Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47237.350ON38138120100.0
KLTH0H01254g7.350ON38137916810.0
ACL148C7.350ON38138116750.0
KLLA0D12342g7.350ON38438016650.0
Kwal_56.246427.350ON38137916610.0
SAKL0F11374g7.350ON38338116510.0
NCAS0A141607.350ON45138116530.0
Kpol_530.317.350ON38037816380.0
TBLA0E00390singletonON38338116310.0
CAGL0L01111g7.350ON38137916270.0
Skud_4.897.350ON38538116150.0
Suva_4.787.350ON38537816090.0
Smik_4.707.350ON38637815950.0
KAFR0B008807.350ON38138115930.0
YDL168W (SFA1)7.350ON38637715850.0
TPHA0F029707.350ON38137515740.0
TDEL0C019807.350ON38537815740.0
ZYRO0F11704g7.350ON38237815600.0
KNAG0C037907.350ON38238214430.0
NDAI0A018907.350ON42238114080.0
SAKL0A00880gsingletonON38838111531e-157
KLLA0D19929gsingletonON3863762945e-29
KLLA0B00451gsingletonON3863872911e-28
TBLA0I011402.480ON3772602654e-25
CAGL0J01441g2.480ON3723412621e-24
KLTH0D05588g2.480ON3892602443e-22
NCAS0I023503.118ON3512982407e-22
Suva_4.3943.118ON3512952391e-21
Ecym_53313.118ON3482982382e-21
TPHA0G032102.480ON3773192373e-21
SAKL0B00814g8.16ON3543582346e-21
NDAI0A069303.118ON3512932311e-20
YBR145W (ADH5)3.118ON3512952302e-20
NCAS0I01720singletonON3513542292e-20
KLLA0F21010g3.118ON3502602274e-20
KNAG0K020003.118ON3503572274e-20
TBLA0E034403.118ON3512602265e-20
Smik_2.2843.118ON3512952265e-20
Kpol_1058.118.16ON3532662266e-20
KLTH0D00616g7.3ON3823412276e-20
KLLA0F00506g7.3ON3852282268e-20
Skud_2.2723.118ON3512952258e-20
KAFR0A007902.480ON3772602251e-19
SAKL0C10164g3.118ON3512812231e-19
YMR083W (ADH3)2.480ON3752602241e-19
TBLA0E03430singletonON3512802232e-19
Smik_13.520na 1ON3482982222e-19
KLTH0G18986g8.16ON3543872222e-19
ZYRO0G03388g2.480ON3702952222e-19
KLLA0F13530g2.480ON3752602223e-19
NDAI0H021602.480ON3812602223e-19
YOL086C (ADH1)3.118ON3483012213e-19
TDEL0C003908.16ON3533562213e-19
AER032W3.118ON3512932203e-19
KAFR0G014203.118ON3512602204e-19
SAKL0F06270gna 2ON3512802204e-19
Kwal_55.19574singletonON3563622187e-19
CAGL0I07843g3.118ON3522502188e-19
Skud_13.477na 1ON3483082178e-19
KLTH0G15686g3.118ON3513012179e-19
Smik_13.2662.480ON3752602181e-18
CAGL0D00198g7.3ON3833182181e-18
Suva_13.494na 1ON3482982161e-18
Skud_13.2402.480ON3752602161e-18
KLLA0F18260gsingletonON3482602152e-18
Smik_48.1singletonON3573692152e-18
YMR303C (ADH2)na 1ON3483082142e-18
SAKL0B08184gna 3ON3733452152e-18
Kwal_26.77992.480ON3872602152e-18
YAL060W (BDH1)7.3ON3822392153e-18
Kwal_26.67397.3ON3822452143e-18
YLR070C (XYL2)8.16ON3563672143e-18
Smik_15.713.118ON3482982133e-18
Suva_13.2612.480ON3752602134e-18
KLLA0B09064gna 3ON3743342125e-18
SAKL0E02838g2.480ON3772602126e-18
NCAS0A077802.480ON3732602126e-18
Skud_20.2singletonON3573702117e-18
Skud_4.2singletonON3573702117e-18
YJR159W (SOR1)na 4ON3573692117e-18
Kpol_431.82.480ON3802632118e-18
TDEL0D050503.118ON3512602108e-18
KLTH0E05588gna 2ON3482602099e-18
YDL246C (SOR2)singletonON3573692072e-17
ZYRO0F02552g8.16ON3512742072e-17
TDEL0A025602.480ON3732952082e-17
Suva_15.813.118ON3482982072e-17
ABL033C2.480ON3733062072e-17
Ecym_73912.480ON3752702073e-17
Kwal_55.20564singletonON2162262003e-17
Suva_10.1548.16ON3563812063e-17
Skud_1.37.3ON3822392054e-17
Smik_1.67.3ON3822392055e-17
KNAG0E025902.480ON3742602046e-17
TDEL0H044607.3ON3822782047e-17
KNAG0K01040singletonON3912662039e-17
NDAI0H020507.3ON3853162039e-17
Skud_15.683.118ON3482982002e-16
NCAS0J003008.16ON3572682002e-16
Suva_12.260singletonON3573702002e-16
Kwal_56.231983.118ON3512801983e-16
Kwal_26.6684singletonON3562991983e-16
KAFR0L02010singletonON3512601974e-16
Suva_1.77.3ON3822411984e-16
Kpol_1036.193.118ON3532801974e-16
TPHA0M007303.118ON3502801965e-16
TDEL0F03190na 2ON3512611965e-16
AAR084WsingletonON3852521975e-16
SAKL0D14872g7.3ON3832421967e-16
ZYRO0C12562gna 2ON3482981941e-15
TBLA0A042907.3ON3952961932e-15
KLLA0D05511g8.16ON3543531922e-15
ZYRO0B05940g3.118ON3792981932e-15
ABR229C8.16ON3533621912e-15
Kpol_1049.187.2ON3863071923e-15
KAFR0L02000singletonON3612601886e-15
SAKL0D14894g7.2ON3852401888e-15
KLTH0A00418gsingletonON3562571851e-14
NCAS0A076707.2ON4393031817e-14
KAFR0I001607.2ON3853461753e-13
ZYRO0G03410gsingletonON3733211753e-13
TPHA0H03100singletonON3923041692e-12
YAL061W (BDH2)7.2ON4172401692e-12
Suva_1.67.2ON4172281683e-12
NCAS0A076607.3ON3862431674e-12
YBR046C (ZTA1)3.253ON3342591654e-12
KNAG0I00120singletonON3812321657e-12
Skud_1.27.2ON4172401594e-11
Smik_1.57.2ON4172401594e-11
Kwal_47.17532na 5ON3733731551e-10
KAFR0I001707.3ON3812801523e-10
TDEL0D037203.253ON3353501487e-10
KNAG0D00110singletonON3623091471e-09
KAFR0C005803.253ON3343341461e-09
NDAI0H020607.2ON3993031452e-09
KLLA0F00528g7.2ON3812921442e-09
NDAI0H02950singletonON3633221443e-09
Smik_2.1703.253ON3342621433e-09
SAKL0H22088gna 5ON3763581409e-09
KNAG0E042007.2ON3853171362e-08
KLTH0B04972gna 6ON3603571353e-08
NDAI0G04880singletonON3613291336e-08
SAKL0D14938gsingletonON3783311328e-08
KLTH0C07854g3.253ON3583481329e-08
NCAS0C03020singletonON3623881311e-07
Kwal_56.229853.253ON3462491301e-07
NDAI0A063203.253ON3492581292e-07
Skud_2.1623.253ON3342581292e-07
KAFR0A08730singletonON3603091292e-07
CAGL0H06853gsingletonON3603281282e-07
KLTH0E07964gna 5ON3743211274e-07
Suva_13.513na 7ON3603641265e-07
NCAS0D01220na 8ON3623241255e-07
KLLA0F00638gna 9ON3822511248e-07
CAGL0M14047gna 7ON3593241231e-06
ZYRO0A03366g3.253ON3493391203e-06
TPHA0J00170singletonON3613371185e-06
SAKL0D03872g3.253ON3483421176e-06
Suva_4.2793.253ON3342591159e-06
Ecym_1093singletonON3832841122e-05
KLLA0A10549g3.253ON3531411096e-05
NCAS0I017303.253ON3492711071e-04
KNAG0B06990singletonON3583431033e-04
ABL090W3.253ON3343281024e-04
KNAG0K02680singletonON359284990.001
Skud_13.494na 7ON360345980.001
Smik_13.535na 7ON360355970.001
CAGL0H09944g3.253ON333353960.002
YMR318C (ADH6)na 7ON360317940.004
Kpol_526.18singletonON361311860.035
KLTH0C10538gsingletonON273150850.045
TDEL0A00140singletonON405284820.11
TDEL0F02300na 5ON379363800.18
Suva_6.13singletonON6859720.27
SAKL0H00374gsingletonON428308790.32
KLTH0B00506gna 9ON398295780.34
Skud_86.1singletonON8959691.0
ZYRO0G10318gna 5ON37698741.2
KLTH0F01056g1.29ON77155713.1
Smik_2.3singletonOFF21636684.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4723
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   778   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   652   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   649   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   645   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   644   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   640   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   641   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   635   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      632   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   631   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   626   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   624   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   619   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   618   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   615   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   610   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   610   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   605   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   560   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    546   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   448   e-157
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   117   5e-29
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   116   1e-28
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...   106   4e-25
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...   105   1e-24
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    99   3e-22
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     97   7e-22
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    97   1e-21
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    96   2e-21
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    96   3e-21
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    95   6e-21
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    94   1e-20
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    93   2e-20
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               93   2e-20
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    92   4e-20
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    92   4e-20
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    92   5e-20
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    92   5e-20
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    92   6e-20
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    92   6e-20
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    92   8e-20
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    91   8e-20
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    91   1e-19
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    91   1e-19
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    91   1e-19
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               91   2e-19
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    90   2e-19
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    90   2e-19
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    90   2e-19
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    90   3e-19
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     90   3e-19
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    90   3e-19
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    90   3e-19
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    89   3e-19
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    89   4e-19
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    89   4e-19
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    89   7e-19
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    89   8e-19
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    88   8e-19
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    88   9e-19
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    89   1e-18
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    89   1e-18
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    88   1e-18
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    88   1e-18
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    87   2e-18
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    87   2e-18
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    87   2e-18
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    87   2e-18
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    87   2e-18
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    87   3e-18
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    87   3e-18
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    87   3e-18
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    87   3e-18
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    87   4e-18
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    86   5e-18
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    86   6e-18
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    86   6e-18
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     86   7e-18
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    86   7e-18
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    86   7e-18
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    86   8e-18
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    86   8e-18
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    85   9e-18
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    84   2e-17
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    84   2e-17
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    85   2e-17
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    84   2e-17
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    84   2e-17
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    84   3e-17
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    82   3e-17
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    84   3e-17
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     84   4e-17
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     84   5e-17
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    83   6e-17
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    83   7e-17
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    83   9e-17
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    83   9e-17
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    82   2e-16
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       82   2e-16
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    82   2e-16
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    81   3e-16
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    81   3e-16
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              80   4e-16
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     81   4e-16
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    80   4e-16
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    80   5e-16
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    80   5e-16
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    80   5e-16
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    80   7e-16
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    79   1e-15
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    79   2e-15
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    79   2e-15
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    79   2e-15
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    78   2e-15
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    79   3e-15
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              77   6e-15
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    77   8e-15
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    76   1e-14
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    74   7e-14
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    72   3e-13
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    72   3e-13
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    70   2e-12
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    70   2e-12
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     69   3e-12
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    69   4e-12
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    68   4e-12
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  68   7e-12
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      66   4e-11
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     66   4e-11
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    64   1e-10
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    63   3e-10
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    62   7e-10
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   61   1e-09
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    61   1e-09
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    60   2e-09
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    60   2e-09
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    60   3e-09
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    60   3e-09
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    59   9e-09
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    57   2e-08
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    57   3e-08
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    56   6e-08
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    55   8e-08
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    55   9e-08
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    55   1e-07
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    55   1e-07
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    54   2e-07
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    54   2e-07
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    54   2e-07
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    54   2e-07
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    54   4e-07
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    53   5e-07
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               53   5e-07
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    52   8e-07
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    52   1e-06
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    51   3e-06
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                50   5e-06
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    50   6e-06
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    49   9e-06
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    48   2e-05
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    47   6e-05
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     46   1e-04
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             44   3e-04
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    44   4e-04
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    43   0.001
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    42   0.001
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    42   0.001
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    42   0.002
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    41   0.004
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    38   0.035
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    37   0.045
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 36   0.11 
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    35   0.18 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    32   0.27 
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    35   0.32 
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    35   0.34 
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    31   1.0  
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    33   1.2  
KLTH0F01056g Chr6 complement(80904..83219) [2316 bp, 771 aa] {ON...    32   3.1  
Smik_2.3 Chr2 complement(6099..6290,6294..6323,6327..6398,6402.....    31   4.0  

