Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47257.348ON23423410871e-152
ACL150W7.348ON2191856482e-85
Kpol_530.337.348ON1951956436e-85
KLTH0H01298g7.348ON2141946386e-84
SAKL0F11330g7.348ON2081946351e-83
Kwal_56.246357.348ON2261916321e-82
NCAS0A141407.348ON2242176301e-82
KLLA0D12386g7.348ON2111836221e-81
NDAI0A019107.348ON2141836179e-81
Smik_4.727.348ON1971846141e-80
TPHA0F029507.348ON2161836135e-80
TDEL0C020007.348ON2131836101e-79
ZYRO0F11660g7.348ON1981856045e-79
KAFR0B008607.348ON2281966076e-79
YDL166C (FAP7)7.348ON1971846021e-78
Suva_4.807.348ON2061846003e-78
Skud_4.917.348ON1941945821e-75
CAGL0I03366g7.348ON2121845789e-75
KNAG0C037707.348ON2231965736e-74
TBLA0E005207.348ON2091835649e-73
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4725
         (234 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   423   e-152
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   254   2e-85
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   252   6e-85
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   250   6e-84
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   249   1e-83
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   248   1e-82
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   247   1e-82
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   244   1e-81
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   242   9e-81
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   241   1e-80
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   240   5e-80
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   239   1e-79
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   237   5e-79
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   238   6e-79
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   236   1e-78
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   235   3e-78
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   228   1e-75
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   227   9e-75
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   225   6e-74
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   221   9e-73

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  423 bits (1087), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 209/234 (89%), Positives = 209/234 (89%)

Query: 1   MESSNMVATFFGNEMDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEH 60
           MESSNMVATFFGNEMDSTRLRPNIIV            ELLQRRLDDCRYYNISDFAKEH
Sbjct: 1   MESSNMVATFFGNEMDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEH 60

Query: 61  DCYEGYDEGRKSHIVXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNST 120
           DCYEGYDEGRKSHIV             RKGGAIIDWHVNDVFPERLIDLVVVLRCDNST
Sbjct: 61  DCYEGYDEGRKSHIVDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNST 120

Query: 121 LYDRLHKRGYHDAKIEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVA 180
           LYDRLHKRGYHDAKIEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVA
Sbjct: 121 LYDRLHKRGYHDAKIEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVA 180

Query: 181 WESSWVSQHPTGVTNELQQDYQSNDESDLDQYDLAKDEGDPNEDKESSNSDTDA 234
           WESSWVSQHPTGVTNELQQDYQSNDESDLDQYDLAKDEGDPNEDKESSNSDTDA
Sbjct: 181 WESSWVSQHPTGVTNELQQDYQSNDESDLDQYDLAKDEGDPNEDKESSNSDTDA 234

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  254 bits (648), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 142/185 (76%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M  TR RPNI+V            ELLQR L D +Y+NISDFA+EH+CY+GYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+GGAI+DWHVND+FPERLIDLVVVLRCDN+ L+DRL KRGYH +K
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEENIDAEIMGVVLQDA+DSYV +IVVELQS+   QM++NV RI AWE++WVS+HP GV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 195 NELQQ 199
           N LQQ
Sbjct: 181 NALQQ 185

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  252 bits (643), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 126/195 (64%), Positives = 144/195 (73%), Gaps = 1/195 (0%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M S RL+PN+++            ELLQRRL D +YYNISDFAKEHDCYEGYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+GG+I+DWHVNDVFPERLIDLVVVLRCDNS LYDRLH R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           I+EN+DAEIMGVVLQDA +SY  +IVVELQS+T  QME NV RIV W   W+ QH  GVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 195 NELQQDYQSND-ESD 208
           NEL++   S+D ESD
Sbjct: 181 NELEEGVSSDDNESD 195

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  250 bits (638), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 122/194 (62%), Positives = 145/194 (74%), Gaps = 2/194 (1%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M STR  PNI+V            ELLQRRL D  YYNISDFA++H+CY+GYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             RKGGAI+DWHVND+FPERLIDLVVVLR DN+ LYDRL  RGYH+AK
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           I+ENIDAEIMGVV+QDA DSY  +IVVELQS+TA+QM+ENV RI +W ++W+ Q+P GVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 195 NELQQDYQSNDESD 208
           NEL +  + +DE D
Sbjct: 181 NELVE--RGSDEED 192

