K  + +    + FL+ Y+ L
Sbjct: 246 DVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAYWLL 305

Query: 322 RTIF 325
           R +F
Sbjct: 306 RKLF 309

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  358 bits (918), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 215/301 (71%)

Query: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81
           IP+PTDVGALANRINF TRD H K +A++  ++A A++HGFIYRQGILAFY+IF AVEQ+
Sbjct: 8   IPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQE 67

Query: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141
           +DRLL  P   EE Q+  +LRQFW EEFRR+ R+ +DLE  Y  EY     L+ F+    
Sbjct: 68  LDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQP 127

Query: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201
           L P+LQ FVD I     ++  TILAYCHVLY ALFAGGKVMRSN+YR+ GLFPK + ++ 
Sbjct: 128 LAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTP 187

Query: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261
            E    GTNFFTFSD+G D ENKLRW+YK+ YELATR+ L E+QK  I+ VS   F   M
Sbjct: 188 KELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNM 247

Query: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321
           D++GEIGE N+ ELM+ FSFKLLT+LS EW+Y+  LS   K ++ +    I FL+ Y  L
Sbjct: 248 DVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAYIVL 307

Query: 322 R 322
           R
Sbjct: 308 R 308

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  348 bits (893), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 169/304 (55%), Positives = 211/304 (69%)

Query: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81
           IPSPTDVGALANRINF TRD H K D  +  K A AM+HGFIYRQG+LAF+Y+F A+EQ+
Sbjct: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63

Query: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141
           +DRL +   T EE Q   IL QFW EEFRR+ R+L+DLE  Y  E+PT   L+ FL +  
Sbjct: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123

Query: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201
           L P+LQ FVD++       P+ ILAYCHVLY ALFAGG+VMRS IYR+ GLFPK   ++ 
Sbjct: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTT 183

Query: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261
            E  R GTNFFTFSD GV  EN+LR  YK+ YELATR+GL E QKL I+DVS A F+   
Sbjct: 184 EEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNT 243

Query: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321
            ++ EIGE N++ELM   SF+LLTF+  EW+Y+ KL+ + K  +      +  LM+Y+ L
Sbjct: 244 RVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYWVL 303

Query: 322 RTIF 325
           R  F
Sbjct: 304 RKFF 307

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 212/304 (69%)

Query: 19  VGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAV 78
           +  IPSPTDVGALANRINF TRD H K D  +  K A AM+HGFIYRQG+LAF+Y+F A+
Sbjct: 1   MSTIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAI 60

Query: 79  EQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLN 138
           EQ+IDRLL+   T EE+Q   IL QFW   F R+ R+ +DL+  Y  E+P+  +L  FL 
Sbjct: 61  EQEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQ 120

Query: 139 DFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKG 198
              LPP+ Q FVDF+ +     P++ILA+CHVLY ALFAGG+VMRS IYR+ GLFPK   
Sbjct: 121 QNTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPD 180

Query: 199 ISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQ 258
           ++  E  R GTNFFTFSDDGV  EN+LR +YK+ YELATREGL E+QKL I++V+ A F+
Sbjct: 181 LTPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFE 240

Query: 259 AVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIY 318
               ++ EIGE N++ELM   SFKL++F  +EW++ +KL+   K  +      I  L++Y
Sbjct: 241 WNTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKSIVLATGAVIQILVMY 300

Query: 319 FTLR 322
           + LR
Sbjct: 301 WMLR 304

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  338 bits (868), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 223/319 (69%), Gaps = 9/319 (2%)

Query: 7   MNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQ 66
           M DS + I       IPSPTDVGALANRINF TRD H K + F+  KMA+AMRHGFIYRQ
Sbjct: 1   MEDSSNTI-------IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQ 53

Query: 67  GILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHE 126
           GILA+YY+F A+EQ+IDRLL  P T+EELQ S IL+QFW E+FRRS ++ +DL+  Y + 
Sbjct: 54  GILAYYYVFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNT 113