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/381 (100%), Positives = 381/381 (100%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT
Sbjct: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV
Sbjct: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG
Sbjct: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EINDGLTDLHHGDCLRTVLNF
Sbjct: 361 EINDGLTDLHHGDCLRTVLNF 381

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/379 (82%), Positives = 338/379 (89%)

Query: 3   ITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEG 62
           ++ GK I C AA+AY AG PL +E I VDPPKAHEVRIK+ +TA+CHTDAYTLSGVDPEG
Sbjct: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60

Query: 63  IFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQG 122
            FPSILGHEG+G+VESVG GVTNVK GDHVI LYTAEC+ECKFC SGKTNLCGSVRATQG
Sbjct: 61  AFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 123 KGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTT 182
           KG+MPDGTSRF N KGE + HFMGCSTFS+YTVVADVSVVAID KAPLDK CLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 183 GYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGAT 242
           GYGAAVKTADVQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVDIND KK+WS DFGAT
Sbjct: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240

Query: 243 DFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVA 302
           DF+NP+K L DG+TIV KL++MTDGGLD TFDCTGNT VMR ALEACHKGWGQSIIIGVA
Sbjct: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300

Query: 303 AAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEI 362
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG L+SDY  GKLKVDEF+TH R F++I
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360

Query: 363 NDGLTDLHHGDCLRTVLNF 381
           N    DLHHGDCLRTVL+ 
Sbjct: 361 NSAFEDLHHGDCLRTVLDL 379

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/381 (82%), Positives = 347/381 (91%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           MS T GK IQC AA+AY AG PL+IE +TVDPPKAHEVRIKI ++A+CHTDAYTLSG DP
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG+FP ILGHEGSGIVESVG GVTNVK GDHV+PLYTAECQ+CKFC+SGKTNLCG+VRAT
Sbjct: 61  EGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           QGKG+MPDGTSRF+N KGE +YHFMGCSTFSEYTVVADVSVVA+D++APL+ VCLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGV 180

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTGYGAAVKTADVQ+GDTVAVFGAGTVGLSVVQGA++R AS+IIVVDIND K++W+  FG
Sbjct: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINP  DL +GETIV++LI+MTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMG L+ DY  G LKV EFVTH RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EIN G  DLHHGDCLRTVL+ 
Sbjct: 361 EINSGFEDLHHGDCLRTVLSL 381

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 339/380 (89%)

Query: 2   SITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPE 61
           S TAGK I+C AA+AY AG PL +E I VD PKAHEVR+++THTA+CHTDAYTLSGVDPE
Sbjct: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62

Query: 62  GIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQ 121
           G FPSILGHEG+GIVESVG GVTNVKVGDHV+ LYTAEC +CKFC S KTNLCGSVRATQ
Sbjct: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122

Query: 122 GKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVT 181
           GKG+MPDGT+RF N KGE + HFMGCSTFS+YTVVADVS+V ID  APL  VCLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182

Query: 182 TGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGA 241
           TGYGAAVKTA+VQ+GDTVAVFGAGTVGLSVVQGA+SRGASKIIVVD+ND KK+WS DFGA
Sbjct: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242

Query: 242 TDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           T F+NP KDL +GETIVSKLIDMTDGGLD TFDCTGN KVMRDALEACHKGWGQSIIIGV
Sbjct: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE 361
           AAAG+EISTRPFQL+TGRVWKGSAFGGIKGRSEMG L++ Y  G LKVD+F+TH RPF+E
Sbjct: 303 AAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362

Query: 362 INDGLTDLHHGDCLRTVLNF 381
           IN+   DLHHGDCLRTVL+ 
Sbjct: 363 INNAFEDLHHGDCLRTVLDL 382

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/379 (81%), Positives = 340/379 (89%)

Query: 3   ITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEG 62
           ++ GK I C AA+AY AG PL IE I VDPPKAHEVR+KI +TA+CHTDAYTLSGVDPEG
Sbjct: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60

Query: 63  IFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQG 122
            FPSILGHEG+GIVES+G GVTNVK GDHVI LYTAEC+ECKFC SGKTNLCGSVRATQG
Sbjct: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 123 KGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTT 182
           KG+MPDGT+RF N KGE I HFMGCSTFS+YTV+ADVSVVAID KAPLDK CLLGCGVTT
Sbjct: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 183 GYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGAT 242
           GYGAAVKTA+VQKGDTVAVFGAGTVGLSVVQGA+ RGAS+IIVVDIND KK+W+ +FGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240

Query: 243 DFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVA 302
           DF+NP+KDL DG+TIV  L++MTDGGLD+TFDCTGNT VMR ALEACHKGWG+SIIIGVA
Sbjct: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300

Query: 303 AAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEI 362
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LISDY  GKLKVDEF+TH R F++I
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360

Query: 363 NDGLTDLHHGDCLRTVLNF 381
           N    DLHHGDCLRTVL+ 
Sbjct: 361 NSAFEDLHHGDCLRTVLDL 379

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/381 (82%), Positives = 347/381 (91%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           MS T GK I C AA+AY AG PL +E I V+PPKAHEVRI+IT+TA+CHTDAYTLSGVDP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG FPSILGHEG+G+VESVG GVTNVK GDHV+ LYTAECQ+CKFC SGKTNLCGSVRAT
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           QGKG+MPDGTSRF+   GE I HFMGCSTFS+YTVVADVSVVA+D +APLD++CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTGYGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA++RGAS+IIVVDIND KK+W+ DFG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP+KDL +GETIVSKLI++TDGGLD TFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMG L+SDY  G+LKVDEF+TH RPF+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EIN    DLHHGDCLRTVL+ 
Sbjct: 361 EINAAFDDLHHGDCLRTVLDL 381

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 344/381 (90%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           MS T GK I C AA+AY AG PL +E I VDPPKAHEVRIKI +TA+CHTDAYTLSG+DP
Sbjct: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG FPSILGHEGSGIVESVG GVTNVKVGDHVI LYTAEC +CKFC SGKTNLCGSVRAT
Sbjct: 129 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           QGKG+MPDGTSRF N KGE + HFMGCSTFS+YTVVADVSVVA+D KAPLD + LLGCGV
Sbjct: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGV 248

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTGYGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA+SRGASKIIVVDIN+DKK+WSFDFG
Sbjct: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP +DL +GETIV KLI+MTDGGL++TFDCTGN KVMRDALEACHKGWG+SIIIG
Sbjct: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIG 368

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VA AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  GKLKVDEF+TH RPF+
Sbjct: 369 VAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EIND   DLHHGDCLRTVL+ 
Sbjct: 429 EINDAFEDLHHGDCLRTVLDL 449

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/378 (80%), Positives = 337/378 (89%), Gaps = 1/378 (0%)

Query: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63
           T GK I C+AA+AY A  PL +E I VDPPKAHEVRIKI +TA+CHTDAYTLSGVDPEG+
Sbjct: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123
           FP +LGHEGSGIVESVG  VT VK GDHV+ LYTAEC +CKFC+SGKTNLCGSVRATQGK
Sbjct: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122

Query: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183
           G+MPDGT RF N KGE +YHFMGCSTFSEYTVVADVSVVAID  APLD VCLLGCGVTTG
Sbjct: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182

Query: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243
           YGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA+SRGASKIIVVDIN+DKK+WS +FGATD
Sbjct: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242

Query: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP+ +L +G+ IVSKL++MTDGGLD TFDCTGN  VMRDALEACHKGWGQSIIIGVAA
Sbjct: 243 FVNPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+T+ RPF EIN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361

Query: 364 DGLTDLHHGDCLRTVLNF 381
           D   +LHHG+CLRTVL+F
Sbjct: 362 DAFEELHHGNCLRTVLSF 379

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/381 (79%), Positives = 333/381 (87%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           MS T GK I+C AA+AY A  PL +E I V+PP+AHEVRIKITHTA+CHTDAYTLSGVDP
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDP 60

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG FP +LGHEGSGIVESVG GV++VKVGDHVI LYTAEC  CKFC SGKTNLCGSVR T
Sbjct: 61  EGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRET 120

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           QGKG+MPDGTSRFKN KGE + HFMGCSTFS+YTVVADVSVVAI++ APL  VCLLGCGV
Sbjct: 121 QGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGV 180

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTGYGAA+KTA+VQK DTVAVFGAGTVGLSVVQGAQ+RGASKII+VD+N  K+ +S  FG
Sbjct: 181 TTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFG 240

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINP  DL  GETIVSKL++MTDGGLDHTFDCTGN KVMRDALE CHKGWGQSIIIG
Sbjct: 241 ATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGG+KGRSEMG LI  Y  G LKVD+F+T+ RPF+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFT 360

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EIN    DLHHGDCLRTVL+ 
Sbjct: 361 EINAAFEDLHHGDCLRTVLDL 381

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/379 (79%), Positives = 332/379 (87%)

Query: 3   ITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEG 62
           +T GK I+C AA+AY AG P  +E I VDPPKAHEVRIKI +TA+CHTDAYTLSG DPEG
Sbjct: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60

Query: 63  IFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQG 122
           +FP +LGHEG+GIVESVG GVTNVK GDHVI LYTAECQ+CKFC+SGKTNLCG+VRATQG
Sbjct: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120

Query: 123 KGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTT 182
           KG+MPDGTSRF N KGE +YHFMGCSTFSEYTVVADVSVVAID+ APL+ VCLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180

Query: 183 GYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGAT 242
           GYGAAVKTA+VQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D ND KK +   FGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240

Query: 243 DFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVA 302
           DFINPTKDL + ETIV+KLI+MTDGGLDHTFDCTGN  VMR ALEACHKGWGQS+IIGVA
Sbjct: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300

Query: 303 AAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEI 362
           AAGQEISTRPFQLVTGRVWKGSAFGG+KGRSEM  LI  Y  G+LKVDEF+TH R F+EI
Sbjct: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360

Query: 363 NDGLTDLHHGDCLRTVLNF 381
           N+   DLH+G CLRTVL+F
Sbjct: 361 NEAFDDLHNGLCLRTVLSF 379

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/381 (79%), Positives = 332/381 (87%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           ++ T GK IQC AA+AY A   L +E ITVDPPKAHEVRIKI  TA+CHTDAYTLSG DP
Sbjct: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG+FP ILGHEG+GIVESVG  V  VK GDHVI LYTAEC +CKFC SGKTNLC +VRAT
Sbjct: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           QGKG+MPDGT+RF N+KGE IYHFMGCSTFSEYTVVADVSVVAID KAPLD  CLLGCGV
Sbjct: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTGYGAA+KTA+VQ+GDTVAVFG GTVGLSV+QGA+SRGASKII VDIN+ K+++S +FG
Sbjct: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINP +DL + +TIV KLIDMTDGGLD TFDCTGNT +MRDALEACHKGWGQSIIIG
Sbjct: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIG 301

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY +G LKV+EF+TH RPF 
Sbjct: 302 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EIN    DLH+GDCLRTVL F
Sbjct: 362 EINQAFEDLHNGDCLRTVLRF 382

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/378 (80%), Positives = 328/378 (86%)

