Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47267.347ON19119110181e-143
ACL151C7.347ON2081919151e-127
KLLA0D12408g7.347ON1841917681e-105
SAKL0F11308g7.347ON1911957221e-97
Kwal_56.246347.347ON1901967011e-94
KLTH0H01320g7.347ON1901966923e-93
ZYRO0F11638g7.347ON1911986761e-90
YDL165W (CDC36)7.347ON1911986733e-90
TDEL0C020107.347ON1911986716e-90
Skud_4.927.347ON1911986708e-90
Kpol_530.347.347ON1911986709e-90
Smik_4.737.347ON1911986691e-89
KAFR0B008507.347ON1921996691e-89
Suva_4.817.347ON1911986639e-89
CAGL0I03388g7.347ON1911986631e-88
NCAS0A141307.347ON1911986612e-88
NDAI0A019207.347ON1932006585e-88
TPHA0F029407.347ON1911986543e-87
KNAG0C037607.347ON1911986455e-86
TBLA0E005107.347ON2871746154e-80
ZYRO0C16588g3.370ON608961152e-06
Kwal_23.39623.370ON5531741134e-06
SAKL0B08052g3.370ON576961082e-05
CAGL0D01342g3.370ON548811063e-05
KAFR0H008603.370ON578941054e-05
KLTH0F11880g3.370ON563931046e-05
Kpol_1006.73.370ON540961029e-05
YPR072W (NOT5)3.370ON560961011e-04
NDAI0A050803.370ON575941011e-04
Skud_16.3613.370ON56096993e-04
KNAG0A072903.370ON50781983e-04
TPHA0A035003.370ON54894983e-04
Suva_16.4013.370ON56596983e-04
Smik_16.3163.370ON56094974e-04
TBLA0H014903.370ON55293940.001
TDEL0C051203.370ON56294900.004
Ecym_34563.370ON50878900.004
ADL364C3.370ON50479880.006
KLLA0B09196g3.370ON59080810.047
Kpol_1070.257.214ON68683800.076
KLTH0A03652g7.214ON77241780.11
NCAS0A112103.370ON582209760.22
NDAI0A026907.214ON84681720.64
TDEL0H023307.214ON81281701.3
TDEL0C053803.401ON2371135701.4
NCAS0D034106.145ON65979682.1
TDEL0A050508.561ON27230672.7
CAGL0K00363g1.527ON1227149672.8
TPHA0C012907.214ON78682673.1
ZYRO0D16302g7.214ON82981673.3
NCAS0A133507.214ON80081664.5
YOR373W (NUD1)7.7ON85160655.0
KNAG0D050507.25ON16867636.9
KLLA0E04335g7.214ON75879646.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4726
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   396   e-143
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   357   e-127
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   300   e-105
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   282   1e-97
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   274   1e-94
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   271   3e-93
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   265   1e-90
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   263   3e-90
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   263   6e-90
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   262   8e-90
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   262   9e-90
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   262   1e-89
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   262   1e-89
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   259   9e-89
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   259   1e-88
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   259   2e-88
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   258   5e-88
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   256   3e-87
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   253   5e-86
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   241   4e-80
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    49   2e-06
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    48   4e-06
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    46   2e-05
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    45   3e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    45   4e-05
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    45   6e-05
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    44   9e-05
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    44   1e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    44   1e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    43   3e-04
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    42   3e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    42   3e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    42   3e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    42   4e-04
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    41   0.001
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    39   0.004
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    39   0.004
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    39   0.006
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    36   0.047
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    35   0.076
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    35   0.11 
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    34   0.22 
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    32   0.64 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    32   1.3  
TDEL0C05380 Chr3 (960131..967246) [7116 bp, 2371 aa] {ON} Anc_3....    32   1.4  
NCAS0D03410 Chr4 complement(637426..639405) [1980 bp, 659 aa] {O...    31   2.1  
TDEL0A05050 Chr1 (892740..893558) [819 bp, 272 aa] {ON} Anc_8.56...    30   2.7  
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...    30   2.8  
TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {O...    30   3.1  
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    30   3.3  
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    30   4.5  
YOR373W Chr15 (1036834..1039389) [2556 bp, 851 aa] {ON}  NUD1Com...    30   5.0  
KNAG0D05050 Chr4 (923903..924409) [507 bp, 168 aa] {ON} Anc_7.25...    29   6.9  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    29   6.9  