Query: 127 YPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNI 186
           + +   L +FL  F+ PP LQ+F++ I +   + P TIL+YCHVLY ALFAGGK++RSN+
Sbjct: 114 FKSTESLNEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNL 173

Query: 187 YRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQK 246
           YR +GLFP  + +S  E  + GTNFFTFSD G  EE +L+W+YKKNYELATR  L E QK
Sbjct: 174 YRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQK 233

Query: 247 LEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSE--VKQA 304
           L+II V+   F    +I+ EIGE N++ELM  FSFK +T+L  EW +N+  ++   +   
Sbjct: 234 LQIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTV 293

Query: 305 LAIAVFFINFLMIYFTLRT 323
           + + +  I   ++YF +++
Sbjct: 294 MLLVLSIIAIWVLYFLVKS 312

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  336 bits (862), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/308 (53%), Positives = 220/308 (71%), Gaps = 1/308 (0%)

Query: 19  VGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAV 78
           +  IP+PTDVGALANRINF TRD H K +A++  ++A A++HG+I+RQGILA+YYIF A+
Sbjct: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60

Query: 79  EQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLN 138
           EQ++DR+++    ++E+Q+  +L +FW  +FRR+ R+ +DL   Y  E+PT++ L+QFL 
Sbjct: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120

Query: 139 DF-ELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPK 197
               L P LQ FVD I     E P TILAYCHVLY ALFAGGKVMRSN+YR+ GLFPK +
Sbjct: 121 SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ 180

Query: 198 GISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANF 257
            +S  E  + GTNFFTFS++G + ENKLRW+YK+ YELATR+ L E QK +II VS   F
Sbjct: 181 HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF 240

Query: 258 QAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMI 317
           Q  M+ + EIGE N++ELM   SF+LLT+L  EW++  KLS   K  L +AV  + FL++
Sbjct: 241 QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQFLIV 300

Query: 318 YFTLRTIF 325
           Y  LR I 
Sbjct: 301 YLVLRRIL 308

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 213/293 (72%), Gaps = 7/293 (2%)

Query: 7   MNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQ 66
           M DS+++I       IPSPTD+GALANRINF TRD H K + F+  KMA+AMRHGFIYRQ
Sbjct: 1   MEDSNNKI-------IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQ 53

Query: 67  GILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHE 126
           GILA+YY+F A+EQ+IDRLL  P T +ELQ SAIL+QFW E+FRRS ++ +DL+  Y + 
Sbjct: 54  GILAYYYVFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNT 113

Query: 127 YPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNI 186
           + +   L +FL  FE PP LQ+FV+ I +   + P TIL+YCHVLY ALFAGGK++RSN+
Sbjct: 114 FKSTESLNEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNL 173

Query: 187 YRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQK 246
           YR +GLFP  + +S  E  + GTNFFTFSD G  EE +L+ +YKKNYELATR  L E QK
Sbjct: 174 YRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQK 233

Query: 247 LEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSS 299
           L+II V+   F    +I+ EIGE N++ELM  FSFK +T++  EW +N++ ++
Sbjct: 234 LQIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESAT 286

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  328 bits (842), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 210/293 (71%), Gaps = 5/293 (1%)

Query: 7   MNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQ 66
           M DS S        +IPSPTD+GALANRINF TRD H K + F+  KMA+AMRHGFIYRQ
Sbjct: 1   MEDSTS-----TSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQ 55

Query: 67  GILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHE 126
           GILA+YY+F A+EQ+IDRLL    +++ELQ   IL+QFW E+FRRS ++ +DL+  Y + 
Sbjct: 56  GILAYYYVFDAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNT 115

Query: 127 YPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNI 186
           + +   L +FL  FE PP LQ+FVD I D   + P TIL+YCHVLY ALFAGGK++RSN+
Sbjct: 116 FKSTESLNEFLATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNL 175