Query: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63
           T GK IQC AAIAY A  PL +E ITVDPPKAHEVRIKI +TA+CHTDAYTLSG DPEG+
Sbjct: 5   TVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123
           FP ILGHEG+GIVESVG  VT VK GDHVI LYTAEC +CKFC SGKTNLC +VRATQG+
Sbjct: 65  FPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGR 124

Query: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183
           G+MPD T+RF N KGE IYHFMGCSTFSEYTVVADVSVVAID KAPLD   LLGCGVTTG
Sbjct: 125 GIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVTTG 184

Query: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243
           YGAAVKTA+VQKGDTVAVFG GTVGLSV+QGA++RGASKII +DIN+ KK++ FDFGATD
Sbjct: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGATD 244

Query: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FINP +DL  G+TIV KLI+ TDGGLD TFDCTGNTK+MRDALEACHKGWGQSIIIGVAA
Sbjct: 245 FINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAA 304

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKV+EF+TH RPF EIN
Sbjct: 305 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKEIN 364

Query: 364 DGLTDLHHGDCLRTVLNF 381
               DLH GDCLRTVL F
Sbjct: 365 QAFEDLHQGDCLRTVLKF 382

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/378 (79%), Positives = 329/378 (87%)

Query: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63
           T GK I+C AA+AY A  P  +E ITVD PKAHEVRIKI +TA+CHTDAYTLSG DPEG+
Sbjct: 5   TVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123
           FP ILGHEG+GIVESVG GV  VK GDHVI LYTAEC +CKFC SGKTNLC +VRATQGK
Sbjct: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGK 124

Query: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183
           G+MPDGT+RF N+KG+ IYHFMGCSTFSEYTVVADVSVVAID KAPLD  CLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTG 184

Query: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243
           YGAAVKTA+VQKGDTVAVFG GTVGLSV+QGA+ RGASKII VDIN++KKK+   FGATD
Sbjct: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATD 244

Query: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FINP +DL   +TIV KL++MTDGGLD TFDCTGNTK+MRDALEACHKGWGQSIIIGVAA
Sbjct: 245 FINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAA 304

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY +G LKV+EF+TH RPF EIN
Sbjct: 305 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEIN 364

Query: 364 DGLTDLHHGDCLRTVLNF 381
               DLH+GDCLRTVL F
Sbjct: 365 HAFEDLHNGDCLRTVLKF 382

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/381 (77%), Positives = 332/381 (87%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           MS T GK IQCKAA+AY A  PL ++ + VD PKAHEVRIKI +TA+CHTDAYTLSGVDP
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG+FP ILGHEGSGIVES+G GVT+VKVGDHVIPLYTAECQ+CKFC SGKTNLCG+VR T
Sbjct: 61  EGLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           QGKG+MPDGTSRF   +G+ I+HFMGCSTFSEYTVVADVSVVAID+K  L+   LLGCGV
Sbjct: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTG+GAAVK A+VQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVDIND+KK++S+DFG
Sbjct: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP  DL DGETIV+KLI MTDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIG
Sbjct: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VAAAGQEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEF+TH R F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EINDG  DLH G CLRTVL F
Sbjct: 361 EINDGFEDLHMGTCLRTVLKF 381

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/377 (78%), Positives = 327/377 (86%)

Query: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63
           T GK I+C AA+AY A  PL +E ITVD PKAHEVRIKI +TA+CHTDAYTLSG DPEG+
Sbjct: 5   TVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123
           FP +LGHEG+GIVESVG  V  VK GDHVI LYTAEC +CKFC SGKTNLCG+VRATQGK
Sbjct: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGK 124

Query: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183
           G+MPDGT+RF N+KGE IYHFMGCSTFSEYTVVADVSVVAID KAPLD  CLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184

Query: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243
           +GAA+KTA+VQKGDTVAVFG GTVGLSV+QGA+ RGASKII +DIN+ KK++   FGATD
Sbjct: 185 FGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGATD 244

Query: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP +DL   +TIV KLI+MTDGGLD TFDCTGNTK+MRDALEACHKGWGQSIIIGVAA
Sbjct: 245 FVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAA 304

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKV+EF+TH RPF EIN
Sbjct: 305 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEIN 364

Query: 364 DGLTDLHHGDCLRTVLN 380
               DLH+GDCLRTVL 
Sbjct: 365 QAFEDLHNGDCLRTVLK 381

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/375 (78%), Positives = 327/375 (87%), Gaps = 1/375 (0%)

Query: 6   GKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFP 65
           GK I C AAIAY A  PL +  I VDPPKAHEVRIKI  TA+CHTDAY+LSGVDPEG+FP
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 66  SILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGL 125
            +LGHEGSGIVES+G  VTNVKVGDHVI LYTAEC +CKFC+SGKTNLCGSVRATQGKG+
Sbjct: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 126 MPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYG 185
           MPDGT+RF +  G+ IYHFMGCSTFS+YTVVADVS+VA D+    +   LLGCGVTTGYG
Sbjct: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184

Query: 186 AAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFI 245
           AA+KTA++QKGDTVAVFGAGTVGLSVVQGA+SRGASKIIVVD+N+DKK WSF+FGATDF+
Sbjct: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244

Query: 246 NPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305
           NP K+L D E IVSKLI+MTDGGLD TFDCTGN  VMR+ALEACHKGWGQSIIIGVAAAG
Sbjct: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303

Query: 306 QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG 365
           QEI+TRPFQLVTGRVW+GSAFGGIKGRSEMG LI DY +G LKVDEF+T  RPF+EIN  
Sbjct: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363

Query: 366 LTDLHHGDCLRTVLN 380
             DLH+G CLRTVL+
Sbjct: 364 FEDLHNGSCLRTVLD 378

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/378 (79%), Positives = 334/378 (88%)

Query: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63
           T GK+I C AA+AY AG PL +E ITV+ P+AHEVRIKI +TA+CHTDAYTLSGVDPEG 
Sbjct: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123
           FPSILGHEG+GIVESVG GVTNVK GDHVI LYTAECQ+CKFC SGKTNLC SVRATQGK
Sbjct: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125

Query: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183
           G+MPDGTSRFKN KGE + HFMGCSTFS+YTVVADVSVVA+D  APL+ +CLLGCGVTTG
Sbjct: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTTG 185

Query: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243
           YGAA KTA+VQKGDTVAVFGAGTVGLSV+QGA+ RGAS+II+VDIND K+K+  +FGATD
Sbjct: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245

Query: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FINP  DL DG+TIV KLI+MTDGGLD+TFDCTGNTKVMRDALEACHKGWG S+IIGVAA
Sbjct: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+T+ RPF+EIN
Sbjct: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365

Query: 364 DGLTDLHHGDCLRTVLNF 381
               DLH GDCLRTVL+ 
Sbjct: 366 KAFEDLHAGDCLRTVLDL 383

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/378 (78%), Positives = 331/378 (87%)

Query: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63
           T GK +   AA+AY AG PL +E ITVDPPKAHEVRI++  TA+CHTDAYTLSG DPEG 
Sbjct: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123
           FPSILGHEG+GIVESVG GVT+VK GDHV+ LYTAEC +CKFC SGKTNLCGSVRATQGK
Sbjct: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122

Query: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183
           G+MPDGTSRFKN KGE + HFMGCSTFSEYTVVADVSVVA+D KAPL+  CLLGCGVTTG
Sbjct: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTTG 182

Query: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243
           YGAAVKTA+VQKGDTVA+FGAGTVGLSV QGA++RGAS+II+VDIND KKK+  +FGATD
Sbjct: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242

Query: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FINP  DL +G+TIV KLI+MTDGGLD TFDCTGN KVMRDALEACHKGWG S++IGVAA
Sbjct: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVAA 302

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363
           +GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+T+ RPF +IN
Sbjct: 303 SGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362

Query: 364 DGLTDLHHGDCLRTVLNF 381
           +   DLH GD LRTVLN+
Sbjct: 363 EAFEDLHAGDSLRTVLNY 380

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/382 (72%), Positives = 315/382 (82%), Gaps = 1/382 (0%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPK-AHEVRIKITHTALCHTDAYTLSGVD 59
           M+ T G+TI C AA+AY AG PL +E ITV+ P  A        H  L H   +++    
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60

Query: 60  PEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRA 119
                    G  G+G+VESVG  VT+VKVGDHVI LYTAEC+ECK C SGKTNLC +VRA
Sbjct: 61  EVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120

Query: 120 TQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCG 179
           TQGKG+MPDGTSRF+NSKGE + HFMGCSTF+EYTVVADVSVVAID  APL+KVCLLGCG
Sbjct: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180

Query: 180 VTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDF 239
           VTTGYGAA+KTA+VQKGDTVAVFGAGT+GLSVVQGA++R ASKIIVVDIND KKK++FDF
Sbjct: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240

Query: 240 GATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIII 299
           GATDF+NP  DL DG+TIV KL++MTDGGLD TFD TGN +VMRDALEACHKGWGQSIII
Sbjct: 241 GATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIII 300

Query: 300 GVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPF 359
           GVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG+LI DY  G LK+DEF+T+ RPF
Sbjct: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360

Query: 360 SEINDGLTDLHHGDCLRTVLNF 381
            EIN+G  DLHHGDCLRTVLN+
Sbjct: 361 KEINEGFEDLHHGDCLRTVLNY 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/381 (71%), Positives = 295/381 (77%), Gaps = 46/381 (12%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           MS T GK I C AA+AY AG PL +E I VDPPKAHEVRIKI +TA+CHTDAYTLSGVDP
Sbjct: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG FPSILGHEGSGIVESVG GVTNVKVGDHVI LYTAEC ECKFC SG           
Sbjct: 146 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX-------- 197

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
                                                     A+D+ AP+D +CLLGCGV
Sbjct: 198 --------------------------------------XXXXAVDKNAPMDSICLLGCGV 219

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTGYGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA++RGASKIIVVD+ND KK+WS DFG
Sbjct: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINP  DL +GETIVSKLI+MTDGGL++TFDCTGNTKVMRDALEACHKGWG+SIIIG
Sbjct: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIG 339

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKVDEF+TH RPF+
Sbjct: 340 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399

Query: 361 EINDGLTDLHHGDCLRTVLNF 381
           EIN+   DLHHGDCLRTVL+ 
Sbjct: 400 EINNAFEDLHHGDCLRTVLDL 420

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  448 bits (1153), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/381 (55%), Positives = 279/381 (73%), Gaps = 3/381 (0%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60
           M    G+ I+C AA+AY+   PL +E I VDPP+ HEVR+K+T+TALC TD +TL G++P
Sbjct: 1   MFYKEGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNP 60

Query: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           EG FP +LGHEGSGIVES G+ V  VK GDHV+ LY  EC  C  C S K+NLC  ++AT
Sbjct: 61  EGKFPCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKAT 120

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
           Q +G+MP G+SR  N + + ++HFMGCS+FS+Y VV+D+S V I + APLDK+CLLGCGV
Sbjct: 121 QAQGVMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGV 180

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           TTG+GA +    V+ GD VAVFG+GTVGLSVVQ        ++IVVD+ D+K++W+  FG
Sbjct: 181 TTGFGAPIAKG-VKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFG 239

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDG-GLDHTFDCTGNTKVMRDALEACHKGWGQSIII 299
           ATDFINP K +   ++++  LID + G G D TFDCTG+T VMR ALE+C KGWG S+II
Sbjct: 240 ATDFINPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVII 298

Query: 300 GVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPF 359
           G+A AG+EIST P+ L+ GR W+G AFGG+KGRSE+  L+  Y   ++K+DE++T+ RP 
Sbjct: 299 GLAGAGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPL 358

Query: 360 SEINDGLTDLHHGDCLRTVLN 380
            EIN+ L +L  G  L+TVL+
Sbjct: 359 KEINEALKELEDGLVLKTVLD 379

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  117 bits (294), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 110/376 (29%), Positives = 167/376 (44%), Gaps = 53/376 (14%)

