Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47277.346ON42942923310.0
KLLA0D12430g7.346ON41840718100.0
SAKL0F11286g7.346ON42343017120.0
TDEL0C020207.346ON42543117110.0
KLTH0H01342g7.346ON42241717030.0
Kwal_56.246317.346ON42240417030.0
CAGL0A03927g7.346ON43741717010.0
Suva_10.2977.346ON43640816580.0
Skud_12.2667.346ON43640816580.0
Kpol_530.357.346ON42540616490.0
Smik_12.2617.346ON43641416470.0
ACL152W7.346ON42841316440.0
YLR203C (MSS51)7.346ON43640816330.0
NCAS0E028807.346ON42942916190.0
TPHA0F029307.346ON43640416170.0
ZYRO0F11616g7.346ON41541216150.0
KNAG0B026307.346ON43843015980.0
NDAI0E044807.346ON44340215690.0
KAFR0B008407.346ON42640315490.0
NCAS0A141207.346ON42740015270.0
NDAI0A019307.346ON45041914810.0
TBLA0E005007.346ON43742514660.0
KNAG0C037507.346ON42442914460.0
KLLA0E13333g3.144ON16370830.044
KLTH0G11418g8.357ON897128840.11
Kwal_56.228833.144ON16168780.21
TPHA0M004603.144ON15456760.38
KLTH0C08514g3.144ON15973750.47
Smik_15.873.144ON15868740.73
Skud_15.813.144ON15964711.7
NDAI0B025903.144ON16461702.2
TDEL0D047903.144ON16364692.5
TBLA0A016608.477ON486108713.6
Ecym_52763.144ON16570683.9
YOL071W (EMI5)3.144ON16268684.0
KNAG0E010804.13ON26459694.2
KNAG0D034105.480ON336130695.3
Suva_15.943.144ON15964675.4
AER200C3.144ON16064675.7
CAGL0I01210g5.419ON55168696.3
Kpol_1032.253.144ON20157677.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4727
         (429 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   902   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   701   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   664   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   663   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   660   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   660   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   659   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   643   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   643   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   639   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   639   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   637   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   633   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   628   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   627   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   626   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   620   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   608   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   601   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   592   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   575   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   569   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   561   0.0  
KLLA0E13333g Chr5 (1178639..1179130) [492 bp, 163 aa] {ON} highl...    37   0.044
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    37   0.11 
Kwal_56.22883 s56 complement(313749..314234) [486 bp, 161 aa] {O...    35   0.21 
TPHA0M00460 Chr13 complement(87266..87730) [465 bp, 154 aa] {ON}...    34   0.38 
KLTH0C08514g Chr3 (717495..717974) [480 bp, 159 aa] {ON} similar...    33   0.47 
Smik_15.87 Chr15 (160826..161302) [477 bp, 158 aa] {ON} YOL071W ...    33   0.73 
Skud_15.81 Chr15 (155660..156139) [480 bp, 159 aa] {ON} YOL071W ...    32   1.7  
NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON...    32   2.2  
TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON...    31   2.5  
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    32   3.6  
Ecym_5276 Chr5 (563865..564362) [498 bp, 165 aa] {ON} similar to...    31   3.9  
YOL071W Chr15 (196507..196995) [489 bp, 162 aa] {ON}  EMI5Subuni...    31   4.0  
KNAG0E01080 Chr5 (209650..210444) [795 bp, 264 aa] {ON} Anc_4.13...    31   4.2  
KNAG0D03410 Chr4 complement(609661..610671) [1011 bp, 336 aa] {O...    31   5.3  
Suva_15.94 Chr15 (169308..169787) [480 bp, 159 aa] {ON} YOL071W ...    30   5.4  
AER200C Chr5 complement(1012538..1013020) [483 bp, 160 aa] {ON} ...    30   5.7  
CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly ...    31   6.3  
Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON...    30   7.5  

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/429 (100%), Positives = 429/429 (100%)

Query: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60
           MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD
Sbjct: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60

Query: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120
           QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL
Sbjct: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120

Query: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180
           KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM
Sbjct: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180

Query: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFI 240
           LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFI
Sbjct: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFI 240

Query: 241 LGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMK 300
           LGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMK
Sbjct: 241 LGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMK 300

Query: 301 MHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFT 360
           MHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFT
Sbjct: 301 MHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFT 360

Query: 361 TGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFR 420
           TGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFR
Sbjct: 361 TGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFR 420

Query: 421 GKRYHAIEL 429
           GKRYHAIEL
Sbjct: 421 GKRYHAIEL 429

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/407 (79%), Positives = 363/407 (89%), Gaps = 1/407 (0%)

Query: 24  GKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVT 83
            K   R IMGFVRNALGLDPP SPD+PT +NRFHPWDQSPSP+LRERAARIKA+A CPVT
Sbjct: 12  AKPMTRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVT 71

Query: 84  GKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPE 143
            K+IQF+C  SGIPTHHS EAW+ D+EYH+SKRY LLKKVNIYEHDLRSGRPF EFDFP+
Sbjct: 72  HKDIQFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQ 131

Query: 144 QQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKG 203
            QDYDRMVNM NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LHQYSPYSLNPKG
Sbjct: 132 DQDYDRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKG 191

Query: 204 PITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPE 263
           PITLEGLKSLAALRYTLYPEQ+ R R+ QD P+R+FILG RAEAQLPGHVWKQLQYL P+
Sbjct: 192 PITLEGLKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPD 251

Query: 264 SLIELHFVGPESNYDREKREYVTSSI-PVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDP 322
           + IELHFVGPES YDREKR YV SS   +VKRID+ M++ YHTD+FHVFHEAQDFFPYDP
Sbjct: 252 TSIELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDP 311

Query: 323 YNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDE 382
           YND+FFCFHPGF +PET + WM  T++AL+QTKCA+FTTGF+K+DL+ D+  V++KYG E
Sbjct: 312 YNDVFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSE 371

Query: 383 LDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
           LDML++P  NVFGSTKWELND NPHEVYQFNMYIAGFRGKRYHAIEL
Sbjct: 372 LDMLMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/430 (72%), Positives = 373/430 (86%), Gaps = 8/430 (1%)

Query: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60
           MLL   KR        +S++R+    Q+R I+GFVRNALGLDPP SPD+PT DNRFHPWD
Sbjct: 1   MLLSAYKRCS---IAPASATRI----QKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWD 53