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  396 bits (1018), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MSKYGLKSLLPVIKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS 60
           MSKYGLKSLLPVIKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS
Sbjct: 1   MSKYGLKSLLPVIKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS 60

Query: 61  PWVETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHP 120
           PWVETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHP
Sbjct: 61  PWVETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHP 120

Query: 121 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 180
           GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFILNYNAIM 191
           RDFILNYNAIM
Sbjct: 181 RDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  357 bits (915), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 168/191 (87%), Positives = 179/191 (93%)

Query: 1   MSKYGLKSLLPVIKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS 60
           M KYGLK LLPVIKH+KQYD+ MTLG D+ S+LHSLQ++++D YN+ L+NGHH LDTFPS
Sbjct: 18  MDKYGLKGLLPVIKHEKQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHALDTFPS 77

Query: 61  PWVETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHP 120
           PWVETSRSEVEPKFFIPESF NI GVLGQ ST FTSVARDHPRISLLQDETLFYLFYKHP
Sbjct: 78  PWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHP 137

Query: 121 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 180
           GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ
Sbjct: 138 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 197

Query: 181 RDFILNYNAIM 191
           RDFILNY+AIM
Sbjct: 198 RDFILNYSAIM 208

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  300 bits (768), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/191 (74%), Positives = 162/191 (84%), Gaps = 7/191 (3%)

Query: 1   MSKYGLKSLLPVIKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS 60
           M KYGLK L+PV++HD  YD++MTLG DL S+L+SL +T +D+        HH LD F S
Sbjct: 1   MEKYGLKDLVPVLRHDPTYDANMTLGIDLNSLLNSLDIT-KDT------KSHHCLDAFES 53

Query: 61  PWVETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHP 120
           PWVETSRSEV+P FFIPESFKNI G+LG     FTSV RD PRISLLQDETLFYLFYKHP
Sbjct: 54  PWVETSRSEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 180
           G+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+QDS SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 RDFILNYNAIM 191
           RDF+L+YNAIM
Sbjct: 174 RDFVLHYNAIM 184

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  282 bits (722), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 138/195 (70%), Positives = 157/195 (80%), Gaps = 10/195 (5%)

Query: 1   MSKYGLKSLLPVIKHD---KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDT 57
           + KYGLK+LLP+IK +    +YD +MT+G DL S+LHSL + +   Y +        LDT
Sbjct: 3   VEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKT------RVLDT 56

Query: 58  FPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST-YFTSVARDHPRISLLQDETLFYLF 116
           FPSPWVETSRSEVEPKFF PESF NI  VL  PS   F SV +DHP+I+L QDETLFYLF
Sbjct: 57  FPSPWVETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFYLF 116

Query: 117 YKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRW 176
           YKHPGTV+QE+TYLELRKRNWRYHKTLKVWLTKDP+MEP+VSQD  SERGSYVFFDPQRW
Sbjct: 117 YKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRW 176

Query: 177 EKCQRDFILNYNAIM 191
           EKCQRDF+L YNAIM
Sbjct: 177 EKCQRDFVLFYNAIM 191

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  274 bits (701), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 153/196 (78%), Gaps = 11/196 (5%)

Query: 1   MSKYGLKSLLPVIKHDKQ---YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDT 57
           M KYGL +LLP+I+ + Q   YDSSMTLG DL  +LHSL + +  S        +  LDT
Sbjct: 1   MEKYGLSALLPLIRREDQSPEYDSSMTLGIDLSPVLHSLGIASNQS------TRYRVLDT 54