Query: 14  AIAYTAGNPLKIETITVDPPK---AHEVRIKITHTALCHTDAYTLSGVDPE--------- 61
           A+ Y   N +K E    + P+   + +  IK+THT++C TD     G +PE         
Sbjct: 33  AMVYYGANDIKFED--REQPQILSSTDAIIKMTHTSICGTDLGIWKGKNPEIEQTAQTKE 90

Query: 62  GIFP-SILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           G F   ILGHEG GI++ VG  V N K GD VI    + C  C+ C     + C     T
Sbjct: 91  GSFNGRILGHEGIGIIDEVGDAVHNFKKGDRVIVSCISRCGTCENCAKSLYSHC-----T 145

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY--TVVADVSVVAIDEKAPLDKVCLLGC 178
            G G                I  +M   T +EY  T  AD S+ ++ E    +   +L  
Sbjct: 146 NGGGW---------------ILGYMIDGTQAEYVRTPFADTSLYSVPENLSDEAAVMLSD 190

Query: 179 GVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFD 238
            + T +   V+  +V+ GDTVA+ GAG VG+  V  +Q    S +IVVDI+D++   + +
Sbjct: 191 ALPTAHEIGVQMGNVKPGDTVAIVGAGPVGMGCVLTSQLYSPSLLIVVDIDDNRLAMAKE 250

Query: 239 FGATDFINPTKDLNDGETIVSKLIDMTDG-GLDHTFDCTGNTKVMRDALEACHKGWGQSI 297
            G+T  IN  K     E  VSK+++ T+G G+D   +  G  +   D  +   K  G   
Sbjct: 251 MGSTHTINSAK-----EDAVSKILEYTNGRGVDCVMEAVG-AQATWDICQRVIKEGGHLA 304

Query: 298 IIGVAAAGQEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTH 355
            +GV         +P      ++W    +   G+   +  G L+    +GKLK +  VTH
Sbjct: 305 NVGVHG-------KPVNFEIDKLWIKNLTITSGLVNTNTTGMLMKSCCSGKLKSERLVTH 357

Query: 356 TRPFSEINDGLTDLHH 371
              F E++       H
Sbjct: 358 HCNFGEMSGNYNIFKH 373

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  116 bits (291), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 108/387 (27%), Positives = 170/387 (43%), Gaps = 52/387 (13%)

Query: 14  AIAYTAGNPLKIETITVDPPKAHEVR---IKITHTALCHTDAYTLSGVDPE--------- 61
           A+ Y   N L+ E   +  PK  + R   IK+T+T++C TD     G  PE         
Sbjct: 33  AMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNE 90

Query: 62  GIFP-SILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120
           G F   +LGHEG+GIV  VG  V N+K GD VI      C  C+ C  G    C      
Sbjct: 91  GSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC------ 144

Query: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
                M DG            Y   G       T  AD S+ A+ E    +   LL   +
Sbjct: 145 -----MNDGGWALG-------YSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLLSDAL 192

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
            T +   V+  +V+ GD+VA+ GAG VG+  V  +Q    S +IVVD++D++ + + + G
Sbjct: 193 PTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEMG 252

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDG-GLDHTFDCTGNTKVMRDALEACHKGWGQSIII 299
           AT  IN  K     E  V+K++++T+G G+D   +  G     +   + C     Q I  
Sbjct: 253 ATHTINSGK-----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QIIKE 299

Query: 300 GVAAAGQEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTR 357
           G   A   +  +P      ++W    +   G+   +    L+ +  +GKL+ D+ V+H  
Sbjct: 300 GGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHC 359

Query: 358 PFSEINDGLTDLHHG---DCLRTVLNF 381
            F ++ +      H      L+ +++F
Sbjct: 360 NFKDMANNYNIFKHAAKEKALKLLISF 386

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score =  106 bits (265), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 124/260 (47%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA + Y  G PLK  TI V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 37  KAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGH 96

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G+ V N ++GD+  I      C  C+ C  G  + C     +   G   DG
Sbjct: 97  EGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQADLS---GYTHDG 153

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 154 -------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY-KALK 193

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TADV+ G  VA+ GA G +G   VQ A++ G  +++ +D  D+KKK     G   F++ T
Sbjct: 194 TADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIFVDFT 252

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K      +IV  + D+T+GG
Sbjct: 253 KT----HSIVKDIQDVTNGG 268

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/341 (26%), Positives = 160/341 (46%), Gaps = 37/341 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L+ + + V  PK +E+ I + ++ +CHTD +   G  P G   P + GH
Sbjct: 32  KGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGH 91

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G+ VTN ++GD+  I      C  C+FC  G  + C     +   G   DG
Sbjct: 92  EGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLS---GYTHDG 148

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     +    I +   L +V  + C   T Y  A+K
Sbjct: 149 -------------------SFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY-KALK 188

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            +DV+ G  VA+ G AG +G   VQ A++ G  +++ +D  D+K+K     G   F++ T
Sbjct: 189 DSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHFVDFT 247

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
           K     + +VS++ ++T+GG     + + + K +  ++E   +  G  +++G+  AG  +
Sbjct: 248 KT----KDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVVLVGL-PAGATV 301

Query: 309 STRPFQLVTGRV-WKGSAFGGIKGRSEMGNLISDYFAGKLK 348
            +  F  V   +  KGS  G    R++    I  +  G++K
Sbjct: 302 KSDVFNHVIKSINIKGSYVG---NRADTREAIDFFAKGQVK 339

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 117/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L  + + V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 49  KGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGH 108

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G  VTN ++GD+  I      C  C+ C  G    C     +   G   DG
Sbjct: 109 EGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GYTHDG 165

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L ++  + C   T Y  A+K
Sbjct: 166 -------------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALK 205

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TADV+ G  VA+ G AG +G   VQ A++ G  +++ +D  +DKKK   D G   FI   
Sbjct: 206 TADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI--- 261

Query: 249 KDLNDGETIVSKLIDMTDGG 268
            D    + +V  + + T GG
Sbjct: 262 -DFRTTKDMVGAIQEATQGG 280

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 97.1 bits (240), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 140/298 (46%), Gaps = 32/298 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I  T G  L+ + I V  PK++E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   K+GD+  I      C  C++C  G  + C     +   G   DG
Sbjct: 71  EGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I   + L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G+ VA+ GA G +G   +Q A++ G  +++ +D  D+K K   D G   FI+ T
Sbjct: 168 SANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
           K     + IV  +I  T+GG     + + + + +  +++ C    G ++++G+    Q
Sbjct: 227 KT----KDIVGDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGMPGGAQ 279

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 132/295 (44%), Gaps = 32/295 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA + Y     L+ + I V  PKA+E+ + + ++ +CH+D +   G  P  + FP I GH
Sbjct: 11  KAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQLKFPLIGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD   I      C  C++C  G  + C  +    G G   DG
Sbjct: 71  EGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGFTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              TF EY     V    + E   L +V  + C   T Y  A+K
Sbjct: 128 -------------------TFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            A++  G  V + GA G +G   +Q A + G  ++I +D  + KK+     G   FI+ T
Sbjct: 168 RANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLGGEVFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           K+    + IV  +I  TDGG     + + +   +  +   C    G  +++G+ A
Sbjct: 227 KE----KDIVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/298 (27%), Positives = 135/298 (45%), Gaps = 32/298 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I Y  G  LK   I V  PK  E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   K+GD   I      C  C++C     + C     +   G   DG
Sbjct: 68  EGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNCPDADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A +Q G+ VA+ GA G +G   VQ A++ G  +I+ +D  ++KKK   + G   FI   
Sbjct: 165 SARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI--- 220

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
            D  + + +V+++I +T+GG     + + +   +  + E C    G  +++G+ A  Q
Sbjct: 221 -DFAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGLPAGAQ 276

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 95.9 bits (237), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 92/319 (28%), Positives = 140/319 (43%), Gaps = 32/319 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y    PL+ + I V  PK++E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 37  KGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGH 96

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G  V N K+GD   I      C  C+ C +G    C     +   G   DG
Sbjct: 97  EGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS---GYTHDG 153

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L  V  + C   T Y  A+K
Sbjct: 154 -------------------SFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALK 193

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TAD++ GD VA+ G AG +G   VQ A + G  ++I +D  +DKKK     G   FI+ T
Sbjct: 194 TADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFIDFT 252

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
           K     + IV  + + T GG     + + + K +  +++      G  +++G+ A     
Sbjct: 253 KS----KDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPANAVVK 307

Query: 309 STRPFQLVTGRVWKGSAFG 327
           S    Q+V     KGS  G
Sbjct: 308 SDVFNQVVKSIQIKGSYVG 326

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 104/358 (29%), Positives = 171/358 (47%), Gaps = 49/358 (13%)

Query: 36  HEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTNVKVGDHV 92
           H V++ I  T +C +D  Y  +G     +   P +LGHE SG+V  VG+ VT+VKVGD V
Sbjct: 30  HYVKLAIKKTGICGSDVHYYKTGAIGNFVVKDPMVLGHESSGVVVEVGSKVTSVKVGDRV 89

Query: 93  IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSE 152
                   +  K   SG  NLC S+       +  DGT         ++ +++    F  
Sbjct: 90  AIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI--DGT---------LLKYYLSPEDF-- 136

Query: 153 YTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVV 212
             +V     V+ +E A ++    L  GV      A K ADV+ G  V VFGAG VGL  +
Sbjct: 137 --LVKLPDSVSFEEGACVEP---LSVGVH-----ANKLADVRFGSKVVVFGAGPVGL--L 184

Query: 213 QGAQSR--GASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLD 270
            GA SR  GA+ ++ VD+ D K + + +FGAT  +N +K  ++ + +      ++    +
Sbjct: 185 AGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVNSSKFKSEDDLVKEIQRVLSGEQPE 244

Query: 271 HTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG-----QEISTRPFQLV-TGRVWKGS 324
             F+C+G    +R  ++AC  G G+ + +G+          E+ ++  Q++ T R   G 
Sbjct: 245 VVFECSGAEVCIRAGIKACKAG-GRYVQVGMGKDNVNFPISEVVSKELQVLGTFRYCFGD 303

Query: 325 AFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE-INDGLTDLHHG-DCLRTVLN 380
               +K       LIS+   GK+ V   +TH   F + I     ++ HG D ++T+++
Sbjct: 304 YNDSVK-------LISE---GKVNVKPLITHRFKFQDAIKAYEFNIEHGEDVVKTIID 351

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 135/293 (46%), Gaps = 32/293 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA I  T G  L+ + I V  PK+ E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+GIV  VG  V   KVGD   I      C  C++C  G  + C +   +   G   DG
Sbjct: 71  EGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G+ VA+ G AG +G   VQ A++ G  +I+ +D  ++K+K   + G   FI+ T
Sbjct: 168 SANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           K     + IV  +I  T+GG     + + +   +  + E C    G  +++G+
Sbjct: 227 KT----KDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGL 274

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 129/295 (43%), Gaps = 32/295 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA + Y     L+ + +TV  PK +E+ + + ++ +CH+D +   G  P  + FP I GH
Sbjct: 11  KAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD   I      C  C++C  G  + C  +    G G   DG
Sbjct: 71  EGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL---DGTGFTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              TF EY     V    I     L +V  + C   T Y  A+K
Sbjct: 128 -------------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            A+V  G  V + GA G +G   +Q A + G  ++I +D  + K+K     G   FI   
Sbjct: 168 RANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI--- 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
            D  + + IV  +I  T+GG     + + +   +  +   C    G  +++G+ A
Sbjct: 224 -DFTEEKDIVGAIIKATNGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/354 (25%), Positives = 157/354 (44%), Gaps = 38/354 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I  + G PL+ + I V  PK++E+ + I ++ +CHTD +   G  P +   P + GH
Sbjct: 11  KAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+GIV ++G  V   K+GD+  +      C  C++C  G  + C +   +   G   DG
Sbjct: 71  EGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G+ VA+ GA G +G   +Q A + G  +++ +D  DDK K         FI+ T
Sbjct: 168 SANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
           K     + ++S++  +T+GG     + + +   +  + + C    G  +++G+    +  
Sbjct: 227 KT----KDVISEVNKVTNGGAHGVINVSVSEAAIEASTKYCRAN-GTVVLVGLPGGAKCK 281