Query: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120
           QSPSP+LR RAA I+ALA+CPVTGK I ++C  SGIPTHHS EAW+ D+ YH +K+Y +L
Sbjct: 54  QSPSPDLRTRAATIRALARCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEIL 113

Query: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180
           KKVNIYEHDLRSGRPF EFDFP+ QDYDRMVNM NWDL+FYTR F+SMDTEFQLAAVTKM
Sbjct: 114 KKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKM 173

Query: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVR-SIQDKPLRVF 239
           LSYP T+GS+LH++SPY+LNPKGPITLEGLKSLAALRYTLYP+Q+R+V  + +D+P+R+F
Sbjct: 174 LSYPTTVGSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIF 233

Query: 240 ILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTM 299
           ILGARAEAQLPGHVWKQ Q+LFPE   ELHF+GPES YDREKREY+TSS P+V+R+D+T+
Sbjct: 234 ILGARAEAQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETL 293

Query: 300 KMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIF 359
              YHTDYFHVFHEAQDFFPYDPY DIFFCFHPGF +PE+ + WM  T++ LL+TKCAIF
Sbjct: 294 SFVYHTDYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIF 353

Query: 360 TTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGF 419
           TTGFN++DL+ D+ AV+EKYG+E+DML++P +N+FGSTKWELND+NP EVYQFNMYIAGF
Sbjct: 354 TTGFNEQDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGF 413

Query: 420 RGKRYHAIEL 429
           RGKRYHAIE+
Sbjct: 414 RGKRYHAIEV 423

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/431 (72%), Positives = 368/431 (85%), Gaps = 8/431 (1%)

Query: 1   MLLPVTKRLGRPGFISSSSSRVCGK--QQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHP 58
           M+L  T R        S  ++ CGK   QRR I+GFVRNALGLDPP SPD+PT +NRFHP
Sbjct: 1   MMLSATSRF------PSLRAQRCGKVFNQRRFIIGFVRNALGLDPPPSPDDPTPENRFHP 54

Query: 59  WDQSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYR 118
           WDQSP  +LRERAARI+ LA+CPVTGK I ++C  SGIPTHHS EAW+ D +YH+SK+Y 
Sbjct: 55  WDQSPVGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYE 114

Query: 119 LLKKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVT 178
           +LKKVNIYEHDLRSGRPF EFDFP+ QD+DR VNM NWDL+FYTR F+SMDTEFQLAAVT
Sbjct: 115 ILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVT 174

Query: 179 KMLSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRV 238
           KMLSYPI+I S+LHQ+SPYSLNPKGP+TLEGLKSLAALRYTLYP +N+ + S +D+P+R+
Sbjct: 175 KMLSYPISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISSTKDRPMRI 234

Query: 239 FILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDT 298
           FILGARAEAQLPGHVWKQLQYLFPE + ELHFVGPE   ++EK +YVTSS PVVKR+D+T
Sbjct: 235 FILGARAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDET 294

Query: 299 MKMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAI 358
           +   YHTD+FHV HEAQDFFPYDPY D+FFCFHPGFG+PET  +W+N T++ LL+TKCAI
Sbjct: 295 ISFVYHTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAI 354

Query: 359 FTTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAG 418
           FTTGFNK DL+ D+ AVK+KYG E+D+L++P KNVFGSTKWELND+NP EVYQFNMYIAG
Sbjct: 355 FTTGFNKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAG 414

Query: 419 FRGKRYHAIEL 429
           FRGKRYHAIE+
Sbjct: 415 FRGKRYHAIEV 425

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/417 (75%), Positives = 364/417 (87%), Gaps = 2/417 (0%)

Query: 15  ISSSSSRVCGKQ-QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAAR 73
           +S ++ R C    Q+R IMGFVRNALGLDPP SPDEPT +NRFHPWDQSPSP+LRERAA 
Sbjct: 6   LSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAAT 65

Query: 74  IKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSG 133
           I+ALAKCPVTG+ I ++C  SGIPTH+S EAW+ND EY +SKR  +LKKVNIYEHDLRSG
Sbjct: 66  IRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSG 125

Query: 134 RPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQ 193
           RPF EFDFP  QD+DRMVN+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TIGS+LHQ
Sbjct: 126 RPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQ 185

Query: 194 YSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSI-QDKPLRVFILGARAEAQLPGH 252
           +SPYSLNPKGP+TLEGLKSLAALRYTLYPEQNRRV SI ++ PLR+FILGARAEAQLPGH
Sbjct: 186 FSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGH 245

Query: 253 VWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFH 312
           VWKQLQ++FPE+ IELHFVGPES YDR KREYV SS P+V+R+D+T+   YHTDYFHVFH
Sbjct: 246 VWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFH 305

Query: 313 EAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDL 372
           EAQDFFPYDPY DIFFCFHPGF +PE+R+ WM  T++ALL+TKCA+FTTGFN+ DL  D+
Sbjct: 306 EAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDV 365

Query: 373 QAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
             V  K+G ELDML++P  N FGSTKWELND+NP EVYQFNM+IAGFRGKRYHAIE+
Sbjct: 366 GTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/404 (76%), Positives = 359/404 (88%), Gaps = 1/404 (0%)

Query: 27  QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKN 86
           Q+R IMGFVRNALGLDPP SPDEPT +NRFHPWDQSPSP+LRERAA I+ALAKCPVTG+ 
Sbjct: 19  QKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGRE 78

Query: 87  IQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQD 146
           I ++C  SGIPTHHS EAW+ D +Y +SKR  +LKKVNIYEHDLRSGRPF EFDFP  QD
Sbjct: 79  INYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQD 138

Query: 147 YDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPIT 206
           +DRMVN+ NWDL+FYTR FFSMDTEFQLAAVTKMLSYPITIGS+LHQ+SPYSLNPKGPIT
Sbjct: 139 FDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 198

Query: 207 LEGLKSLAALRYTLYPEQNRRVRSI-QDKPLRVFILGARAEAQLPGHVWKQLQYLFPESL 265
           LEGLKSLAALRYTLYP+QNRRV SI ++ PLR+F+LGARAEAQLPGHVWKQLQ++FPE+ 
Sbjct: 199 LEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQ 258

Query: 266 IELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYND 325
           +E+HFVGPES YDR KREYV S+ P+++R+D+T+   YHTDYFHVFHEAQDFFPYDPY D
Sbjct: 259 MEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTD 318

Query: 326 IFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELDM 385
           IFFCFHPGF +PE+R+ WM  T++ALL+TKCAIFTTGFN+ DL  DL AV  +YG ELD+
Sbjct: 319 IFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDI 378