Query: 187 YRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQK 246
           YR +GLFP  + ++  E  + GTNFFTFS+ G  EE +L+W+YKKNYELATR  L E QK
Sbjct: 176 YRRLGLFPNFEKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQK 235

Query: 247 LEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSS 299
           L+II V+   F    +I+ EIGE N++ELM+ FSFK +T++  EW +++  +S
Sbjct: 236 LKIISVAEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSAS 288

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  324 bits (831), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 156/271 (57%), Positives = 200/271 (73%)

Query: 21  MIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQ 80
           +IPSPTDVGALANRINF TRD H K + F+  +MA+AMRHGFIYRQGILA+YY+F A+EQ
Sbjct: 8   IIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQ 67

Query: 81  QIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDF 140
           +IDRLL  P T++ELQ S IL+QFW E+FRRS ++ +DL+  Y + + +   L +FL  F
Sbjct: 68  EIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKF 127

Query: 141 ELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGIS 200
           E PP LQ+FV+ I +   + P TIL+YCHVLY ALFAGGK++RSN+YR +GLFP  + +S
Sbjct: 128 EKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLS 187

Query: 201 AAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAV 260
             E  + GTNFFTFSD G  EE +L+ +YKKNYELATR  L E QKL+II V+   F   
Sbjct: 188 QKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWN 247

Query: 261 MDILGEIGETNKKELMNIFSFKLLTFLSNEW 291
             I+ EIGE N++ELM  FSFK +T++  EW
Sbjct: 248 FHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  309 bits (792), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 149/290 (51%), Positives = 198/290 (68%), Gaps = 1/290 (0%)

Query: 11  DSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILA 70
           ++ I++ A  ++P PTD GALANRINF TR++H+KADAFV  K A+A+RH  IYRQG+LA
Sbjct: 7   NTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLA 66

Query: 71  FYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQ 130
            YYIF +VEQ IDRLL  P+T +E +I  ILR FW  EF R+  L++D E +Y  EY T 
Sbjct: 67  MYYIFRSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTS 126

Query: 131 NELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNI 190
            +L QFL+ +ELPP+L   V  I    +  P TILA+CHVLY ALFAGG+VMRS + R +
Sbjct: 127 AQLHQFLDSYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQL 186

Query: 191 GLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEII 250
           GL P+  G+SA E+   GT+FFTF   G  EENK R  YK+ YELATR  L E +K ++I
Sbjct: 187 GLLPRAAGLSARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVI 245

Query: 251 DVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSE 300
           D + A+F  +  ++ E+   N++EL+   S++LLTFL  EWRY  K S +
Sbjct: 246 DAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  304 bits (778), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 148/305 (48%), Positives = 203/305 (66%), Gaps = 3/305 (0%)

Query: 21  MIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQ 80
           +IPSPTD  ALANRINF TRD H K +  +  K+A+A+RHGFIYRQGIL +YYIF  VE+
Sbjct: 8   IIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVEE 67

Query: 81  QIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFL--N 138
           +I +L  +P+T EE++I  +L + W  EF R+  LL+DL+  YH EYPT+  LQ FL  N
Sbjct: 68  EIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLETN 127

Query: 139 DFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKG 198
             ELPP L  F+ +I    +ENP +I AYCHVLY ALFAGGK++RS IY+N+G  P    
Sbjct: 128 ATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPNFNH 187

Query: 199 ISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQ 258
           +S+ E    GTNFF F  DGV EE KL+ ++KKNYEL TRE L+E +K  II+ S   F 
Sbjct: 188 LSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIFD 247

Query: 259 AVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQK-LSSEVKQALAIAVFFINFLMI 317
             +  + E+G  NK++LM+  +FK++T+L  EW++N   LS   K  + + +  ++ L  
Sbjct: 248 YNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMVLLHMLFA 307

Query: 318 YFTLR 322
           +F L+
Sbjct: 308 FFILK 312

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  285 bits (729), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 204/294 (69%), Gaps = 9/294 (3%)