Query: 309 STRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEI 362
           S    Q+V      GS  G    R++    +  +  G +K      H  P S +
Sbjct: 282 SDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAP---IHVAPLSTL 329

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 119/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           K  I Y  G  L+ + I V  PKA+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 10  KGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 69

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   K+GD   I      C  C++C     + C     +   G   DG
Sbjct: 70  EGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEADLS---GYTHDG 126

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L +V  + C   T Y  A+K
Sbjct: 127 -------------------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY-KALK 166

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ GD VA+ G AG +G   VQ A++ G  +++ +D  ++K K   D G   FI+ T
Sbjct: 167 SANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFIDFT 225

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K  N    I  ++I+ T GG
Sbjct: 226 KSKN----IPEEVIEATKGG 241

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 157/357 (43%), Gaps = 38/357 (10%)

Query: 20  GNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGHEGSGIVES 78
           G PL+ + I V  PKA+E+ I + ++ +CHTD +   G  P  +  P + GHEG+GIV +
Sbjct: 18  GGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVA 77

Query: 79  VGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSK 137
           +G  V N  +GD+  I      C  C+ C     + C     +   G   DG        
Sbjct: 78  MGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GYTHDG-------- 126

Query: 138 GEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGD 197
                      +F +Y     V    I     L +V  + C   T Y  A+K+A+++ GD
Sbjct: 127 -----------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKAGD 174

Query: 198 TVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGET 256
            VA+ GA G +G   +Q A + G  +++ +D  ++K +     G   FI+ TK     + 
Sbjct: 175 WVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFIDFTK----CKD 229

Query: 257 IVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
           ++++++++TDGG     + + +   +  +   C    G  +++G+ A     S    Q+V
Sbjct: 230 VIAEILEVTDGGAHGVINVSVSEAAIEASTRYCRAN-GTVVLVGLPANAYCKSEVFSQVV 288

Query: 317 TGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDGLTDLHHGD 373
                 GS  G    R++    + D+FA  L       H  P S++ +    +  G 
Sbjct: 289 KSISIVGSYVG---NRADTRQAL-DFFARGLVKSPI--HIAPLSDLPEIFDKMAKGQ 339

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 91.7 bits (226), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 119/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I Y  G PL+ + + V  PK +E+ I I ++ +CHTD +   G  P +   P I GH
Sbjct: 11  KAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   K+GD+  +      C  C+ C     + C     +   G   DG
Sbjct: 71  EGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F EY     V    I +   L +V  L C   T Y  A+K
Sbjct: 128 -------------------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +AD+  G  VA+ GA G +G   +Q A++ G  +++ +D  ++KKK   + G   F+   
Sbjct: 168 SADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVFL--- 223

Query: 249 KDLNDGETIVSKLIDMTDGG 268
            D    + + + +I  T+GG
Sbjct: 224 -DFRLEKDMEAAIIKATNGG 242

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 91.7 bits (226), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 131/295 (44%), Gaps = 32/295 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA + Y     L+ + +TV  PK +E+ + + ++ +CH+D +   G  P  + FP I GH
Sbjct: 11  KAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD   I      C  C++C  G  + C  +    G G   DG
Sbjct: 71  EGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGFTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              TF EY     V    I +   L +V  + C   T Y  A+K
Sbjct: 128 -------------------TFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            A++  G  V + GA G +G   +Q A + G  ++I +D  + K+K     G   FI+ T
Sbjct: 168 RANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLGGEIFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           K+ +    +   +I  T+GG     + + +   +  +   C    G  +++G+ A
Sbjct: 227 KERD----VAGAVIKATNGGSHGIINVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 123/266 (46%), Gaps = 39/266 (14%)

Query: 36  HEVRIKITHTALCHTDAY--TLSGVDPEGIF----PSILGHEGSGIVESVGTGVTNVKVG 89
           H V+++I  T +C +D +  T   +   G F    P +LGHE SGIV  VG+ VT V VG
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAI---GSFIVKEPMVLGHESSGIVVEVGSEVTKVAVG 87

Query: 90  DHVI--PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTS-RFKNSKGEVIYHFMG 146
           D V   P Y +   E    +SG  NLC  ++      +  DGT  ++     + +Y    
Sbjct: 88  DRVAIEPGYPSRYSE--ETVSGHYNLCPGMKFAATPPV--DGTLLKYFQVPEDFVYKLPD 143

Query: 147 CSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGT 206
             TF E  +V  ++V                         AVK A V+ GD V VFGAG 
Sbjct: 144 DVTFEEGALVEPLAVAV----------------------HAVKLAGVKFGDKVVVFGAGP 181

Query: 207 VGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTD 266
           VGL V    ++ GA++++ +D+ D K   S + G+T  IN +KD+ +    +    D+  
Sbjct: 182 VGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN-SKDMAEEALALEIQNDLNG 240

Query: 267 GGLDHTFDCTGNTKVMRDALEACHKG 292
              +   DCTG    +R ++ AC  G
Sbjct: 241 QHPNKVIDCTGAEPCLRSSILACKPG 266

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 92.0 bits (227), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 147/341 (43%), Gaps = 73/341 (21%)

Query: 14  AIAYTAGNPLKIETITVDPPKAHE--VRIKITHTALCHTD----------------AYTL 55
           A+AY     ++       P  +HE  V I ++   +C +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 56  SGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE------------- 102
           SG   +G+ P  +GHE SGIV  VG+ V+ VKVGDHV+      C++             
Sbjct: 63  SG---QGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 103 -CKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCST--FSEYTVVADV 159
            C  C +G  N C                        ++ +  +GC +  F+E  V+++ 
Sbjct: 119 LCIACKTGNPNCC-----------------------TDLGFCGLGCQSGGFAEKIVLSER 155

Query: 160 SVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRG 219
           +VV I    PLD   L+     + +  AV+ + +Q G T  V GAG +GL+ V   QS G
Sbjct: 156 NVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQSHG 213

Query: 220 ASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTG 277
           A  IIV +  D +++ +   GA  F NPT+    G+ ++  L  +  G  G + ++DC G
Sbjct: 214 AGTIIVSEPADTRRQKAEALGAQTF-NPTE---HGDNVIEALRKLAPGGEGFNFSYDCCG 269

Query: 278 NTKVMRDALEACHKGWGQSIIIGVAAAG-QEISTRPFQLVT 317
            ++     L   H    + + + +A  G + I   P  + T
Sbjct: 270 TSETFSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTT 307

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 91.7 bits (226), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 103/228 (45%), Gaps = 39/228 (17%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE SGIV  VG  VTN+K GDHV+   T  C               EC  C  G
Sbjct: 67  LPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N C  +      G M  G     +S G           F+E  VV++  VV I    P
Sbjct: 127 FYNCCAHL------GFMGLGV----HSGG-----------FAEKVVVSEKHVVKIPNTLP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+     + +  AV+ + +QKG +  V GAG +GL+ +   Q  GASKI+V +  
Sbjct: 166 LDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTG 277
           + ++  +   G   F +P++   D   I+ KL    + G D  +DC+G
Sbjct: 224 EIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 91.3 bits (225), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 131/295 (44%), Gaps = 32/295 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA + Y     L+ + + V  PK +E+ + + ++ +CH+D +   G  P  + FP I GH
Sbjct: 11  KAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD   I      C  C++C  G  + C  +    G G   DG
Sbjct: 71  EGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGFTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              TF EY     V    I +   L +V  + C   T Y  A+K
Sbjct: 128 -------------------TFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            A++  G  V + GA G +G   VQ A + G  ++I +D  + K+K   +     FI+ T
Sbjct: 168 RANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           K+    + +V  +I  TDGG     + + +   +  +   C    G  +++G+ A
Sbjct: 227 KE----KDVVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 118/260 (45%), Gaps = 28/260 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G PL  + + V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 34  KGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 93

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+GIV + G+ V N ++GD   I      C  C+ C  G  + C     +   G   DG
Sbjct: 94  EGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHADLS---GYTHDG 150

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y          I     L +V  + C   T Y  A+K
Sbjct: 151 -------------------SFQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY-KALK 190

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TA +Q G+ VA+ GA G +G   +Q A++ G  +++ +D  + K K   + G   FI+ T
Sbjct: 191 TAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETFIDFT 249

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K  N+ E ++  + + T GG
Sbjct: 250 KYKNN-EAMIKDIQEATKGG 268

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 128/281 (45%), Gaps = 37/281 (13%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA I Y  G  L+ + I V  PK++E+ I I ++ +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFC-ISGKTNLCGSVRATQGKGLMPD 128
           EG+GIV  +G  V   K+GD+  I      C  C++C +S ++N              PD
Sbjct: 71  EGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC-------------PD 117

Query: 129 GTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAV 188
                    G          +F +Y     V    I     L +V  + C   T Y  A+
Sbjct: 118 ADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY-KAL 166

Query: 189 KTADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINP 247
           K+A+++ G+ VA+ GA G +G   +Q A++ G  +++ +D  D+K     + G   FI+ 
Sbjct: 167 KSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVFIDF 225

Query: 248 TKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
           TK     + +V  ++D T+GG         N  V   A+EA
Sbjct: 226 TKT----KDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 118/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y     L  + I V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 35  KGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 94

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD   I      C  C+FC SG  + C     +   G   DG
Sbjct: 95  EGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPDADLS---GYTHDG 151

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F ++     +    I +   L +V  + C   T Y  A+K
Sbjct: 152 -------------------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALK 191

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            AD++ GD VA+ G AG +G   VQ A + G  +++ +D  ++K+K     G   FI+ T
Sbjct: 192 EADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFIDFT 250

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K  N    +VS + + T GG
Sbjct: 251 KTKN----MVSDIQEATKGG 266

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 126/280 (45%), Gaps = 35/280 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I Y +G  L+ + + V  PK +E+ I I ++ +CHTD +   G  P +   P I GH
Sbjct: 11  KAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G  V   K+GD+  +      C  C+ C     + C     +   G   DG
Sbjct: 71  EGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F EY     V    I + A L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +AD+  G+ VA+ GA G +G   VQ A++ G  +++ +D  ++KKK   + G   F+   
Sbjct: 168 SADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVFL--- 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
            D    + + + +I  T+GG         N  V   A+EA
Sbjct: 224 -DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEA 258

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 135/298 (45%), Gaps = 32/298 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           K  I Y +   L+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   KVGD   I    + C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I E   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G  VA+ G AG +G   VQ A++ G  +++ +D  + K++     G   FI+ T
Sbjct: 165 SANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
           K+    + IVS ++  TDGG     + + +   +  +   C    G  +++G+ A  +
Sbjct: 224 KE----KDIVSAVVKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAGAK 276

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 106/387 (27%), Positives = 180/387 (46%), Gaps = 54/387 (13%)

Query: 10  QCKAAIAYTAGNPLKIETITV----DPPKAHEVRIKITHTALCHTDA-YTLSGVDPEGIF 64
           + + AI       + +E+  V    DP   H V+++I  T +C +D  Y ++G   + + 
Sbjct: 3   ETQEAIVLVQKGEIAVESKPVPEITDP---HYVKLQIKKTGICGSDVHYYVAGAIGDFVV 59

Query: 65  --PSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQG 122
             P ILGHE SG+V  VG+ V+ V+VGD V        +      +G+ NLC  ++    
Sbjct: 60  KKPMILGHESSGLVVEVGSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAAT 119

Query: 123 KGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTT 182
             +  DGT         ++ +++    F    +V     V+ +E A ++    L  GV  
Sbjct: 120 PPI--DGT---------LVKYYLAPEDF----LVKLPDHVSYEEGALVEP---LSVGVH- 160

Query: 183 GYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGAT 242
               A K A V     VAVFGAG VGL     A++ GAS+++ +D+ + K   S +FG T
Sbjct: 161 ----ANKLAGVAFNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGT 216