Query: 386 LVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
           ++DP KN FGSTKWELND+NP EVYQFNM++AGFRGKRYHAIE+
Sbjct: 379 IMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/417 (73%), Positives = 349/417 (83%), Gaps = 15/417 (3%)

Query: 28  RRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNI 87
           +RQ+MGFVRNALGLDPP SPDEPT  NRFHPWDQSP+ +LRERAARIK LAKCPVT K I
Sbjct: 21  KRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPI 80

Query: 88  QFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDY 147
           Q++C  SGIPTHHS EAW+ D EYH SK+Y +LKKVNIYEHDLRSGRPF EFDFP  Q  
Sbjct: 81  QYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGP 140

Query: 148 DRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITL 207
           DR VN+ NWDL+ YTRSF+SMDTEFQLAAVTKMLSYPITIGS+LHQ+SPYSLNPKGPITL
Sbjct: 141 DRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITL 200

Query: 208 EGLKSLAALRYTLYPEQNRRVRSI-QDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLI 266
           EGLKSLAALRYTLYP QNR V +  ++KP+R+FILGARAEAQLPGHVWKQLQ+LFP+   
Sbjct: 201 EGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNF 260

Query: 267 ELHFVGPESNYDREKREYV--------------TSSIPVVKRIDDTMKMHYHTDYFHVFH 312
           E+HF+GPES YDRE+ EY+              TSSIPV KRID+TMK  YHTDYFH  H
Sbjct: 261 EIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLH 320

Query: 313 EAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDL 372
            AQDFFPYDPY D+FF FHPG  SPE++DTWM  T++ LL TKCAIFTTGFNKKD+ DD+
Sbjct: 321 TAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDI 380

Query: 373 QAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
           Q +++ YG E+DML++P KNVFGSTKWEL+D +PH VYQFNMYIAGFRGKRYH I++
Sbjct: 381 QILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV 437

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/408 (74%), Positives = 353/408 (86%), Gaps = 1/408 (0%)

Query: 22  VCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCP 81
           V   Q RR +MGFVRNALGLDPP SPD+PT +NRFHPWDQSPS +LRERAA+I+ LA CP
Sbjct: 27  VVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCP 86

Query: 82  VTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDF 141
           VTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRPF EFDF
Sbjct: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146

Query: 142 PEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNP 201
           P+QQ YD+ VN+ NWDL+ YTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNP
Sbjct: 147 PQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206

Query: 202 KGPITLEGLKSLAALRYTLYPEQNRRV-RSIQDKPLRVFILGARAEAQLPGHVWKQLQYL 260
           KGPITLEGLKSLAALRYTLYP +NR V  + +++ +R+FILGARAEAQLPGHVWKQLQ+L
Sbjct: 207 KGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFL 266

Query: 261 FPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPY 320
           FPE   E+HF+GPE  Y R+K+EYV S+ PVV+RID+T+K  +HTD+F VFHEAQDFFPY
Sbjct: 267 FPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPY 326

Query: 321 DPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYG 380
           DPY D+FF FHPG+ SPE+  +WM  T+ ALL+TKCAIFTTGFNKKDLMDD+  VK KYG
Sbjct: 327 DPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYG 386

Query: 381 DELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428
            E+D+L+DP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 387 KEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/408 (74%), Positives = 356/408 (87%), Gaps = 1/408 (0%)

Query: 22  VCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCP 81
           V   Q RR +MGFVRNALGLDPP SPD+PT +NRFHPWDQSPS +LRERAA+I+ LA CP
Sbjct: 27  VVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCP 86

Query: 82  VTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDF 141
           VTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRPF EFDF
Sbjct: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146

Query: 142 PEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNP 201
           P+QQ YD+ VN+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNP
Sbjct: 147 PQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNP 206

Query: 202 KGPITLEGLKSLAALRYTLYPEQNRRV-RSIQDKPLRVFILGARAEAQLPGHVWKQLQYL 260
           KGPITLEGLKSLAALRYTLYP +NR V  + +++ +R+FILGARAEAQLPGHVWKQLQ+L
Sbjct: 207 KGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFL 266

Query: 261 FPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPY 320
           FPE   E+HFVGPE  Y R+K+EYV S+ PVV+R+D+T++  +HTD+F VFHEAQDFFPY
Sbjct: 267 FPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPY 326

Query: 321 DPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYG 380
           DPY D+FF FHPG+ SPE+  +WM  T++ALL+TKCAIFTTGFNKKDLMDD+ AVK KYG
Sbjct: 327 DPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYG 386

Query: 381 DELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428
            E+D+L+DP +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 387 KEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/406 (73%), Positives = 354/406 (87%), Gaps = 3/406 (0%)

Query: 27  QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKN 86
           Q+R +MGFVRNALGLDPP SPD+PT +NRFHPWDQSP  +LRERAA+I+ LAKCPVT K+
Sbjct: 20  QKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKD 79

Query: 87  IQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQD 146
           I ++C  SGIPTHH +EAW  D +YHESKRY +LKKVNIYEHDLRSGRPF EFDFP+ QD
Sbjct: 80  INYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139

Query: 147 YDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPIT 206
           YDR++N+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LHQ+SPYSLNPKGP+T
Sbjct: 140 YDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVT 199

Query: 207 LEGLKSLAALRYTLYPEQNRRVR---SIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPE 263
           LEGLKSLAALRYTLYP QN+      + +D+P+R+FILGARAEAQLPGHVWKQ QYLFPE
Sbjct: 200 LEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPE 259

Query: 264 SLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPY 323
              E+HF+GPE   ++EK +Y+TSS P+VK++DDT+K+ +H DYFHVFHEAQDFFPYDP+
Sbjct: 260 QEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPF 319

Query: 324 NDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDEL 383
            D+FF FHPG+  PET + W+  T++ALL TKCAIFTTGF+K+DL+ D+  VK +YG+EL
Sbjct: 320 LDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNEL 379

Query: 384 DMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
           DML+DP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 380 DMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/414 (72%), Positives = 355/414 (85%), Gaps = 1/414 (0%)

Query: 16  SSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIK 75
           SS +  V   Q RR +MGFVRNALGLDPP SPD+PT +NRFHPWDQSPS +LRERAA+I+
Sbjct: 21  SSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIR 80

Query: 76  ALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRP 135
            LA CPVTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRP
Sbjct: 81  TLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRP 140