Query: 58  FPSPWVETSRSEVEPKFFIPESFKNIVGVL--GQPSTYFTSVARDHPRISLLQDETLFYL 115
           F SPWVETSRSEVEPKFF+PESFKNI  VL  G     F SV +DH +ISL QDETLFYL
Sbjct: 55  FQSPWVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYL 114

Query: 116 FYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR 175
           FYKHPG+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+    SERGSYVFFDPQR
Sbjct: 115 FYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQR 174

Query: 176 WEKCQRDFILNYNAIM 191
           WEKCQRDF+L YNAIM
Sbjct: 175 WEKCQRDFVLFYNAIM 190

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  271 bits (692), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 135/196 (68%), Positives = 153/196 (78%), Gaps = 11/196 (5%)

Query: 1   MSKYGLKSLLPVIKHDKQ---YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDT 57
           M KYGL +LLP+I+ + Q   YDSSMTLG DL  +LHSL +           + +  LDT
Sbjct: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQP------SRNRVLDT 54

Query: 58  FPSPWVETSRSEVEPKFFIPESFKNIVGVL--GQPSTYFTSVARDHPRISLLQDETLFYL 115
           F SPWVETSRSEVEPKFF+PESFKNI  VL  G+    F SV +DH +ISL QDETLFYL
Sbjct: 55  FQSPWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYL 114

Query: 116 FYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR 175
           FYKHPG+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+    SERGSYVFFDPQR
Sbjct: 115 FYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQR 174

Query: 176 WEKCQRDFILNYNAIM 191
           WEKCQRDF+L YNAIM
Sbjct: 175 WEKCQRDFVLFYNAIM 190

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  265 bits (676), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 152/198 (76%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHDK-----QYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GL++L+P++K +      +YD SMTLG DL S+LHSL +  RDS        H  L
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIP-RDS------KRHKVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP+FFIPESF NI  VL   ST   F SV +D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  263 bits (673), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIK-HDKQ----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GLK+L+P++K  DK+    YD SMTLG DL S+L+SL +  RDS +      H  L
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIP-RDSQD------HRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           +LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVFFDP
Sbjct: 114 FLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  263 bits (671), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 134/198 (67%), Positives = 152/198 (76%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHDKQ-----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GLK+L+P+IK +++     YD S+TLG DL S+LHSL +  RDS        H  L
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIP-RDS------KRHRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEPKFFIP+SF NI  VL   +T   F SV  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQR+F+L YNAIM
Sbjct: 174 QRWEKCQREFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  262 bits (670), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 134/198 (67%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIK-HDKQ----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GL++L+P++K  DK+    YD SMTLG DL S+L+SL +  RDS +      H  L
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIP-RDSQD------HRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           +LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVFFDP
Sbjct: 114 FLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  262 bits (670), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GL++LLP+IK D     K+Y+ +MT+GTDL S+LHSL +  RD      N  +  L
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIP-RD------NQRYRIL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP+FF PESFKNI  VL    T   F S+  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP++EP+VS D  SERGSY+FFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQR+F+L YNAIM
Sbjct: 174 QRWEKCQREFVLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  262 bits (669), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/198 (67%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIK-HDKQ----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GL++L+P++K  DK+    YD SMTLG DL S+L+SL +  RDS +      H  L
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIP-RDSQD------HRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           +LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVFFDP
Sbjct: 114 FLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  262 bits (669), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 150/199 (75%), Gaps = 15/199 (7%)

Query: 1   MSKYGLKSLLPVIKHD------KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHT 54
           M K+GLK+L+P+IK D       QYD SMTLG DL S+L+SL +  RD  +      H  
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIP-RDKQH------HRV 53

Query: 55  LDTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETL 112
           LDTF SPW ETSRSEVEPKF IP+SF NI  VL    T   F S+  D  R++L QDETL
Sbjct: 54  LDTFQSPWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETL 113

Query: 113 FYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFD 172
           FYLFYKHP TV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVSQD  SE+GSYVFFD
Sbjct: 114 FYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFD 173