Query: 243 DFINPTKDLNDGETIVSKLIDMTDGGL--DHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
            F+N + ++ D + +V K I+   GG   D  FDCTG    +R  ++ C+ G G  + +G
Sbjct: 217 QFVN-SANIKDEDDLV-KEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVG 273

Query: 301 VAAAGQEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTH 355
           +   G +    P   +  +  K       AFG  +   +   LI+   +G + V   VTH
Sbjct: 274 M---GHDDVNFPIGAIGAKELKVLGCFRYAFGDYR---DAVQLIA---SGDVNVKPLVTH 324

Query: 356 TRPFSEINDGLT-DLHHG-DCLRTVLN 380
              F +       ++ HG + ++T+++
Sbjct: 325 RFKFEDAEAAYEFNIKHGSEVIKTIIS 351

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 133/295 (45%), Gaps = 32/295 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           K  I Y +G  L  + + V  P+ +E+ + + ++ +CHTD +   G  P +   P + GH
Sbjct: 30  KGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLDTKLPLVGGH 89

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G  V N ++GD   I      CQ C+ C  G  + C     +   G   DG
Sbjct: 90  EGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLS---GYTHDG 146

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              TF +Y     +    I +   L  V  + C   T Y  A++
Sbjct: 147 -------------------TFQQYATADAIQAAHIPKGTDLAGVAPILCAGVTVY-KALR 186

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           ++  + G+ VA+ G AG +G    Q A++ G  +++ +D  +DK K     G   FI+ T
Sbjct: 187 SSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSLGGEIFIDFT 245

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           K+    + I + +++ T GG     + + + K M  ++E   +  G  +++G+ A
Sbjct: 246 KE----KDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVGLPA 295

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 119/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L+ + + V  PKA+E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 35  KGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 94

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+GIV + G  V N ++GD+  I      C  C+ C  G  + C     +   G   DG
Sbjct: 95  EGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQADLS---GYTHDG 151

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L ++  + C   T Y  A+K
Sbjct: 152 -------------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY-KALK 191

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TAD++ G  VA+ G AG +G   VQ A++ G  +++ +D  D K++     G   FI   
Sbjct: 192 TADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI--- 247

Query: 249 KDLNDGETIVSKLIDMTDGG 268
            D    + +V+ + + T+GG
Sbjct: 248 -DFRKSKDMVADIQEATNGG 266

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 115/260 (44%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA + Y  G PL  + I V  PKA+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 41  KAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 100

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EGSG+V  VG  V   KVGD   I      C  C+ C +G  + C     +   G   DG
Sbjct: 101 EGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GYTHDG 157

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I E   L +V  + C   T Y  A+K
Sbjct: 158 -------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY-KALK 197

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            AD++ G  V + G AG +G   VQ A++ G  ++I +D    K++     G   FI+ T
Sbjct: 198 EADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVFIDFT 256

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + +V  + + T GG
Sbjct: 257 KS----KDMVKDIQEATKGG 272

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 136/301 (45%), Gaps = 38/301 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y +   L+ + I V  PKA+E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G  V   K+GD+  I      C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++  G  VA+ G AG +G   VQ A++ G  +++ +D  + K++     G   FI+ T
Sbjct: 165 SANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAAAG 305
           K+    + IV  ++  TDGG         N  V   A+EA     +  G ++++G+ A  
Sbjct: 224 KE----KDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPAGA 275

Query: 306 Q 306
           +
Sbjct: 276 K 276

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 152/356 (42%), Gaps = 47/356 (13%)

Query: 36  HEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTNVKVGDHV 92
           H+V+I+I  T +C +D  Y   G   + +   P +LGHE +G+V  VG  V++VKVGD V
Sbjct: 29  HDVKIQIKATGICGSDVHYFTQGSIGDFVVKSPLVLGHESAGVVVEVGDAVSSVKVGDRV 88

Query: 93  IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGT-SRFKNSKGEVIYHFMGCSTFS 151
                   +  K  +SG  NLC  +          DGT  ++  S  + +Y      +F 
Sbjct: 89  AVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY--DGTLVKYYLSPEDFVYKLADHISFE 146

Query: 152 EYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSV 211
           E  VV  +SV                         A + A+   G  V V GAG VGL  
Sbjct: 147 EGAVVEPLSVAV----------------------HANRLANTAFGQAVLVLGAGPVGLLA 184

Query: 212 VQGAQSRGASKIIVVDINDDKKKWSFDFGATD--FINPTKDLNDGETIVSKLIDMTDGGL 269
              A++ GA+ ++ VDI + K + +  FGAT      P  D ND  ++V+K +    GGL
Sbjct: 185 GAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVLFKPDSDENDLVSLVTKSL----GGL 240

Query: 270 --DHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFG 327
             D  F+C+G  K +R A+++  +G G  + +G+           F        K + F 
Sbjct: 241 HPDVVFECSGAEKCIRAAVKSVKRG-GTFVQVGMGKDNINFPINEFS------QKEATFK 293

Query: 328 GIKGRSE--MGNLISDYFAGKLKVDEFVTHTRPFSEINDGLTD--LHHGDCLRTVL 379
           G     E    + +     GK+ V   +T   PF +  +       H  D  +T++
Sbjct: 294 GCFRYYEGDFDDAVKLLSTGKVNVKPLITKVFPFEQAVEAYKHNVEHAKDVTKTII 349

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 89.4 bits (220), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 129/293 (44%), Gaps = 32/293 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA I Y  G PL+   I V  PKA E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   K+GD   I      C  C++C     + C     +   G   DG
Sbjct: 71  EGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNCPEADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ GD VA+ GA G +G   +Q A + G  +++ +D  ++K++     G   FI   
Sbjct: 168 SANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVFI--- 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
            D    + IV+ ++  T+GG     + + +   +  + E      G  +++G+
Sbjct: 224 -DFRKSKDIVADVVKATNGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGL 274

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 121/260 (46%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L+ + I V  PKA+E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 11  KGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   K+GD+  I      C  C++C     + C     +   G   DG
Sbjct: 71  EGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNCPEADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++  G+ VA+ GA G +G   +Q A++ G  +I+ +D  D+K     + G   FI+ T
Sbjct: 168 SANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + I + +I+ T+GG
Sbjct: 227 KT----KDIEAAVIEATNGG 242

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 127/280 (45%), Gaps = 35/280 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I Y  G  L+ + I V  PK++E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   K+GD+  I      C  C++C     + C     +   G   DG
Sbjct: 71  EGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNCPEADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G+ VA+ GA G +G   +Q A++ G  +++ +D  ++K     + G   FI+ T
Sbjct: 168 SANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
           K     + +V  ++D T+GG         N  V   A+EA
Sbjct: 227 KT----KDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 102/362 (28%), Positives = 168/362 (46%), Gaps = 57/362 (15%)

Query: 36  HEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTNVKVGDHV 92
           +  ++ +  T +C +D  Y  SG   + I   P +LGHE SG+V  VG  V  +KVGD V
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRV 89

Query: 93  -----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMG 146
                +P  Y+ E +      +GK NLC  +       +  DGT         ++ +++ 
Sbjct: 90  AIEPGVPDRYSDETK------AGKYNLCPHMAFAATPPI--DGT---------LVKYYLS 132

Query: 147 CSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGT 206
            + F    +V     V+ +E A ++    L  GV +      K A V+ G TV VFGAG 
Sbjct: 133 PADF----LVKLPDHVSFEEGACIEP---LSVGVHSN-----KLAKVRFGQTVVVFGAGP 180

Query: 207 VGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTK-DLNDGETIVSKLIDMT 265
           VGL     A++ GAS ++ VD+ D K + + +FGAT  IN TK   ND + +  ++  + 
Sbjct: 181 VGLLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLL 240

Query: 266 DGGL-DHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWK-- 322
            G L D  F+C+G    +   ++A   G G  + IG+   G+     P   V+G+     
Sbjct: 241 GGALADVVFECSGAESCIDAGVKATKNG-GTMVQIGM---GKNYVNFPIAEVSGKEMTLV 296

Query: 323 ---GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG--LTDLHHGDCLRT 377
                ++G  K   +  NL+S    G++ V + +TH   F +          H G+ ++T
Sbjct: 297 GCFRYSYGDYK---DAVNLVS---TGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEVVKT 350

Query: 378 VL 379
           ++
Sbjct: 351 II 352

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 113/250 (45%), Gaps = 27/250 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y     L+ + I V  PKA+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 12  KGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGH 71

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G  V   K+GD+  I      C  C++C     + C     +   G   DG
Sbjct: 72  EGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEADLS---GYTHDG 128

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 129 -------------------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALK 168

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++  G+ VA+ G AG +G   VQ A++ G  +I+ +D  D+KK    + G   F++ T
Sbjct: 169 SANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFVDFT 227

Query: 249 KDLNDGETIV 258
           K  N  + I+
Sbjct: 228 KSKNVEQDIL 237

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 88.2 bits (217), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 140/308 (45%), Gaps = 33/308 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y +   L+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   KVGD   +    + C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I E   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G+ VA+ G AG +G   VQ A++ G  +++ +D    K++     G   FI+ T
Sbjct: 165 SANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
           K+    + I+  ++  TDGG     + + +   +  + + C    G  +++G+  AG + 
Sbjct: 224 KE----KDIIGAVVKATDGGAHGIINVSVSEAAIEASTKYCRAN-GTVVLVGL-PAGAKC 277

Query: 309 STRPFQLV 316
           S+  F  V
Sbjct: 278 SSDVFNHV 285

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 134/301 (44%), Gaps = 38/301 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L+ + I V  PKA+E+ + + ++ +CHTD +   G  P  +  P + GH
Sbjct: 11  KGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   KVGD   I      C  C+ C  G  + C     +   G   DG
Sbjct: 71  EGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNCPEADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I   A L ++  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++Q GD VA+ G AG +G   VQ A++ G  +++ +D  ++K++     G   FI   
Sbjct: 168 SANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVFI--- 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAAAG 305
            D    + I  ++I  T+GG         N  V   A+E+     +  G  +++G+ A  
Sbjct: 224 -DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGLPAGA 278

Query: 306 Q 306
           +
Sbjct: 279 K 279

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 118/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y     L  + I V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 35  KGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 94

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   K+GD   I      C  C+FC SG  + C     +   G   DG
Sbjct: 95  EGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNCPDADLS---GYTHDG 151

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F ++     +    I +   L +V  + C   T Y  A+K
Sbjct: 152 -------------------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALK 191

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            AD++ GD VA+ G AG +G   VQ A + G  +++ +D  ++K+K     G   FI+ T
Sbjct: 192 EADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFIDFT 250

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + +VS + + T GG
Sbjct: 251 KT----KDMVSDIQEATKGG 266

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 142/318 (44%), Gaps = 47/318 (14%)

Query: 27  TITVDPPKA---HEVRIKITHTALCHTDAYT----------------LSGVDPEGIFPSI 67
           T  +D PK    HE+ I +    +C TD +                 LSG+D     P  
Sbjct: 15  TDKIDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLP 70

Query: 68  LGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMP 127
           +GHE SGIV+ VG GVT  K GD V+   T  C        G T+     +  +G+ L P
Sbjct: 71  MGHEMSGIVKEVGKGVTRFKPGDRVVIEATTSC--------GDTHRWPKSKVAKGE-LCP 121

Query: 128 DGTSRFKNSKGEVIYHFMGC--STFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYG 185
                  N      +  +G     F+E  VV +  VV I +K PLD   L+   ++  + 
Sbjct: 122 ACEMGLPNCCTHGSFQGLGSVGGGFAEQVVVGEKHVVKIPDKLPLDVAALVE-PLSVAWH 180

Query: 186 AAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFI 245
           AA + A+ ++G    V G+G +GL+++   +   A KI+V +    +++ +       F 
Sbjct: 181 AA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELAEKLNVVVF- 238

Query: 246 NPTKDLNDGETIVSKLIDMT--DGGLDHTFDCTGNTKVMRDALE-ACHKGWGQSIIIGVA 302
           NPT      +  + KL +++  D G D+TFDC+G       A++ AC +G     I+ VA
Sbjct: 239 NPTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH----IVNVA 292