Query: 19  VGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAV 78
           V +IPSPTDV ALANRINF TRD H K  AF+  ++ALA+RHGFIYRQG++AFY+IF  +
Sbjct: 4   VKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTI 63

Query: 79  EQQIDRLLETPSTK---EELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYP-TQNELQ 134
           E +ID LL T  ++    ++Q   IL+ F+  EFRR   LL+DL   Y+ E+   + ++ 
Sbjct: 64  ENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVL 123

Query: 135 QFLN----DFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNI 190
            FLN    + E  P+L  F D+I+D T E P TI+AYCHVLY ALFAGGK+M+SN+ +N+
Sbjct: 124 DFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNV 183

Query: 191 GLFPKPKGISAAESSRNGTNFFTFS-DDGVDEENKLRWQYKKNYELATREGLDENQKLEI 249
           GLFPK   +S  E +  G+NFF F+ +D  D ++KLR++YKKNYEL+TR+ L+E QK +I
Sbjct: 184 GLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDI 243

Query: 250 IDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQ 303
           I+VS   F  + +++ EIG  N+ +LM  F+ K +T+L  EW+YN+KL+   KQ
Sbjct: 244 IEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNKQ 297

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  282 bits (722), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 204/306 (66%), Gaps = 19/306 (6%)

Query: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81
           IPSPTDVGALANRINF TRD H K  AF+  ++ALA++HGFIYR+G++ FY+IF+ +E +
Sbjct: 5   IPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETE 64

Query: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFL---- 137
           ID +L   + +++ Q+  IL  F+ +EFRR  ++L+DLE  Y+ E+  QN+  Q L    
Sbjct: 65  IDLVL---NNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEF--QNDRPQLLEFIN 119

Query: 138 -----NDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGL 192
                ND E   +LQ FV +I+    E+P T+LAYCHVLY ALFAGGK+M+SN+ +++G+
Sbjct: 120 SDRFTNDSE---QLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGI 176

Query: 193 FPKPKGISAAESSRNGTNFFTFSDDGVDEEN--KLRWQYKKNYELATREGLDENQKLEII 250
           FPK + +S  E    GTNF+ F+D    E    KLRW YKKNYEL+TR+ L E QKL +I
Sbjct: 177 FPKFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVI 236

Query: 251 DVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVF 310
             S   F  + + + E+G  N+ ELMNIFS+KL TF+  EW+YN  +S  +K++L   + 
Sbjct: 237 KTSKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILI 296

Query: 311 FINFLM 316
            I F +
Sbjct: 297 IIQFTL 302

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  279 bits (714), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 147/329 (44%), Positives = 211/329 (64%), Gaps = 20/329 (6%)

Query: 14  IHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYY 73
           + S  V +IPSPTD  ALANRINF TRD H K D  +  K+A+A+RHG IYRQGIL +YY
Sbjct: 1   MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYY 60

Query: 74  IFHAVEQQIDRLLE--TPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQN 131
           IF AVE +I+ LL   T +TKE+ +  ++L + W  EF R+ +L +DL+  Y   +    
Sbjct: 61  IFQAVESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQ 120

Query: 132 ELQQFLN-DFEL-----PPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSN 185
           +L  F+N +F+L       KL +FV+FI      NP  ILAYCHVLY ALFAGGK+++S 
Sbjct: 121 DLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSK 180

Query: 186 IYRNIGLFPKPKGISAAESSRNGTNFFTFSD--------DGVDEENKLRWQYKKNYELAT 237
           IY+N+G  P    +S+ E   N TNFF F++        + +  ENKL+ ++K+N+EL T
Sbjct: 181 IYKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNT 240

Query: 238 REGLDENQKLEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKL 297
           R  L+EN+KL II+++   FQ  ++ + E+G+ N+KELMN+FSFKL+ +L  EW++N  +
Sbjct: 241 RSNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSI 300