Query: 173 PQRWEKCQRDFILNYNAIM 191
           PQRWEKCQRDF+L YNAIM
Sbjct: 174 PQRWEKCQRDFLLFYNAIM 192

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  259 bits (663), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 151/198 (76%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHDKQ-----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GL++L+P++K + +     YD SMTLG DL S+L+SL +  RDS +      H  L
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIP-RDSQD------HRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP+FF PESF NI  VL    T   F S+  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           +LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVFFDP
Sbjct: 114 FLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  259 bits (663), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 132/198 (66%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHDKQ-----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           MSK+GL+ L+P+I+ D++     YD SMT+GTDL S+LHSL +  RDS +      H  L
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIP-RDSKH------HRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEPK++IPESFKNI  VL   +T   F  V  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHK LK WLTKDP+MEP+V+ D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF L Y+AIM
Sbjct: 174 QRWEKCQRDFPLFYSAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  259 bits (661), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 132/198 (66%), Positives = 147/198 (74%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GLK+L+P+++ D     K YD SMTLG DL S++HSL +  RD      N  H  L
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIP-RD------NTRHRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP FFIP+SF  I GVL  P T   F S   D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           YLFYKHPGTVLQELTYLELR RNWRYH TL+ WLTKDPLMEP VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQ+DF+L YNAIM
Sbjct: 174 QRWEKCQKDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  258 bits (658), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 133/200 (66%), Positives = 151/200 (75%), Gaps = 16/200 (8%)

Query: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GL++L+P+IK D     K YD SMTLG DL S+LHSL +  RDS        H  L
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIP-RDS------KRHRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST----YFTSVARDHPRISLLQDET 111
           DTF SPW ETSRSEVEP FFIP+SF +I  VL   +      F SV +D  R++L QDET
Sbjct: 54  DTFQSPWAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDET 113

Query: 112 LFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFF 171
           LFYLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEP+VS D  SERGSYVFF
Sbjct: 114 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFF 173

Query: 172 DPQRWEKCQRDFILNYNAIM 191
           DPQRWEKCQR+F+L YNAIM
Sbjct: 174 DPQRWEKCQREFLLFYNAIM 193

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  256 bits (654), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 128/198 (64%), Positives = 147/198 (74%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GL++LLP+IK D     K+Y+ +MT+G DL SI HSL +          N  +  L
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNN-------NKRYRVL 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
           DTF SPW ETSRSEVEP++F P+SF NI  VL    T   F SV  D  RISL QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHK LK WLTKDP++EPIV+ D  SERGSY+FFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFVLFYNAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  253 bits (645), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 130/198 (65%), Positives = 146/198 (73%), Gaps = 14/198 (7%)

Query: 1   MSKYGLKSLLPVIKHD-----KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55
           M K+GLK+L+P+++        +YD SM LG DL S+LHSL +  RDS    +      L
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIP-RDSKRQAV------L 53

Query: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113
            TF SPW ETSRSEVEP F+IP SF  I  VL   ST   F SV RD  R++L QDETLF
Sbjct: 54  ATFQSPWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLF 113

Query: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDP 173

Query: 174 QRWEKCQRDFILNYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  241 bits (615), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 134/174 (77%), Gaps = 9/174 (5%)

Query: 20  DSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPSPWVETSRSEVEPKFFIPES 79
           D S+T+G DL S+LHSL L  RD      N  H  LDTF SPW ETSRSEV+P+FFIP S
Sbjct: 121 DHSLTIGADLSSMLHSLGLP-RD------NKRHRILDTFQSPWAETSRSEVQPRFFIPSS 173

Query: 80  FKNIVGVLGQPST--YFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNW 137
           F NI  VL   +T   F ++  D  R++L QDETLFYLFYKHPGTV+QELTYLELRKRNW
Sbjct: 174 FSNISNVLQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNW 233