Query: 303 AAG-QEISTRPFQLVTGR 319
             G + ++  P  +  G 
Sbjct: 293 IWGPKPVAFHPMDMTYGE 310

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 133/298 (44%), Gaps = 32/298 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y +   L+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   KVGD   I    + C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I E   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G  VA+ G AG +G   VQ A++ G  +++ +D    K++     G   FI+ T
Sbjct: 165 SANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
           K+    + IV  +I  TDGG     + + +   +  +   C    G  +++G+ A  +
Sbjct: 224 KE----KDIVGAVIKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAGAK 276

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 117/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y     L  + I V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 35  KGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPLVGGH 94

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD   I      C  C+FC SG  + C     +   G   DG
Sbjct: 95  EGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPEADLS---GYTHDG 151

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F ++     +    I     L +V  + C   T Y  A+K
Sbjct: 152 -------------------SFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY-KALK 191

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            A+++ GD VA+ G AG +G   VQ A + G  +++ +D  ++K+K     G   FI+ T
Sbjct: 192 EANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVFIDFT 250

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + +VS + + T GG
Sbjct: 251 KT----KDMVSDIQEATKGG 266

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 118/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L+ + I V  PKA+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V    +GD   I      C  C++C     + C     +   G   DG
Sbjct: 68  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNCPDADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALK 164

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +AD++ GD VA+ GA G +G   +Q A++ G  +++ +D   +K K   + G   F+   
Sbjct: 165 SADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV--- 220

Query: 249 KDLNDGETIVSKLIDMTDGG 268
            D    + ++ +++D T+GG
Sbjct: 221 -DYAVSKDLIKEIVDATNGG 239

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 108/369 (29%), Positives = 169/369 (45%), Gaps = 59/369 (15%)

Query: 29  TVDPPKAHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTN 85
           T++ P  H V++ I  T +C +D  Y  SG   + I   P +LGHE SG V  VG  VT 
Sbjct: 26  TIEDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGEVVEVGNAVTR 83

Query: 86  VKVGDHV-----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGE 139
           VKVGD V     +P  Y+ E +E      G+ NLC  +       +  DGT         
Sbjct: 84  VKVGDRVAIEPGVPSRYSDETKE------GRYNLCPHMAFAATPPI--DGT--------- 126

Query: 140 VIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTV 199
           ++ +++    F    +V     V+ +E A ++    L  GV +      K A V+    V
Sbjct: 127 LVKYYLSPEDF----LVKLPEGVSYEEGACVEP---LSVGVHSN-----KLAGVRFSTRV 174

Query: 200 AVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVS 259
            VFGAG VGL     A++ GAS ++ VD+ D+K + + DFGAT+  N +K   D    ++
Sbjct: 175 VVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELA 234

Query: 260 KLIDMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
             ++   GG   D  F+C+G   V  DA     K  G  + +G+   G+  +  P   V+
Sbjct: 235 SEVEKLLGGNHADVVFECSG-ADVCIDAGVKVTKVGGTMVQVGM---GKNYTNFPIAEVS 290

Query: 318 GRVWK-----GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG--LTDLH 370
           G+  K       +FG  +   +  NL++    GK+ V   +TH   F +          H
Sbjct: 291 GKEMKLIGCFRYSFGDYR---DAVNLVA---TGKVNVKPLITHRFKFEDAAKAYDYNISH 344

Query: 371 HGDCLRTVL 379
            GD ++T++
Sbjct: 345 GGDVVKTII 353

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 138/308 (44%), Gaps = 33/308 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I Y +   L+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G  V   K+GD+  I      C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F EY     V    I +   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G   A+ G AG +G   VQ A++ G  +++ +D    K++     G   FI+ T
Sbjct: 165 SANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
           K+    + IVS ++  T+GG     + + +   +  +   C    G  +++G+  AG + 
Sbjct: 224 KE----KDIVSAVVKATNGGAHGIINVSVSEAAIEASTRYCRAN-GTVVLVGL-PAGAKC 277

Query: 309 STRPFQLV 316
           S+  F  V
Sbjct: 278 SSDVFNHV 285

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 95/345 (27%), Positives = 151/345 (43%), Gaps = 38/345 (11%)

Query: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EG 62
           TA    + K  I Y  G  LK E I V  PK +E+ I + ++ +CHTD +   G  P   
Sbjct: 25  TASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPT 84

Query: 63  IFPSILGHEGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQ 121
             P + GHEG+G+V ++G  V   K+GD   I      C  C++C     + C     + 
Sbjct: 85  KLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHADLS- 143

Query: 122 GKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVT 181
             G   DG                   +F +Y     V    I E   L +V  + C   
Sbjct: 144 --GYTHDG-------------------SFQQYATADYVQAARIPEGTDLAEVSPILCAGV 182

Query: 182 TGYGAAVKTADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           T Y  A+K+A+++ GD VA+ G AG +G   VQ A++ G  +++ +D   +K +     G
Sbjct: 183 TVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKLG 240

Query: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
              FI+ TK  N    +V  + + T+GG     + + +   M  + +      G  +++G
Sbjct: 241 GEVFIDFTKHKN----LVEAVQEATNGGPHGVINVSVSEAAMTASTQFVRPT-GTVVLVG 295

Query: 301 VAAAGQEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGNLISDYFA 344
           +  AG  I +  F  V   +  KGS  G    R++    I D+FA
Sbjct: 296 L-PAGAVIKSEVFSHVVKSINIKGSYVG---NRADTREAI-DFFA 335

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 115/260 (44%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L+ + + V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 47  KGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGH 106

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G  VTN ++GD   I      C  C+ C  G    C     +   G   DG
Sbjct: 107 EGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS---GYTHDG 163

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    + +   L +V  + C   T Y  A+K
Sbjct: 164 -------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY-KALK 203

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TAD+  G  VA+ G AG +G   VQ A++ G  +++ +D  D+KK+     G   FI   
Sbjct: 204 TADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIFI--- 259

Query: 249 KDLNDGETIVSKLIDMTDGG 268
            D    + +V  + + T GG
Sbjct: 260 -DYTTTKDMVGAIQEATQGG 278

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 107/239 (44%), Gaps = 39/239 (16%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE SGIV  VG  VT VKVGDHV+    + C              + C  C  G
Sbjct: 67  LPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             NLC       G G++  G                    F+E  VV+   ++ + ++ P
Sbjct: 127 SENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKEIP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+     T +  AVK +  +KG +  V GAG +GL  +   +  GASKI+V +I 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
           + + + +   G   F NP+K  +    I+  L    D G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 115/245 (46%), Gaps = 29/245 (11%)

Query: 51  DAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGK 110
           + + +SGV      P  +GHE SG+V  +G GV N+KVGDHV+   T  C++       K
Sbjct: 58  EKHAMSGVG----LPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVK 113

Query: 111 ---TNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCST--FSEYTVVADVSVVAID 165
                 C + +              F N   E+ +  +GC +  F+E  V+++  VV + 
Sbjct: 114 HASDEECAACK------------KDFYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVP 161

Query: 166 EKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIV 225
           +  PLD   L+     + +  AV+ + ++ G +  + GAG +GL+ V   Q  GA  I+V
Sbjct: 162 KDIPLDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVV 219

Query: 226 VDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMR 283
            + +  ++K +   GA  F NP    + G+  V +L  +  G  G D ++DC+G      
Sbjct: 220 SEPSASRRKQAEALGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSGLKATFN 275

Query: 284 DALEA 288
             L A
Sbjct: 276 TGLYA 280

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 162/367 (44%), Gaps = 54/367 (14%)

Query: 21  NPLKIETITVDPPK---AHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSG 74
            P KI    V  PK    +EV I+I  T +C +D  Y   G     +   P +LGHE SG
Sbjct: 14  RPGKITLTNVSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSG 73

Query: 75  IVESVGTGVTNVKVGDHV-----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPD 128
           IV  +G  V  +KVGD V     IP  ++ E +E      G+ NL  +++         D
Sbjct: 74  IVALIGENVKTLKVGDRVALEPGIPDRFSPEMKE------GRYNLDPNLKFAATPPF--D 125

Query: 129 GT-SRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAA 187
           GT +++  +  + +Y      +F E  ++  +SV                         A
Sbjct: 126 GTLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAI----------------------HA 163

Query: 188 VKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINP 247
            K A ++ G    VFGAG +GL   + A   GA+ ++ VD+ ++K + +  FGAT  +N 
Sbjct: 164 NKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN- 222

Query: 248 TKDLNDGETIVSKLID-MTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
           + DL  G T+ S +   +   G D  F+C+G    +R  +E C  G G  + +G+   GQ
Sbjct: 223 SGDLPHGVTVDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVGM---GQ 278

Query: 307 EISTRPFQLV-TGRVWKGSAFGGIKG-RSEMGNLISDYFAGKLKVDEFVTHTRPFSEIND 364
           E    P  ++ T  +     F   +G  S+   L+S   + KL +  F+TH   F +  +
Sbjct: 279 EEIQFPISIIPTKELTFQGCFRYCQGDYSDSIELVS---SRKLSLKPFITHRYSFKDAVE 335

Query: 365 GLTDLHH 371
              +  H
Sbjct: 336 AFEETSH 342

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 135/298 (45%), Gaps = 38/298 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y +   L+ + I V  PKA+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V    +GD+  I      C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++  G  VA+ G AG +G   VQ A++ G  +++ +D  + K++     G   FI+ T
Sbjct: 165 SANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAA 303
           K+    + IV+ ++  TDGG         N  V   A+EA     +  G ++++G+ A
Sbjct: 224 KE----KDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPA 273

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 117/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y     L  + I V  PK +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 35  KGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 94

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD   I      C  C+FC SG  + C     +   G   DG
Sbjct: 95  EGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPDADLS---GYTHDG 151

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F ++     +    I +   L +V  + C   T Y  A+K
Sbjct: 152 -------------------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALK 191

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            A+++ GD VA+ G AG +G   VQ A + G  +++ +D   +K+K     G   FI+ T
Sbjct: 192 EANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQLGGEVFIDFT 250

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + +VS + + T GG
Sbjct: 251 KT----KDMVSDIQEATKGG 266

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 147/334 (44%), Gaps = 34/334 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           K  I Y  G  L+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 34  KGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 93

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V    +GD   I      C  C++C     + C     +   G   DG
Sbjct: 94  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNCPDADLS---GYTHDG 150

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 151 -------------------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALK 190

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ GD VA+ G AG +G   VQ A++ G  +++ +D  ++K K     G   F++ T
Sbjct: 191 SANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAFVDFT 249

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
           K     + +V+++ ++T+GG     + + +   M  + +      G  +++G+  AG  I
Sbjct: 250 KT----KDMVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPT-GTVVLVGL-PAGAVI 303

Query: 309 STRPFQLVTGRV-WKGSAFGGIKGRSEMGNLISD 341
            +  F  V   +  KGS  G      E  N  ++
Sbjct: 304 KSEVFSHVVKSINIKGSYVGNRADTREAINFFAN 337

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 117/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y +G  L+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 37  KGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 96

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G  V N ++GD   I      C  C+ C  G  + C     +   G   DG
Sbjct: 97  EGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNCLHADLS---GYTHDG 153

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 154 -------------------SFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY-KALK 193

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TAD++ G  VA+ G AG +G   VQ A++ G  +I+ +D    K++     G   FI+ T
Sbjct: 194 TADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVFIDFT 252

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + IVS + + T GG
Sbjct: 253 KT----KDIVSAIQEATKGG 268

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 116/260 (44%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G PL  + I V  PKA+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 33  KGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGH 92

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EGSG V ++G  V   K+GD   I      C  C+ C SG  + C     +   G   DG
Sbjct: 93  EGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG 149

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   + +V  + C   T Y  A+K
Sbjct: 150 -------------------SFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY-KALK 189