Query: 136 FLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYS 195
           F EFDFP+ Q YD+ VN+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++S
Sbjct: 141 FPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFS 200

Query: 196 PYSLNPKGPITLEGLKSLAALRYTLYPEQNRR-VRSIQDKPLRVFILGARAEAQLPGHVW 254
           PYSLNPKGPITLEGLKSLAALRYTLYP +NR  + + +++ +R+FILGARAEAQLPGHVW
Sbjct: 201 PYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVW 260

Query: 255 KQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEA 314
           KQLQ+LFPE   E+HF+GPE  Y R+K+EYV S+ PVV+R+D+T+K  + TD+F VFHEA
Sbjct: 261 KQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEA 320

Query: 315 QDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQA 374
           QDFFPYDPY D+FF FHPG+ SPE+  +WM  T++ALL+TKCAIFTTGFNKKDL DDL  
Sbjct: 321 QDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNL 380

Query: 375 VKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428
           VK KYG E+D+L+DP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 381 VKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/413 (72%), Positives = 360/413 (87%), Gaps = 3/413 (0%)

Query: 17  SSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKA 76
             ++  CG  QRR IMGFVRNALGLDPP SPDEPT +NRFH W+QSPSP+LRERAARI+A
Sbjct: 19  GCAAGACG--QRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRA 76

Query: 77  LAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPF 136
           LA+CPVTGK+I++SC+ SGIPTHHS EAW+ D EYH SKR+  L+KVN+YEHDLRSGRPF
Sbjct: 77  LARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPF 136

Query: 137 LEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSP 196
            EFDFP++Q  DRMVNM+NWDL+ YTR F+SMDT+FQLAAVTKMLSYPITIGS+LHQ+SP
Sbjct: 137 AEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSP 196

Query: 197 YSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQ 256
           Y+L P+GPITLEGLKSLAALRYTLYPE +   R+++ KP+R+FILGARAEAQLPGHVWKQ
Sbjct: 197 YALEPRGPITLEGLKSLAALRYTLYPE-SESARAVRSKPMRIFILGARAEAQLPGHVWKQ 255

Query: 257 LQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQD 316
           LQYLFP S +E+HF+GPE+ YDR+++EYV SS PV KR+D T+K+ +HTDY HVFHEAQD
Sbjct: 256 LQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQD 315

Query: 317 FFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVK 376
           FFPYDPYND+FFCFHPGF S E R +WM+ T+ ALL+TKCAIF TGF++ D+  D +A++
Sbjct: 316 FFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALR 375

Query: 377 EKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
             +  E+D+L+ PTKN+FGSTKWELND+NPHEVYQFNMYIAGFRGKRYHAI++
Sbjct: 376 ASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/408 (72%), Positives = 353/408 (86%), Gaps = 1/408 (0%)

Query: 22  VCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCP 81
           V   Q RR +MGFVRNALGLDPP SP++PT +NRFHPWDQSPS +LRERAA+I+ LA CP
Sbjct: 27  VVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCP 86

Query: 82  VTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDF 141
           VTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRPF EFDF
Sbjct: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146

Query: 142 PEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNP 201
           P+QQ YD+ VN+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNP
Sbjct: 147 PQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNP 206

Query: 202 KGPITLEGLKSLAALRYTLYPEQNRRV-RSIQDKPLRVFILGARAEAQLPGHVWKQLQYL 260
           KGPITLEGLKSLAALRYTLYP +NR +  + +++ +R+FILGARAEAQLPGHVWKQLQ+L
Sbjct: 207 KGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFL 266

Query: 261 FPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPY 320
           FPE   E+HF+GPE  Y R+K+EYV S+ PVV+R+D+T+K  Y T++F VFHEAQDFFPY
Sbjct: 267 FPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPY 326

Query: 321 DPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYG 380
           DPY D+FF FHPG+ SPE+  +WM  T++ALL+TKCAIFTTGFNKKDL DD+  VK KYG
Sbjct: 327 DPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYG 386

Query: 381 DELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428
            E+D+L++P +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 387 KEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/429 (69%), Positives = 354/429 (82%), Gaps = 2/429 (0%)

Query: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60
           M L  +  + R   +  ++  V G Q R  +MGFVRNALGLDPPTSPD+PT +NRFHPWD
Sbjct: 1   MFLRTSVPVYRTTLLPRNAFNVAGNQTR-HLMGFVRNALGLDPPTSPDDPTPENRFHPWD 59

Query: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120
           QSPSP+LRERAARI+ LA+CPVTGK I ++C  SGIPTHHS EAW+ D EYH SKRY LL
Sbjct: 60  QSPSPDLRERAARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELL 119

Query: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180
           KKVNIYEHDLRSGRPF EFDFP  Q  DRMVNM NWDL+ YTR+F+SMDTEFQ+AAVTKM
Sbjct: 120 KKVNIYEHDLRSGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKM 179

Query: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRS-IQDKPLRVF 239
           LSYPITIGS+LHQ+SPYSL PKGPI+LEGLKSLAALRYTLYP QNR V S  + +P+R+F
Sbjct: 180 LSYPITIGSVLHQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIF 239

Query: 240 ILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTM 299
           ILGARAE+QLPGHVWKQLQYLFPE   E+HF+GPES YD++K++Y+  + P+ + +D+T+
Sbjct: 240 ILGARAESQLPGHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETL 299

Query: 300 KMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIF 359
           K+ YHT+YFH  HEAQDFFPYDPY D+FF FHPGF S E  + WM  T++ LL TKCAIF
Sbjct: 300 KLIYHTEYFHKLHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIF 359

Query: 360 TTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGF 419
           TTGF K DL++D+  V++KYG ELD+L+ PTKNVFGSTKWELND+NP EVYQFNMYIAGF
Sbjct: 360 TTGFTKNDLLEDIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGF 419

Query: 420 RGKRYHAIE 428
           RGKRY  I+
Sbjct: 420 RGKRYPTIK 428

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/404 (71%), Positives = 350/404 (86%), Gaps = 2/404 (0%)

Query: 27  QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKN 86
           Q+R +MGFV+NALGLDP  SPD+PT +NRFHPWDQSPSP+LRERAARI+ LAKCPVT K 
Sbjct: 32  QKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKE 91

Query: 87  IQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQD 146
           I ++C  SGIPTHHS EAW+ D +YH+SKRY +LKKVNIYEHDLRSGRPF EFDFP  Q 
Sbjct: 92  INYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQI 151