Query: 138 RYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQRDFILNYNAIM 191
           R+HK LK WLTKDP+MEPIV+ D  SERGSYVFFDPQRWEKCQR+FIL YNAIM
Sbjct: 234 RFHKILKTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 53/96 (55%), Gaps = 9/96 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 153
           TS+AR   +  L   +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +
Sbjct: 510 TSLARILRKFDL---DTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--V 564

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 186
           E +    + SE  S+ +FD QR W   +C  DFI N
Sbjct: 565 EKLPPGMAQSEEESWRYFDYQRSWLARRCNSDFIQN 600

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 77/174 (44%), Gaps = 28/174 (16%)

Query: 24  TLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPSPWVETSRSEVEPKFFIPESFKNI 83
           T+  ++ S L S  L   DS ++   + HH + + P P   TS        F P     +
Sbjct: 386 TMPAEMASQLESSLLNCPDSLDADTPHLHHNVLSLPHP---TS-------IFFPNETIRL 435

Query: 84  VGVLGQPSTYF----------TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELR 133
           V      ST            TS+AR   +  L   +TLF++FY + GT  Q L   EL 
Sbjct: 436 VSNEPVDSTKSHPKQNDIYSRTSLARIMSKFDL---DTLFFIFYHYQGTHEQFLAARELT 492

Query: 134 KRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 184
            R W+++K  + W  K+  +E +      SE  S+ +FD Q+ W   +C  DF+
Sbjct: 493 MRGWQFNKVNRCWFYKE--VEKLPPGMEQSEEISWRYFDYQKSWLARRCGTDFV 544

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 9/96 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 153
           TS+A+   +  L   +TLF++FY + GT  Q L   EL + RNW+++K    W  K+   
Sbjct: 475 TSMAKITSKFDL---DTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEK 531

Query: 154 EP--IVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 184
            P  +VS ++  E  S+ +FD Q+ W   +C  DF+
Sbjct: 532 LPPGVVSSENKQEEISWRYFDYQKSWLARRCGSDFV 567

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 110 ETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSY 168
           +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  +E +    + SE  S+
Sbjct: 463 DTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSEEESW 520

Query: 169 VFFD-PQRW--EKCQRDFILN 186
            +FD  + W   +C  DF+ N
Sbjct: 521 RYFDFKKSWLSRRCGSDFVYN 541

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 9/94 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 153
           TS+A+   +  L   +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +
Sbjct: 481 TSLAKIFTKFDL---DTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--I 535

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 184
           E +    + SE  S+ +FD ++ W   +C  DF+
Sbjct: 536 EKLPPGMNKSEEESWRYFDYKKSWLARRCSPDFV 569

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLME 154
           TS+AR   +  L   +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+  +E
Sbjct: 467 TSLARIMSKFDL---DTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKE--VE 521

Query: 155 PIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 184
            +      SE  S+ +FD Q+ W   +C  +F+
Sbjct: 522 KLPPGMEQSEEISWRYFDYQKSWLARRCGAEFV 554

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 9/96 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 153
           TS+A+   +  L   +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+   
Sbjct: 443 TSLAKTFSKFDL---DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTK 499

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 186
            P   Q   +E  ++ +FD Q  W   +C  DF  N
Sbjct: 500 SPPGMQ--QAEEETWRYFDYQNSWLARRCNSDFKYN 533

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 153
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +
Sbjct: 463 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--I 517

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 186
           E +      SE  S+ +FD ++ W   +C  DF+ N
Sbjct: 518 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFVYN 553

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 7/94 (7%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 153
           TS+A+ + +  L   +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+   
Sbjct: 476 TSLAKIYTKFDL---DTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEK 532

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 184
            P  +  +  E  S+ +FD ++ W   +C  DF+
Sbjct: 533 LPPGANYNKDEEESWRYFDYKKSWLSRRCGNDFV 566

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 153
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +
Sbjct: 463 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--I 517

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 186
           E +      SE  S+ +FD ++ W   +C  DF+ N
Sbjct: 518 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFVYN 553

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 110 ETLFYLFYKHPGTVLQELTYLELR-KRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSY 168
           +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E +    + SE  S+
Sbjct: 422 DTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEEESW 479