Query: 298 SSEVKQALAIAVFFINFLMI-YFTLRTIF 325
               K   AI +F I  L+I +F  R++F
Sbjct: 301 KKNFK---AILMFVILLLLIQFFVSRSLF 326

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  277 bits (709), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 139/254 (54%), Positives = 176/254 (69%), Gaps = 11/254 (4%)

Query: 53  KMALAMRHGFIYRQGILAFYYIFHAVEQQIDRLLE----------TPSTKEELQISAILR 102
           + A+A+RHG +YRQGILAFYY+F A+EQ+ID LL           T  + ++L  S I++
Sbjct: 4   RFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASKIVK 63

Query: 103 QFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPS 162
           QFW  EFRR+ +L +DL   Y  EYPT  EL   L D +LPP+LQ FVD +     +NP 
Sbjct: 64  QFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQNPV 123

Query: 163 TILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEE 222
           T+LAYCHV+Y ALFAGGKVMRS +YRN GLFPK + +S+ E +R GTNFFTFSD GVD E
Sbjct: 124 TVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGVDVE 183

Query: 223 NKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFK 282
           N+L+WQYKKNYELATRE L EN KLEIIDV+   F+  MDI+ EIG+ NK+ L N     
Sbjct: 184 NQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTN-NKLD 242

Query: 283 LLTFLSNEWRYNQK 296
           LL ++  E ++  K
Sbjct: 243 LLQYVFEELKFYNK 256

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  224 bits (570), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 178/278 (64%), Gaps = 17/278 (6%)

Query: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81
           +PSPTD  ALANRINF TRD+H   D  +  K   A+RH FIY+  +L++YY+F  +E +
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141
           ID ++    +     I  ILR F+ ++FRR  ++L+DL+F         N +Q   +D  
Sbjct: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFL--------NVIQDQSDDQW 112

Query: 142 LP--PKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLF--PKPK 197
           L   P+L +F++FI+    E+P  +LAYCHVLY ALFAGG++MR+++ +N+  F  PK  
Sbjct: 113 LSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFD 172

Query: 198 GISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANF 257
            +S  +   N TNFF F  D V  ENKL+ +YK+NY++ T+  L+E++KLEIID+S   F
Sbjct: 173 KMSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIF 231

Query: 258 QAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQ 295
           +   ++L EIG  NK ELM  F++K++T++  EW++ +
Sbjct: 232 KFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRK 269

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  222 bits (566), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 183/307 (59%), Gaps = 19/307 (6%)

Query: 19  VGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAV 78
           +  IPSPTD  ALANRINF TRD+H + D     K  +A+RH FIY   +  FY +F  V
Sbjct: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61

Query: 79  EQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLN 138
           EQ+ID L+ +        + AIL +F+  EFRR+ ++ RDL F    E+ T    Q    
Sbjct: 62  EQRIDELIASEGGD---GVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVESGQ---- 112

Query: 139 DFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFP--KP 196
            +  PP+L  F+ ++R +   +P T+LA CHVLY ALFAGG+V +S++++N+G  P  + 
Sbjct: 113 -WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRD 171

Query: 197 KGISAAESS-----RNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIID 251
           K     E S      N TNFF F++  +++ENKLRW YK+NYELATR+ L E+QKL +I 
Sbjct: 172 KNGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIA 230

Query: 252 VSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFF 311
            S   F+    ++ EI + N  ELM+  SFK++T+   EW++N+     V   +A    F
Sbjct: 231 ASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRGVLWGVAFLAQF 290

Query: 312 INFLMIY 318
           + F+++Y
Sbjct: 291 L-FVVLY 296

>CAGL0K11088g Chr11 complement(1079157..1082075) [2919 bp, 972 aa]
           {ON} highly similar to uniprot|P41810 Saccharomyces
           cerevisiae YDR238c SEC26
          Length = 972

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 51/129 (39%), Gaps = 20/129 (15%)

Query: 55  ALAMRHGFIYRQGILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGR 114
            L  RH ++ +  ILA   I+   E  +      P  KE      I+  F   E   +  
Sbjct: 145 CLEYRHAYVRKYAILAVLSIYKVSEHLL------PDAKE------IINTFLLAE---TDP 189

Query: 115 LLRDLEFFYHHEYPTQNELQQF---LNDFE-LPPKLQR-FVDFIRDKTMENPSTILAYCH 169
           + +   F    E    N LQ     ++D E L P LQ  FV FIR   ++ P+    YC 
Sbjct: 190 ICKRNAFLGLSELDRDNALQYLQDNIDDIESLDPLLQAAFVQFIRKDAIQTPALKSQYCD 249

Query: 170 VLYNALFAG 178
           +L   L + 
Sbjct: 250 LLLELLASA 258

>TPHA0P00750 Chr16 (151647..154562) [2916 bp, 971 aa] {ON} Anc_7.272
           YIL073C
          Length = 971

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 61/150 (40%), Gaps = 16/150 (10%)

Query: 74  IFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQN-E 132
           I   +++Q D+LL    T++E+  + I      E+  +    LR        EY   N +
Sbjct: 144 ILRNIQEQCDKLL--IVTQDEINDNKIKNHLETEQKEKDFNNLR-------IEYLIINFQ 194

Query: 133 LQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGL 192
           L    ND+EL       VD   + +  NP  +L  C ++YNA+    +     I  NI +
Sbjct: 195 LALAENDYELASIYFSKVDINENTSSMNPKVLLELCRLIYNAILQQYQNFNEEI-PNIDI 253

Query: 193 FPKPKGISAAESSRNGTNFFTFSDDGVDEE 222
                  S     RN +  FT + + +  E
Sbjct: 254 LN-----SMCHYLRNTSELFTLNKNMLKTE 278

>Ecym_7107 Chr7 (209079..209618) [540 bp, 179 aa] {ON} similar to
           Ashbya gossypii AAL155W
          Length = 179

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 195 KPKGISAAESSRNGTNFFTF-SDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVS 253
           KPKGIS +              +DG D+E+     +   Y + T+ G  ++QKL ++ + 
Sbjct: 53  KPKGISRSVGDVGPLTLEMLEGEDGDDDESVYVDDHMSRYHITTKMGAADDQKLPVVCMQ 112

Query: 254 IANF 257
           IA  
Sbjct: 113 IAEL 116

>Kpol_513.10 s513 (28142..29806) [1665 bp, 554 aa] {ON}
           (28142..29806) [1665 nt, 555 aa]
          Length = 554

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 16/84 (19%)

Query: 87  ETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHE---------------YPTQN 131
           E    +  L ++ +L + WCE  R +  +  +   F H +               +P   
Sbjct: 119 ENEKVRNRLSVTKLLTKRWCE-LREAYDIYSETPLFEHKQIIEGKLVHQKLEEDIHPVTE 177

Query: 132 ELQQFLNDFELPPKLQRFVDFIRD 155
           +L+ F+ DFE+P     F + + D
Sbjct: 178 DLESFVEDFEVPIPTDNFHNHVDD 201

>TBLA0H03480 Chr8 (852885..854639) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 40/87 (45%), Gaps = 16/87 (18%)

Query: 81  QIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHE-------------- 126
           ++D+++++      L ++ +L + WCE  R +  +   L  F H++              
Sbjct: 120 KLDKIIQSKKELPRLSVTKLLTKRWCE-LRETYDIYSRLPIFSHNQVKVGNIIHSKLENI 178

Query: 127 -YPTQNELQQFLNDFELPPKLQRFVDF 152
            +P + E++QF  +FEL      F +F
Sbjct: 179 SHPLEVEVEQFKKEFELIVPTDSFHNF 205

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,696,204
Number of extensions: 1555100
Number of successful extensions: 6030
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6203
Number of HSP's successfully gapped: 30
Length of query: 326
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 216
Effective length of database: 40,868,139
Effective search space: 8827518024
Effective search space used: 8827518024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)