Query: 147 YDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPIT 206
           +DR+VN+ NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TIGSILHQ+SPYSLNPKGPIT
Sbjct: 152 HDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPIT 211

Query: 207 LEGLKSLAALRYTLYPEQNRRVRSIQ--DKPLRVFILGARAEAQLPGHVWKQLQYLFPES 264
           LEGLKSLAALRY+LYP Q +   S++  D+P+R+FILGARAEAQLPGHVWKQLQ+LFP+ 
Sbjct: 212 LEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQ 271

Query: 265 LIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYN 324
             E+HF+G E   + EK +Y+ S+IPVVK+ID+TMK+ YH+DYFHV+HEAQDF PYDPY 
Sbjct: 272 TFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYL 331

Query: 325 DIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELD 384
           D+FF FHPGF +PET D WM  T++ALL+TKCAIFTTGFNK+D+ +D++ VK +YG E+D
Sbjct: 332 DVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMD 391

Query: 385 MLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428
            L+DP KN +GSTKWELND+NP E++QFNMY+AGFRGKRYH I+
Sbjct: 392 TLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/412 (71%), Positives = 353/412 (85%), Gaps = 1/412 (0%)

Query: 19  SSRVCGK-QQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKAL 77
           S R+C    QRR I+GFVRNALGLDPP SPD+PT +NRFH WDQSP+ +LRERAARI+AL
Sbjct: 4   SIRLCRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRAL 63

Query: 78  AKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFL 137
           A+CPVTGK I ++C  SGIPTHHS+EAW+ D +YHESK++ LLKKVNIYEHDLRSGRPF 
Sbjct: 64  AQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFP 123

Query: 138 EFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPY 197
           EFDFP+  ++DR VNM NWDL+FYTR F+SMDTEFQLAAVTKMLSYPITI S+L+Q+SPY
Sbjct: 124 EFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPY 183

Query: 198 SLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQL 257
           SLNPKGPITLEGLKSLAALRYTLYP +N+ V + +D+P+R+FILGARAEA LPGHVWKQL
Sbjct: 184 SLNPKGPITLEGLKSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQL 243

Query: 258 QYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDF 317
           Q+LFPE+  ELHF+GPE   ++EK +YV+S  PVVKRID+T+   YHTDYFHV+H+AQDF
Sbjct: 244 QFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDF 303

Query: 318 FPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKE 377
           FPYDPY D FFCFHPGFG+PE+   W+  T+  LL+TKCAIF TG NK  L+ D+ AV +
Sbjct: 304 FPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMD 363

Query: 378 KYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
           K+  E+D+L++PTKN++GSTKWELND+NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 364 KHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/430 (69%), Positives = 356/430 (82%), Gaps = 12/430 (2%)

Query: 11  RPGFISSSSS-RVCGKQ--QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPEL 67
           RPG  S+  + R  G     RRQ+MGFVRNALGL+PP SP +PT +NRFHPWDQSP   L
Sbjct: 8   RPGVRSAHRALRASGLPCIARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDAL 67

Query: 68  RERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYE 127
           RERAARIK LAKCPVTG N++++C  SGIPTHHS EAW+ D++YH +KRY  LKKVNIYE
Sbjct: 68  RERAARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYE 127

Query: 128 HDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITI 187
           HDLRSGRPF EFDFP++Q YD++VNM NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TI
Sbjct: 128 HDLRSGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTI 187

Query: 188 GSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQ-NRRVR--------SIQDKPLRV 238
            S+L Q+SPYSLNPKGPITLEGLKSLAA+RYTLY +  N   R        +++++P+R+
Sbjct: 188 ASLLAQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRL 247

Query: 239 FILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDT 298
           F+LGARAEAQLPGHVWKQL YLFPE   E+ F+GPES YDR + +YV S  PVV+++D+T
Sbjct: 248 FVLGARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDET 307

Query: 299 MKMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAI 358
           +K  ++TDYFHV HE+QDFFPYDPY D FF FHPGF SPE RDTW+++TL ALL TKCAI
Sbjct: 308 LKFIHYTDYFHVLHESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAI 367

Query: 359 FTTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAG 418
           FTTGF++ DLM+D+  + EK+G E+D+L++PTKNVFGSTKWELNDLNPHEVYQFNMYIAG
Sbjct: 368 FTTGFDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAG 427

Query: 419 FRGKRYHAIE 428
           FRGKRYH I+
Sbjct: 428 FRGKRYHTIK 437

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/402 (67%), Positives = 338/402 (84%), Gaps = 1/402 (0%)

Query: 29  RQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQ 88
           R +MGFVRNALGLDP +SPD+PT +NRFHPWDQSP  +LRERAA+I+ LA CPVT K I 
Sbjct: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101

Query: 89  FSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYD 148
           ++C  SGIPTHHS+ AW+ D  YH +K Y +LKKVNIYEHDLRSGRPF EF FP+ QD+D
Sbjct: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161

Query: 149 RMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLE 208
           RM+NM NWDL+ YTRSF+SMDTEFQ+AAVTKMLSYPITIGSILHQ+SPYSL PKGPITLE
Sbjct: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221

Query: 209 GLKSLAALRYTLYPEQNRRVRSI-QDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIE 267
           GLKS+AALRYTLYP  N+   ++ +++P+R+F+LGARAEAQLPGH+WKQLQYLFPE   E
Sbjct: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281

Query: 268 LHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYNDIF 327
           L F+GPE+ YD+EK++Y+    P+++ IDDT+K+ + T+YFH  HE+QD FPYDPY D+F
Sbjct: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341

Query: 328 FCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELDMLV 387
           F FHPGF + ET + WMN T+++LL+T+CAIF TGF++ D+++D+  + EKY ++LD+L+
Sbjct: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401

Query: 388 DPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
            P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRY  +EL
Sbjct: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/403 (68%), Positives = 329/403 (81%), Gaps = 3/403 (0%)

Query: 29  RQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQ 88
           R ++GFVRNALGL+PP +PDEP V NRF+PWDQSPSPELRERAA+IKA+A+CP+TGK I 
Sbjct: 25  RTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEIN 84

Query: 89  FSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYD 148
           ++C  SGIPTHHS EAW+ D  YH +K   +LKKVNIYEHDLRSGR F EFDFP  Q +D
Sbjct: 85  YTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFD 144

Query: 149 RMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLE 208
           R VN+ NWDLYFYTRSF+SMDTEFQLA VTKMLSYPITI S+LHQYSPYSL P GPITLE
Sbjct: 145 RAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLE 204