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  249 bits (635), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 142/194 (73%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M++ R RPNI+V            ELL RRL D  YYNISDFA+EH CY+GYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             RKG +I+DWHVNDVFPERLIDLVVVLRCDNS LYDRLHKRGYHD+K
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEEN+DAEIMGVV+QDA +SY  +IVVELQS+T   M+ NV RIV W+  W++QHP GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 195 NELQQDYQSNDESD 208
           NEL+ +  +  +SD
Sbjct: 181 NELEPESDNASDSD 194

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  248 bits (632), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 122/191 (63%), Positives = 137/191 (71%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M STR  PNI+V            ELLQRRL+  +YYNISDFAKE+ CY+GYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R GGAI+DWHVNDVFPERLIDLVVVLR DNS L+DRL KRGYH+AK
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           I+ENIDAEIMGVV+ DA DSY  +IVVELQS+T  QM+ENV RIV W  +W  QHP GVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 195 NELQQDYQSND 205
           NEL     S+D
Sbjct: 181 NELNGADHSDD 191

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  247 bits (630), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 125/217 (57%), Positives = 150/217 (69%), Gaps = 7/217 (3%)

Query: 17  STRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIVX 76
           S R +PN+++            ELLQRRL + +YYNISDFAKEHDCY+GYD+GRKSHIV 
Sbjct: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVD 63

Query: 77  XXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKIE 136
                       R+G +IIDWHVNDVFPERLIDLV VLRCDNS LYDRLH R YHD KIE
Sbjct: 64  EDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123

Query: 137 ENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTNE 196
           EN+DAEIMGVVLQDA++SY  +IVVELQS+T  QM+ NV RIV W+  W+ QH  GVTNE
Sbjct: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183

Query: 197 LQQDYQSNDESDLDQYDLAKDEGDPNEDKESSNSDTD 233
           L+   +++DES         +  D  +D E +NS  D
Sbjct: 184 LEDKQRNSDES-------GSESNDNEDDPEDANSPDD 213

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  244 bits (622), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 136/183 (74%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M+  R +PNIIV            ELL RRL +  YYNISDFAKEHDCY+GYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             RKGG IIDWHVNDVFPERL+DLVVVLRCDN  LYDRL+KRGYH+AK
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEEN+DAEIMGVVLQDA DSY  +IVVELQS+T  +M++NV RI+AW+  W+ QH  GVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 195 NEL 197
           NEL
Sbjct: 181 NEL 183

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  242 bits (617), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 117/183 (63%), Positives = 136/183 (74%)

Query: 16  DSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIV 75
           +S R  PN+++            ELLQRRL +  YYNISDFAKE+DCYEGYD+GRKSHIV
Sbjct: 5   NSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIV 64

Query: 76  XXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKI 135
                        RKG +I+DWHVND+FPERLIDLVVVLRCDNS LYDRL+KRGYHD+KI
Sbjct: 65  DEDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKI 124

Query: 136 EENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTN 195
           +EN+DAEIMGVVLQDA++SY  +IVVELQS+   QME NV RIV W   W+ QH  GVTN
Sbjct: 125 QENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTN 184

Query: 196 ELQ 198
           ELQ
Sbjct: 185 ELQ 187

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  241 bits (614), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 117/184 (63%), Positives = 134/184 (72%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M+S R  PNIIV            ELL+ +L D +YYNISDFAK+HDC+EGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+G +I+DWHVND+FPERLIDLVVVLRCDNS LY RLH RGYHD+K
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEEN+DAEIMGVV QDA++SY   IVVELQS+T   ME NV RI+ WE  W+ QHP GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 195 NELQ 198
           NE Q
Sbjct: 181 NEYQ 184

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  240 bits (613), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 134/183 (73%)

Query: 17  STRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIVX 76
           S R +PN+++            ELLQRRL D  YYNISDFAKEH+CY+G+DEGRKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 77  XXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKIE 136
                       RKG  I+DWHVNDVFPERLIDLVVVLRCDNS LYDRL  RGYHD+KI+
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 137 ENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTNE 196
           EN+DAEIMGVVLQDA +SY  +IVVELQS+T  QM+ENV +IV W   W+ QH  GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 197 LQQ 199
           L +
Sbjct: 182 LSK 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  239 bits (610), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 115/183 (62%), Positives = 134/183 (73%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M+  R +PN+++            ELLQRRL D +YYNISDFAKEHDC++GYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+G AI+DWHVNDVFPERLIDLVVVLRCDN+ LYDRL  R YHDAK
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           I+EN+DAEIMGVVLQDA DSY  +IVVELQS++  QME NV RIV+WE  W+ QH  G T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 195 NEL 197
           NEL
Sbjct: 181 NEL 183