Query: 169 VFFDPQR-W--EKCQRDFILN 186
            +FD ++ W   +C  DF+ N
Sbjct: 480 RYFDYKKSWLARRCNSDFVYN 500

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 11/94 (11%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 153
           TS+A+   +  L   +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+   
Sbjct: 451 TSLAKIFRKFDL---DTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTK 507

Query: 154 E-PIVSQDSTSERGSYVFFDPQR-W--EKCQRDF 183
             P ++Q   +E  ++ +FD Q  W   +C  DF
Sbjct: 508 SAPDMAQ---TEEETWRYFDYQNSWLARRCNHDF 538

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 153
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +
Sbjct: 468 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--I 522

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 186
           E +      SE  S+ +FD ++ W   +C  DF+ N
Sbjct: 523 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFVYN 558

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 153
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +
Sbjct: 463 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--I 517

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 184
           E +      SE  S+ +FD ++ W   +C  DF+
Sbjct: 518 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFV 551

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 9/93 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 153
           TS+AR   +  L   +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++  +
Sbjct: 454 TSLARIFTKFDL---DTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYRE--V 508

Query: 154 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDF 183
           E +      SE  S+ +FD Q+ W   +C  +F
Sbjct: 509 EKLPPGLPQSEEISWRYFDYQKSWLSRRCNSNF 541

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)

Query: 95  TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 153
           TS+AR   +  L   +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +
Sbjct: 464 TSLARIFTKFDL---DTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--V 518

Query: 154 EPIVSQDSTSERGSYVFFDPQ-RW--EKCQRDFI 184
           E +      +E  S+ +FD Q  W   +C  D +
Sbjct: 519 EKLPPGMLQAEEESWRYFDYQGSWLARRCNNDVV 552

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 110 ETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYV 169
           +TLF++FY + GT  Q L   EL  R W +++  + W  ++  +E +       E  S+ 
Sbjct: 424 DTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYRE--VEKLPPGMEQKEEVSWR 481

Query: 170 FFDPQR-W--EKCQRDFI 184
           +FD Q+ W   +C  DF+
Sbjct: 482 YFDYQKSWLARRCGPDFV 499

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 5/79 (6%)

Query: 110 ETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYV 169
           +TLF++FY + GT  Q L   EL  R W +++  + W  K+  +E +       E  S+ 
Sbjct: 420 DTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMDQKEEVSWR 477

Query: 170 FFDPQR-W--EKCQRDFIL 185
           +FD Q+ W   +C  DF+ 
Sbjct: 478 YFDYQKSWLARRCGPDFVF 496

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 96  SVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEP 155
           SVA+   + +L   +TLF++FY + G+  Q L   EL  R W ++K  + W  K+  +E 
Sbjct: 494 SVAKIMSKFAL---DTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEK 548

Query: 156 IVSQDSTSERGSYVFFDPQR 175
           +       E  ++ +FD Q+
Sbjct: 549 LPPGIEGKEEVTWRYFDYQK 568

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 35.4 bits (80), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 111 TLFYLFYKHPGTVLQ-ELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYV 169
           TLFY +Y  P T LQ +++ + L +R+W+  K   +W  K    EP  S +S  E G+Y 
Sbjct: 564 TLFYHYY-FPLTPLQKQISSILLIERDWKLLKNGTMWFLKQ--GEPKFSNESF-EVGNYK 619

Query: 170 FFDPQRWEKCQR-DFILNYNAIM 191
            F    W   ++ +F L++N++M
Sbjct: 620 IFKADDWTVIEKFNFKLDFNSLM 642

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 112 LFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPL 152
           LFY FY     + QE+ Y  L +RNW+  KT + W ++  L
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL 707

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 96/209 (45%), Gaps = 35/209 (16%)