Query: 209 GLKSLAALRYTLYPEQNRRVRSIQDK--PLRVFILGARAEAQLPGHVWKQLQYLFPESLI 266
           GLKS+AALRY+LYP Q++  RS+ +K  P+R+FILGARAE+QLPGHVWKQ QYLFP    
Sbjct: 205 GLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTF 264

Query: 267 ELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYNDI 326
           E+ F+GPE    RE    V  +  +VKRIDDT+ + YH   FH  H+AQDFFPYDPYND+
Sbjct: 265 EIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYNDV 323

Query: 327 FFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELDML 386
           FF FHPGF SPET++ WMN T++ALL TKCA+F TGF+KKDL +D++ + + YGD+LD L
Sbjct: 324 FFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDTL 383

Query: 387 VDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
           + P KN+FGSTKWELNDLNP EVYQFNMYI+ FRGKRYH IE+
Sbjct: 384 MTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/400 (66%), Positives = 331/400 (82%), Gaps = 3/400 (0%)

Query: 29  RQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQ 88
           R ++GFV+NALG+DPP  P EP   NRF+PWD+SPSP +RERAARIKA AKCPVTGK I+
Sbjct: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89

Query: 89  FSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYD 148
           F+C  SGIPTH+S+EAW+ND+ YH++K Y  L+KVNIYEHDLRSGRPF EFDFP +Q  D
Sbjct: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149

Query: 149 RMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLE 208
             VNM NWDL+FYTR F+SMDTEFQLA VTKMLSYPITIGSIL++YSPY+L PKGP+TLE
Sbjct: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209

Query: 209 GLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIEL 268
           GLKSLAALRYTL   +N    + + +P+R+FILGARAE+QLP H+WKQLQ+LFP    E+
Sbjct: 210 GLKSLAALRYTL---RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEI 266

Query: 269 HFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYNDIFF 328
           +F+GPE +   +   Y++S   +VKR+D+++ + Y+ DYF  FH+AQDFFPYDPYNDIFF
Sbjct: 267 NFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFF 326

Query: 329 CFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELDMLVD 388
            FHPGF SPE+  TWM  T++ALL TKCAIFTTGF++ D+M D+ +V++ YG+E+DML++
Sbjct: 327 TFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMN 386

Query: 389 PTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428
           P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRYH ++
Sbjct: 387 PIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVK 426

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 329/419 (78%), Gaps = 17/419 (4%)

Query: 25  KQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTG 84
           K   R  +GFV+NALG++PP SP+EP  +NRFHPWDQSPSP+LRERAARI+ALAKCPVTG
Sbjct: 35  KFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTG 94

Query: 85  KNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQ 144
           K I ++C  SGIPTHHS+EAW+ND+ YH++K Y +LKKVN++EHDLRSGR F EF+FP+ 
Sbjct: 95  KEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQS 154

Query: 145 QDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGP 204
           QD+D  V+M NWD++FYTR F SMD+EFQLA VTKMLSYPITI SILH+Y PY+L P GP
Sbjct: 155 QDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGP 214

Query: 205 ITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPES 264
           ITLEGLKS+AAL+Y+L   ++    + +++P+R+FILGARAE+QLP H+WKQ  YLFP  
Sbjct: 215 ITLEGLKSIAALKYSL---RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQ 271

Query: 265 LIELHFVGPESNY--------DREKREYVTSSIP------VVKRIDDTMKMHYHTDYFHV 310
             E++F+GPE +           E     + S+       +VKRID+ + + YHTD+FH 
Sbjct: 272 NFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHT 331

Query: 311 FHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMD 370
            H A+DFFPYD YND+FF FHPGF SPE   +WM  T++ALL TKCAIFTTGFNK+DL+ 
Sbjct: 332 LHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLK 391

Query: 371 DLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429
           D+  V+E YG E+DML+ PTKNVFGSTKWELND++P EVYQ+NMYIAGFRGKRYHA+++
Sbjct: 392 DIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/425 (62%), Positives = 333/425 (78%), Gaps = 13/425 (3%)

Query: 15  ISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARI 74
           I S +   C    +R +MGFVR+ LGLDPP SP++PT +NRFHPW+ SP  +LRERAARI
Sbjct: 11  ILSKNIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARI 70

Query: 75  KALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGR 134
           K +AKCPV+  +I ++C  SGIPTHHS + W+ D+ YH++    +LKKVNIYEHDLRSGR
Sbjct: 71  KTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGR 130

Query: 135 PFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQY 194
           PF EFDFP +Q+YD ++N++NWDLYFYTR+FFSMDTEFQLAAVTKMLSYP+TI S+LHQ+
Sbjct: 131 PFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQF 190

Query: 195 SPYSLNPKGPITLEGLKSLAALRYTL-----------YPEQNRRVRSIQDKPLRVFILGA 243
           SPYSL PKGP+TLEGLKSLAALRYTL             +      + +++P+R+FILGA
Sbjct: 191 SPYSLTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGA 250

Query: 244 RAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHY 303
           RAEAQLP HVWKQLQYLFP S  E+HF+GPES   ++K  YVTS+ P+ KRIDD+M + Y
Sbjct: 251 RAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVY 310

Query: 304 HTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGF 363
           HTDYFHV+H+AQDF+PYDPY DIFF FHPG  +  T++TW+N T+Q LL +KC IF TGF
Sbjct: 311 HTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMTGF 368

Query: 364 NKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKR 423
           ++KD+  D+  + + +  ++D+L+ P KNVFGSTKWELND NP EVYQFNMYIAG+RGKR
Sbjct: 369 HEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKR 428

Query: 424 YHAIE 428
           YHA E
Sbjct: 429 YHATE 433

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/429 (59%), Positives = 325/429 (75%), Gaps = 5/429 (1%)

Query: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60
           MLL     LG+     S  + +      R IMG+VRNA GL+P  SPD P + NRFHPW+
Sbjct: 1   MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE 60

Query: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120
           +SP  +LR+RAARIK LA+CPVTGKNI ++C  SGIPTHHS +AW++D++YH++K Y  L
Sbjct: 61  ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL 120

Query: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180
           KKVNIYEHDLRSGR F EFDFP +Q  DR VN+ NWDL+ YTR F+SMDTEF LA VTKM
Sbjct: 121 KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM 180