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  237 bits (604), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 135/185 (72%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M+S R  PN+++            ELLQRRL D +YYNISDFA+E+DC++GYDEGRKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             RKGG IIDWHVNDVFPERLIDLVVVLRC+NS L+ RL KRGYH  K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           I+ENIDAEIMGVV+QDA+DSY  +IVVEL S++  QME NV RIV+W   W  QH +GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 195 NELQQ 199
           NEL +
Sbjct: 181 NELHE 185

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  238 bits (607), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 115/196 (58%), Positives = 141/196 (71%)

Query: 16  DSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIV 75
           +S R  PN++V            ELL RRL D  Y+NIS+FA++H CY+GYDE RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 76  XXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKI 135
                        R+G +IIDWHVNDVFPERLIDLVVVLRCDNS L+DRLH RGYH++KI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 136 EENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTN 195
           +EN+DAEIMGVVLQDA+DSY  +IVVELQSN+  +M+ NV RIVAW+  W++QH  GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 196 ELQQDYQSNDESDLDQ 211
           E Q +   +  SD +Q
Sbjct: 187 EYQGELPKDSNSDEEQ 202

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  236 bits (602), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 133/184 (72%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M++ R  PNIIV            E L+ +L D +YYNISDFAK++DC+EGYDEGRKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+G +I+DWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHD+K
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEEN+DAEIMGVV QDA++SY   IVVELQS+T   M  NV RIVAWE  W+ QHP GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 195 NELQ 198
           NE Q
Sbjct: 181 NEYQ 184

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  235 bits (600), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 117/184 (63%), Positives = 132/184 (71%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M+S R  PNIIV            ELL+  L   +YYNISDFAK++DC+EGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+G +IIDWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHD+K
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEEN+DAEIMGVV QDA+DSY   IVVELQS+T   +  NV RI+AWE  W+ QHP GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 195 NELQ 198
           NE Q
Sbjct: 181 NEYQ 184

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  228 bits (582), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 116/194 (59%), Positives = 133/194 (68%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M+  R  PNIIV            ELL+  L   +YYNISDFAK++DC+E YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+G +IIDWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHD+K
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEEN+DAEIMGVV QDA+DSY   IVVELQ +T   M  NV RIVAWE  W+ QH  GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 195 NELQQDYQSNDESD 208
           NE Q  +  ++ES+
Sbjct: 181 NEYQGPHGDDEESE 194

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  227 bits (578), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 114/184 (61%), Positives = 130/184 (70%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M S R  PNIIV            ELLQRRLD  +YYNIS+FA+EH CY+GYDEGRKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V              +G +IIDWHVNDVFPERLIDLVVVLR +N  LYDRL  RGYHD+K
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           IEEN+DAEIMGVVLQDA +SY  +IVVELQSNT   ME NV RI  W  +WV +H  GV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 195 NELQ 198
           +EL+
Sbjct: 181 SELK 184

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  225 bits (573), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 115/196 (58%), Positives = 132/196 (67%), Gaps = 3/196 (1%)

Query: 16  DSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIV 75
           +S RL PNI+V            ELL R L D  YYNISDFA ++ CY+GYDE RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 76  XXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKI 135
                          GG IIDWHVNDVFPERLIDLV VLRCD+S L+DRL+KR YH +KI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 136 EENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTN 195
           +EN+DAEIMGVVLQDA+DSY   IVVELQS+   QM  NV R+V W + W  QHP GVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 196 EL---QQDYQSNDESD 208
           EL   Q   + NDES+
Sbjct: 183 ELSAHQAKKERNDESE 198

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  221 bits (564), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 128/183 (69%)

Query: 15  MDSTRLRPNIIVXXXXXXXXXXXXELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74
           M S R  PN+++            ELL+R L+D +Y NISDFAKE +CY+G+D+GRKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 75  VXXXXXXXXXXXXXRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134
           V             R+G  I+DWHVNDVFPERLIDLVV+LR DNS LYDRL  R YHDAK
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194
           ++EN+DAEIMGVVLQDA+DSY  +IV+ELQSN   +M  NV RIV+W   W  QH  GVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 195 NEL 197
           NEL
Sbjct: 181 NEL 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,631,456
Number of extensions: 1006439
Number of successful extensions: 5591
Number of sequences better than 10.0: 100
Number of HSP's gapped: 5636
Number of HSP's successfully gapped: 101
Length of query: 234
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 128
Effective length of database: 41,326,803
Effective search space: 5289830784
Effective search space used: 5289830784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)