Query: 3   KYGLKSLLPVIKHDKQYDSSMT--LGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS 60
           KY L S  P+++  K+    M   L + L +   SL   +   Y   L+N H T   FPS
Sbjct: 373 KYWLASKKPLMQPYKEMPPKMVSQLESSLLNCPDSLDADSPYLYQVPLSNPHPTSIFFPS 432

Query: 61  -------PW--VETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDET 111
                  P+  +++++  + P      S +++  +  +     TS+A+   +  L   +T
Sbjct: 433 EPIRFTYPYEVIKSNQGNLNPNDKTHASHQSVEDIYSR-----TSLAKIFSKFDL---DT 484

Query: 112 LFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKD-PLMEPIVS----------Q 159
           LF++FY + GT  Q L   EL + R+W ++K    W  ++   + P ++          +
Sbjct: 485 LFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCWYFREIEKLPPTINMSNTIPNNKRE 544

Query: 160 DSTS-ERGSYVFFDPQR-W--EKCQRDFI 184
           DS S E  S+ +FD ++ W   +C  DF+
Sbjct: 545 DSNSDEEESWRYFDYKKSWLARRCGPDFV 573

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 170
           TLFY +Y     + +E+  + L +RNW+      +W  +     PI  Q+   E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKI 775

Query: 171 FDPQRWEKCQR-DFILNYNAI 190
           F    W    + +F L+Y+++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 170
           TLFY +Y     + Q +  L L +RNW+  K+  +W  +    EP  + +   E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLRQ--GEPKFANE-VCEVADYKI 748

Query: 171 FDPQRWEKCQR-DFILNYNAI 190
           F    W    + +F L+Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>TDEL0C05380 Chr3 (960131..967246) [7116 bp, 2371 aa] {ON} Anc_3.401
            YBR136W
          Length = 2371

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 54/135 (40%), Gaps = 16/135 (11%)

Query: 33   LHSLQLTTRDSYNSGLNNGHHTLDTFPSPWVETSRSEVEPKFFIPESFKNI--------- 83
            LH + L +  +  S   N   TLD      +    ++ EP  +I    K+          
Sbjct: 1630 LHDISLLSASNDGSQFQNSTETLDF----RMRRVGADFEPNHYILSMRKSYDRLKEEPYS 1685

Query: 84   VGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTL 143
            VG LG      + + RD  R+ L  +  +  L Y HP T L+    L  +  N R  K +
Sbjct: 1686 VGDLGTTFFNLSRLCRDSSRLDLASESLMHCLQYNHPQTELEFAEILLKQGENDRAVKLV 1745

Query: 144  KVWLTK---DPLMEP 155
            +    K   DP+++P
Sbjct: 1746 REINEKYKDDPMLKP 1760

>NCAS0D03410 Chr4 complement(637426..639405) [1980 bp, 659 aa] {ON}
           Anc_6.145 YGL110C
          Length = 659

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 11/79 (13%)

Query: 2   SKYGLKSLLPVIKHDKQYDSSMTLGTDL----PSILHSLQLTTRDSYNSGLNNGHHTLDT 57
           S+Y L  LL      K+YDS++ L T+     PS++  +    + S+++  N G   L +
Sbjct: 337 SRYQLTELL------KRYDSNVELITNTLFENPSVIDDIPKEPKTSHDANDNLGKQILKS 390

Query: 58  FPSPWVETSRSEVEPKFFI 76
            PSP V+++   +EP+  +
Sbjct: 391 KPSP-VKSNIKNIEPELVL 408

>TDEL0A05050 Chr1 (892740..893558) [819 bp, 272 aa] {ON} Anc_8.561
          YBR185C
          Length = 272

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 70 VEPKFFIPESFKNIVGVLGQPSTYFTSVAR 99
          V  + +IP S+KN+  V   P T+F S+ R
Sbjct: 52 VAAQIYIPTSYKNLPNVFAHPITFFNSLIR 81

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 21/149 (14%)

Query: 13   IKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHT------LDTFPSPWVETS 66
            I+++  Y  + T+G +   +L+ L+     S+   LNNG  +      L    S  +  +
Sbjct: 1084 IRNNLLYGLTETVGDE--HLLNVLEYVGLKSFIISLNNGLDSKLDDSLLSGGQSQRLCMA 1141