Query: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSIQDKPLRVFI 240
           LSYPITI S+LH++SPY L P+GP+TLEGLKS+AALRYTLYP+  +   S  + P+R+FI
Sbjct: 181 LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLS-NNSPMRIFI 239

Query: 241 LGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMK 300
           +G RAE+QLPGHVWKQLQYLF E + E+HF+GPE      K     +S P++K++DDT+ 
Sbjct: 240 VGTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPK----NTSTPLIKKVDDTLS 295

Query: 301 MHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFT 360
           + YH  YFH  H++ D FPY+PY D+FF FHPGF  P+TR  W++ T+  LL+TKCAIF 
Sbjct: 296 LIYHPQYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFH 355

Query: 361 TGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFR 420
           TGFN+ D+ +D+  + + Y +E+D+L+ P KNVFGS KWELND+NP EVYQFNMYIAGFR
Sbjct: 356 TGFNEGDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFR 415

Query: 421 GKRYHAIEL 429
           GKRYH I++
Sbjct: 416 GKRYHPIKI 424

>KLLA0E13333g Chr5 (1178639..1179130) [492 bp, 163 aa] {ON} highly
           similar to uniprot|Q08230 Saccharomyces cerevisiae
           YOL071W EMI5 Non-essential protein of unknown function
           required for transcriptional induction of the early
           meiotic-specific transcription factor IME1 also required
           for sporulation
          Length = 163

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 7/70 (10%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDL---RSGRPFLEFDFPEQ-QDYDRMVNMMNWDL 158
           K   E  + KR RL+   +K  I E DL   R    +L+   PEQ ++YD+++N ++WD+
Sbjct: 58  KRTGESLDKKRARLIYQSRKRGILETDLLLSRFAAKYLKEMTPEQLEEYDQLLNELDWDI 117

Query: 159 YFYTRSFFSM 168
           Y++    +S+
Sbjct: 118 YYWATENYSI 127

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 60/128 (46%), Gaps = 10/128 (7%)

Query: 177 VTKMLSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRV-----RSI 231
           V +++S    + SIL + +    NP+ P T+  L +L  ++ +++P+  R         +
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 232 QDKPLRVFILGARAEAQLPGHVWKQLQY----LFPESLIELHFVGPESNYDREKREYVTS 287
             K L +F L A+ E  + G+    L+     +  E   E+++    SN  R   +Y+  
Sbjct: 721 SRKNLEIFTLLAKMETSILGNYLSDLKVTLRDILEERFYEINWAAYNSNSFRVG-DYIIE 779

Query: 288 SIPVVKRI 295
           ++ V+ R+
Sbjct: 780 ALMVLVRV 787

>Kwal_56.22883 s56 complement(313749..314234) [486 bp, 161 aa] {ON}
           YOL071W - Hypothetical ORF [contig 184] FULL
          Length = 161

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 8/68 (11%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDL---RSGRPFLEFDFPEQQD-YDRMVNMMNWDL 158
           K   E  E+KR RL+   +K  I E DL   R    +L+   PE+ D YD +++ ++WD+
Sbjct: 56  KRTGETLENKRARLVYQSRKRGILETDLLLSRFAARYLDSMTPEELDEYDSLLDELDWDI 115

Query: 159 YFY-TRSF 165
           Y++ TR++
Sbjct: 116 YYWATRNY 123

>TPHA0M00460 Chr13 complement(87266..87730) [465 bp, 154 aa] {ON}
           Anc_3.144 YOL071W
          Length = 154

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 7/56 (12%)

Query: 113 ESKRYRLL---KKVNIYEHDL---RSGRPFLEFDFPEQQD-YDRMVNMMNWDLYFY 161
           E+K+ RL+   +K  I E DL   R    +L+   P+Q D YD ++N ++WD+Y++
Sbjct: 56  ETKKARLIYQSRKRGILETDLLLSRFAAKYLKTMTPQQLDEYDSLLNELDWDIYYW 111

>KLTH0C08514g Chr3 (717495..717974) [480 bp, 159 aa] {ON} similar to
           uniprot|Q08230 Saccharomyces cerevisiae YOL071W EMI5
           Non-essential protein of unknown function required for
           transcriptional induction of the early meiotic-specific
           transcription factor IME1 also required for sporulation
          Length = 159

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 103 EAWKNDSEYHESKRYRLL---KKVNIYEHDL---RSGRPFLEFDFPEQ-QDYDRMVNMMN 155
           E  K   E  E+KR RL+   +K  I E DL   R    +L    PE+ ++YD +++ ++
Sbjct: 51  EPIKRAGETLENKRARLVYQSRKRGILETDLLLSRFAAKYLSSMTPEELEEYDALLDELD 110

Query: 156 WDLYFYTRSFFSM 168
           WD+Y++    +++
Sbjct: 111 WDIYYWATKNYAI 123

>Smik_15.87 Chr15 (160826..161302) [477 bp, 158 aa] {ON} YOL071W
           (REAL)
          Length = 158

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 8/68 (11%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDLR----SGRPFLEFDFPEQQDYDRMVNMMNWDL 158
           K  +E  E KR RL+   +K  I E DL     + +   + +  E ++YD ++N ++WD+
Sbjct: 53  KRTNESIEKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDI 112

Query: 159 YFY-TRSF 165
           Y++ T++F
Sbjct: 113 YYWATKNF 120

>Skud_15.81 Chr15 (155660..156139) [480 bp, 159 aa] {ON} YOL071W
           (REAL)
          Length = 159

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDLR----SGRPFLEFDFPEQQDYDRMVNMMNWDL 158
           K ++E  + KR RL+   +K  I E DL     + +   + +  E ++YD ++N ++WD+
Sbjct: 53  KRNNESLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDI 112

Query: 159 YFYT 162
           Y++ 
Sbjct: 113 YYWA 116

>NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON}
           Anc_3.144 YOL071W
          Length = 164

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 113 ESKRYRLL---KKVNIYEHDLR----SGRPFLEFDFPEQQDYDRMVNMMNWDLYFY-TRS 164
           E  R RL+   +K  I E DL     + +   + D  E ++YD ++N ++WD+Y++ T++
Sbjct: 66  ERTRSRLIYQSRKRGILETDLLLSAFAAKYLKDMDVVELKEYDELLNELDWDIYYWATKN 125

Query: 165 F 165
           F
Sbjct: 126 F 126

>TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON}
           Anc_3.144 YOL071W
          Length = 163

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 110 EYHESKRYRLL---KKVNIYEHDL---RSGRPFL-EFDFPEQQDYDRMVNMMNWDLYFYT 162
           E  + KR RL+   +K  I E DL   R    +L +    E ++YD ++N ++WD+Y++ 
Sbjct: 58  ESIDKKRARLIYQSRKRGILETDLLLSRFAAKYLKDMSLKELEEYDSLLNELDWDIYYWA 117

Query: 163 RSFF 166
              F
Sbjct: 118 TKNF 121

>TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {ON}
           Anc_8.477 YDR247W
          Length = 486

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 13/108 (12%)

Query: 228 VRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTS 287
           + SI DK   + I+G +    L   +++       +  +E   +G   N   E  E+V  
Sbjct: 28  INSINDKKYAIKIIGKQDNLNLKTLLFEYFTIFQNKLTLESLDLGEIKNLKNE--EFVKQ 85

Query: 288 SIPVVKRIDDTMKMHYHTDYF---------HVFHEAQDFFPYDPYNDI 326
             P +K I + +K+H H++           H      D++P D YN I
Sbjct: 86  --PYLKEISNQLKVHSHSNIVTIHTVFDSPHALFIVMDYYPNDLYNAI 131

>Ecym_5276 Chr5 (563865..564362) [498 bp, 165 aa] {ON} similar to
           Ashbya gossypii AER200C
          Length = 165

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDLR----SGRPFLEFDFPEQQDYDRMVNMMNWDL 158
           K   E  E KR RL+   +K  I E D+     + +        E  +YD+++N ++WD+
Sbjct: 60  KRVGEDIEKKRARLIYQSRKRGILEADILLSGFAAKHLKVMSIEEINEYDQLLNELDWDI 119

Query: 159 YFYTRSFFSM 168
           Y++    +++
Sbjct: 120 YYWATKNYTV 129

>YOL071W Chr15 (196507..196995) [489 bp, 162 aa] {ON}  EMI5Subunit
           of succinate dehydrogenase, which couples succinate
           oxidation to ubiquinone reduction; required for FAD
           cofactor attachment to Sdh1p; mutations in human
           ortholog PGL2 are associated with neuroendocrine tumors
           (paraganglioma)
          Length = 162

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDLR----SGRPFLEFDFPEQQDYDRMVNMMNWDL 158
           K  +E  + KR RL+   +K  I E DL     + +   + +  E ++YD ++N ++WD+
Sbjct: 56  KRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDI 115

Query: 159 YFYTRSFF 166
           Y++    F
Sbjct: 116 YYWATKNF 123

>KNAG0E01080 Chr5 (209650..210444) [795 bp, 264 aa] {ON} Anc_4.13
           YLL041C
          Length = 264

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 216 LRYTLYPEQNRRV-RSIQDKP----LRVFILGARAEAQLPGHVWKQLQYLFPESLIELH 269
           L+ T YPE  + V +SI+D+     L   IL A      P + W Q +YL P  L++ +
Sbjct: 149 LQRTSYPEDGKEVLQSIEDRKKLDGLYECILCACCSTSCPSYWWNQEEYLGPAVLMQAY 207

>KNAG0D03410 Chr4 complement(609661..610671) [1011 bp, 336 aa] {ON}
           Anc_5.480 YDR392W
          Length = 336

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 52/130 (40%), Gaps = 7/130 (5%)

Query: 256 QLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQ 315
           +LQ++F E  +E +     SN D ++RE   +++  +K  DD  +     +Y H     Q
Sbjct: 147 ELQFMFNEQPLENN--DDNSNLDEDEREANIATLKRLKIADDRTRNMTKEEYVHWSDCRQ 204

Query: 316 DFFPYDP---YNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDL 372
             F +     + D     H   G P   D  ++       +  CA+  T    K     L
Sbjct: 205 ASFTFRKGRRFKDWSGISHLTEGKPH--DDVIDILGFLTFEIVCALTETALKIKKREQSL 262

Query: 373 QAVKEKYGDE 382
           QA   K GD+
Sbjct: 263 QAKNTKSGDQ 272

>Suva_15.94 Chr15 (169308..169787) [480 bp, 159 aa] {ON} YOL071W
           (REAL)
          Length = 159

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 7/64 (10%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDLR----SGRPFLEFDFPEQQDYDRMVNMMNWDL 158
           K  +E  + KR RL+   +K  I E DL     + +   + +  E ++YD ++N ++WD+
Sbjct: 53  KRINESLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNQEELEEYDSLLNELDWDI 112

Query: 159 YFYT 162
           Y++ 
Sbjct: 113 YYWA 116

>AER200C Chr5 complement(1012538..1013020) [483 bp, 160 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL071W
           (EMI5)
          Length = 160

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 106 KNDSEYHESKRYRLL---KKVNIYEHDLR----SGRPFLEFDFPEQQDYDRMVNMMNWDL 158
           K ++E  E +R RL+   +K  I E DL     + +        E  +YD ++N ++WD+
Sbjct: 55  KRNNETLEQQRARLVYQSRKRGILETDLLLSGFAAKYLKHMTAEELNEYDELLNELDWDI 114

Query: 159 YFYT 162
           Y++ 
Sbjct: 115 YYWA 118

>CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P38818 Saccharomyces cerevisiae
           YHR109w CTM1 cytochrome c methyltransferase
          Length = 551

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 39/68 (57%)

Query: 360 TTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGF 419
           ++ FN K+LM+ + A++ +Y ++     D  K++ GS+  EL+ ++   +  + M +   
Sbjct: 54  SSVFNVKNLMEAMNALEGEYAEDGQRAADMFKSIIGSSIEELSAVSETCLLVYFMMVIYL 113

Query: 420 RGKRYHAI 427
            G++ +A+
Sbjct: 114 MGEQGYAV 121

>Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON}
           complement(53514..54119) [606 nt, 202 aa]
          Length = 201

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 113 ESKRYRLL---KKVNIYEHDLR-SG--RPFLEFDFPEQQD-YDRMVNMMNWDLYFYT 162
           + KR RL+   +K  I E DL  SG    +L+   PE+ D YD ++N ++WD+Y++ 
Sbjct: 102 DKKRARLIYQSRKRGILETDLLLSGFAAKYLKEMTPEELDEYDNLLNELDWDIYYWA 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,821,154
Number of extensions: 2281997
Number of successful extensions: 5405
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5543
Number of HSP's successfully gapped: 46
Length of query: 429
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 317
Effective length of database: 40,638,807
Effective search space: 12882501819
Effective search space used: 12882501819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)