Query: 67   RSEV-EPKFFIPE---------SFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLF 116
            R  +  PK  I +         S K I  ++G  S    ++   H + ++   + +F+L 
Sbjct: 1142 REMLRNPKVLILDECTSALDVTSAKKINDIIGSRSLAPVTIIVSHQKETIKLCDKIFFLV 1201

Query: 117  YKHPGTVLQELTYLELRKRNWRYHKTLKV 145
                GTV    TY EL + NW + K L +
Sbjct: 1202 ---DGTVAMMGTYEELMENNWEFRKLLNL 1227

>TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {ON}
           Anc_7.214 YIL038C
          Length = 786

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 170
           TLFY FY    ++ +++    L +RNW       +W  +      I   +  SE   Y  
Sbjct: 668 TLFYNFYFSVTSMERDIAAKILVERNWIQLSNGVMWFLR---QGNIKFANENSEVADYKI 724

Query: 171 FDPQRWEKCQR-DFILNYNAIM 191
           F    W   ++ +F L+Y++IM
Sbjct: 725 FKADDWTVVEKLNFKLDYDSIM 746

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 170
           TLFY +Y     + QE+  + L +R+W+  K   +W  +          +   E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLR---QSETKFANELCEVADYKI 768

Query: 171 FDPQRWEKCQR-DFILNYNAI 190
           F    W    R +F L+Y A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON}
           Anc_7.214 YIL038C
          Length = 800

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 170
           TLFY +Y     + +E++ + L +R+WR  K   +W  +      +  Q+   E G Y  
Sbjct: 671 TLFYNYYFAVTPLEKEISNVILNERSWRISKDETLWFLR---QGSVKLQNEFCEIGDYKI 727

Query: 171 FDPQRWEKCQR-DFILNYNAI 190
           F    W    + +F L+Y+ +
Sbjct: 728 FKLDDWTVIDKINFKLDYSNL 748

>YOR373W Chr15 (1036834..1039389) [2556 bp, 851 aa] {ON}
           NUD1Component of the spindle pole body outer plaque;
           acts through the mitotic exit network to specify
           asymmetric spindle pole body inheritance
          Length = 851

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query: 39  TTRDSYNSGLNNGHHTLDTFPSPWVE--TSRSEVEPKFFIPESFKNIVGVL-----GQPS 91
           T+R   NS L   H  L TFP+  VE  TS SEV   F   E+ K ++ +L     G PS
Sbjct: 414 TSRSISNSNLLEAHKKLKTFPAERVEDITSISEVNTSF--NETEKQLISILTSKLSGSPS 471

>KNAG0D05050 Chr4 (923903..924409) [507 bp, 168 aa] {ON} Anc_7.25
           YAL044C
          Length = 168

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 6/67 (8%)

Query: 72  PKFFIPESFKNIVGVLGQPSTYFTS------VARDHPRISLLQDETLFYLFYKHPGTVLQ 125
           P+ F+     N +  L  P  Y  S        +DH  +SL +D T F    K+    L 
Sbjct: 16  PRLFLRAQSTNSLNKLELPFKYSNSGPSQVKYTKDHEWVSLHEDGTAFLGITKYAADALG 75

Query: 126 ELTYLEL 132
           + TY+EL
Sbjct: 76  DATYVEL 82

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 111 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 170
           TLFY +Y     + Q +  L L++R WR  KT   W  +   ++   S D   E   Y  
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFLRQGAVK--FSNDQC-EVADYKI 697

Query: 171 FDPQRWEKCQR-DFILNYN 188
           F    W    + +F L+Y+
Sbjct: 698 FKMDIWTVVDKLNFKLDYS 716

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,375,595
Number of extensions: 963850
Number of successful extensions: 2439
Number of sequences better than 10.0: 64
Number of HSP's gapped: 2413
Number of HSP's successfully gapped: 65
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)