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            AD++ G  V + G AG +G   VQ A++ G  ++I +D    K++     G   F++ T
Sbjct: 190 EADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSLGGEIFVDFT 248

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + IV+++ + T GG
Sbjct: 249 KT----KDIVAEIQEATRGG 264

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 107/370 (28%), Positives = 165/370 (44%), Gaps = 61/370 (16%)

Query: 29  TVDPPKAHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTN 85
           T+D P  H V++ I  T +C +D  Y  SG   + I   P +LGHE SG V  VG  VT 
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 86  VKVGDHV-----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGT-SRFKNSKG 138
           VK+GD V     +P  Y+ E +E      G+ NLC  +       +  DGT  R+  S  
Sbjct: 84  VKIGDRVAIEPGVPGRYSDETKE------GRYNLCPHMAFAATPPI--DGTLVRYYLSPE 135

Query: 139 EVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDT 198
           + +       ++ E   V  +SV                 GV +      K A V+ G  
Sbjct: 136 DFLVKLPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTR 173

Query: 199 VAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
           V VFGAG VGL     A + GAS +I VD+ D++ + + DFGA+   N +K   D    +
Sbjct: 174 VVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQL 233

Query: 259 SKLIDMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
           +  ++   GG   D  F+C+G   V  DA     K  G  + +G+   G+  +  P   V
Sbjct: 234 ADEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEV 289

Query: 317 TGRVWK-----GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG--LTDL 369
           +G+  +       +FG  +   +  NL++   +GK+ V   +TH   F +          
Sbjct: 290 SGKEMRLIGCFRYSFGDYR---DAVNLVA---SGKVNVKPLITHRFKFEDAAKAYDYNIA 343

Query: 370 HHGDCLRTVL 379
           H GD ++T++
Sbjct: 344 HGGDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 107/370 (28%), Positives = 165/370 (44%), Gaps = 61/370 (16%)

Query: 29  TVDPPKAHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTN 85
           T+D P  H V++ I  T +C +D  Y  SG   + I   P +LGHE SG V  VG  VT 
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 86  VKVGDHV-----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGT-SRFKNSKG 138
           VK+GD V     +P  Y+ E +E      G+ NLC  +       +  DGT  R+  S  
Sbjct: 84  VKIGDRVAIEPGVPGRYSDETKE------GRYNLCPHMAFAATPPI--DGTLVRYYLSPE 135

Query: 139 EVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDT 198
           + +       ++ E   V  +SV                 GV +      K A V+ G  
Sbjct: 136 DFLVKLPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTR 173

Query: 199 VAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
           V VFGAG VGL     A + GAS +I VD+ D++ + + DFGA+   N +K   D    +
Sbjct: 174 VVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQL 233

Query: 259 SKLIDMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
           +  ++   GG   D  F+C+G   V  DA     K  G  + +G+   G+  +  P   V
Sbjct: 234 ADEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEV 289

Query: 317 TGRVWK-----GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG--LTDL 369
           +G+  +       +FG  +   +  NL++   +GK+ V   +TH   F +          
Sbjct: 290 SGKEMRLIGCFRYSFGDYR---DAVNLVA---SGKVNVKPLITHRFKFEDAAKAYDYNIA 343

Query: 370 HHGDCLRTVL 379
           H GD ++T++
Sbjct: 344 HGGDVVKTII 353

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 111/369 (30%), Positives = 169/369 (45%), Gaps = 71/369 (19%)

Query: 36  HEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTNVKVGDHV 92
           H V++ I  T +C +D  Y  SG   + I   P +LGHE SG V  VG  VT VKVGD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 93  -----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMG 146
                +P  Y+ E +E      G+ NLC  +       +  DGT         ++ +++ 
Sbjct: 91  AIEPGVPSRYSDETKE------GRYNLCPHMAFAATPPI--DGT---------LVKYYLS 133

Query: 147 CSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGT 206
              F    +V     V+ +E A ++    L  GV +      K A V+ G  V VFGAG 
Sbjct: 134 PEDF----LVKLPEGVSYEEGACVEP---LSVGVHSN-----KLAGVRFGTKVVVFGAGP 181

Query: 207 VGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT-------KDLNDGETIVS 259
           VGL     A++ GA+ +I VD+ D+K + + DFGAT+  N +       +DL DG   V 
Sbjct: 182 VGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQ 238

Query: 260 KLIDMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
           KL+    GG   D  F+C+G   V  DA     K  G  + +G+   G+  +  P   V+
Sbjct: 239 KLL----GGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVS 290

Query: 318 GRVWK-----GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG--LTDLH 370
           G+  K       +FG  +   +  NL++    GK+ V   +TH   F +          H
Sbjct: 291 GKEMKLIGCFRYSFGDYR---DAVNLVA---TGKVNVKPLITHKFKFEDAAKAYDYNIAH 344

Query: 371 HGDCLRTVL 379
            G+ ++T++
Sbjct: 345 GGEVVKTII 353

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 122/263 (46%), Gaps = 32/263 (12%)

Query: 10  QCKAAIAYTAGN-PLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSI 67
           + +  + +T  N  LK   I V  PK++E+ I + ++ +CHTD +   G  P  +  P +
Sbjct: 37  KVQKGVVFTEHNGELKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLV 96

Query: 68  LGHEGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLM 126
            GHEG+G+V  +G  V   K+GD   I      C  C+ C +G    C     +   G  
Sbjct: 97  GGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHADLS---GYT 153

Query: 127 PDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGA 186
            DG                   +F +Y     V    I E + L ++  + C   T Y  
Sbjct: 154 HDG-------------------SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-K 193

Query: 187 AVKTADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFI 245
           A+KTA+++ G+ VA+ G AG +G   VQ A++ G  +++ +D  ++K+K     G   F+
Sbjct: 194 ALKTANLKPGEWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV 252

Query: 246 NPTKDLNDGETIVSKLIDMTDGG 268
           + TK     + IV+ + + T GG
Sbjct: 253 DFTKS----KDIVADIQNATKGG 271

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 120/260 (46%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y     L+ + I V  P  +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 11  KGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G+ V N KVGD+  I      C  C+ C  G  + C     +   G   DG
Sbjct: 71  EGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G  VA+ GA G +G   VQ A++ G  +++ +D  D+K K   + G   FI+ T
Sbjct: 168 SAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYFIDFT 226

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + I+ +++  T+GG
Sbjct: 227 K----CKDIIGEVVKATNGG 242

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 85.1 bits (209), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 119/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA +  T G  L+ + I V  P A+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G  V   K+GD   I      C  C+ C     + C     +   G   DG
Sbjct: 68  EGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I E   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G+ VA+ G AG +G   VQ A++ G  ++I +D  D+K++     G   F+   
Sbjct: 165 SANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV--- 220

Query: 249 KDLNDGETIVSKLIDMTDGG 268
            D    + +V++++++T GG
Sbjct: 221 -DFRKSKDVVAEILEVTGGG 239

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 111/369 (30%), Positives = 168/369 (45%), Gaps = 71/369 (19%)

Query: 36  HEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTNVKVGDHV 92
           H V++ I  T +C +D  Y  SG   + I   P +LGHE SG V  VG  VT VKVGD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 93  -----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMG 146
                +P  Y+ E +E      G  NLC  +       +  DGT         ++ +++ 
Sbjct: 91  AIEPGVPSRYSDETKE------GSYNLCPHMAFAATPPI--DGT---------LVKYYLS 133

Query: 147 CSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGT 206
              F    +V     V+ +E A ++    L  GV +      K A V+ G  V VFGAG 
Sbjct: 134 PEDF----LVKLPEGVSYEEGACVEP---LSVGVHSN-----KLAGVRFGTKVVVFGAGP 181

Query: 207 VGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT-------KDLNDGETIVS 259
           VGL     A++ GA+ +I VD+ D+K + + DFGAT+  N +       +DL DG   V 
Sbjct: 182 VGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQ 238

Query: 260 KLIDMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
           KL+    GG   D  F+C+G   V  DA     K  G  + +G+   G+  +  P   V+
Sbjct: 239 KLL----GGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVS 290

Query: 318 GRVWK-----GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG--LTDLH 370
           G+  K       +FG  +   +  NL++    GK+ V   +TH   F +          H
Sbjct: 291 GKEMKLIGCFRYSFGDYR---DAVNLVA---TGKVNVKPLITHKFKFEDAAKAYDYNIAH 344

Query: 371 HGDCLRTVL 379
            G+ ++T++
Sbjct: 345 GGEVVKTII 353

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 128/274 (46%), Gaps = 39/274 (14%)

Query: 36  HEVRIKITHTALCHTDA--YTLSGVDPEGIF----PSILGHEGSGIVESVGTGVTNVKVG 89
           H V++ I  T +C +D   YT   +   G F    P +LGHE SGIV  VG+ VTNVKVG
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGHESSGIVAEVGSAVTNVKVG 85

Query: 90  DHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGT-SRFKNSKGEVIYHFMGCS 148
           D V        +     +SG  NLC  +          DGT +++  +  + +Y      
Sbjct: 86  DRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGTLTKYYLAPEDFVYKMPDHL 143

Query: 149 TFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVG 208
           +F E  +   +SV                 GV      A K A  + G  V V GAG VG
Sbjct: 144 SFEEGALAEPMSV-----------------GVH-----ANKLAGTRFGSKVLVSGAGPVG 181

Query: 209 LSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGG 268
           L     A++ GA++++ VDI ++K + S  FGAT  ++ +   +D E  VS++  +  G 
Sbjct: 182 LLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSS---SDEERFVSEVSKVLGGD 238

Query: 269 LDH-TFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           L +   +C+G    +R  ++AC K  G  + +G+
Sbjct: 239 LPNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM 271

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 133/295 (45%), Gaps = 32/295 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L  + I V  PK +E+ I I ++ +CHTD +   G  P  +  P + GH
Sbjct: 33  KGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 92

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G  VTN ++GD   +    + C  C++C  G  + C     +   G   DG
Sbjct: 93  EGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLS---GYTHDG 149

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     +    I +   L +V  + C   T Y  A+K
Sbjct: 150 -------------------SFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY-KALK 189

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           T+  + G  VA+ G AG +G   VQ A + G  +++ +D  + K++     G   F++ T
Sbjct: 190 TSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVFVDFT 248

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           K     + +VS + + T+GG     + + +   ++ + E   +  G  +++G+ A
Sbjct: 249 KT----KDMVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPA 298

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 132/298 (44%), Gaps = 32/298 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y +   L+ + I V  PKA+E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V    +GD   I      C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +   + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++  G  VA+ G AG +G   VQ A++ G  +++ +D  + K++     G   FI+ T
Sbjct: 165 SANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
            +    + IV  +I  TDGG     + + +   +  +   C    G ++++G+ A  +
Sbjct: 224 TE----KDIVGAVIKATDGGAHGIINVSVSEAAIEASTRYCRAN-GTTVLVGMPAGAK 276

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 37/306 (12%)

Query: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSG--- 57
           +S TA  T Q KA + Y  G  LK   I V  PK +E+ + I ++ +CHTD +   G   
Sbjct: 23  LSSTAIPTTQ-KAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWA 81

Query: 58  VDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGS 116
           + P+   P + GHEG+G+V + G  VTN ++GD+  +      C EC+FC          
Sbjct: 82  IKPK--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFC---------- 129

Query: 117 VRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLL 176
                 KG  P       N +   +  +    TF +Y     +    I     L KV  +
Sbjct: 130 -----QKGFEP-------NCETPTLSGYTHDGTFQQYATADAIHAAHIPPGTDLAKVAPI 177

Query: 177 GCGVTTGYGAAVKTADVQKGDTVAV-FGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKW 235
            C   T Y  A+KTA +  G  VA+    G +G   VQ A + G  +++ +D  ++K+  
Sbjct: 178 LCAGITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEAL 235

Query: 236 SFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQ 295
               G   F+    D +  + IVS + + T GG     + + +T  +  ++E   +  G 
Sbjct: 236 FRSLGGETFV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGT 290

Query: 296 SIIIGV 301
            +++G+
Sbjct: 291 VVLVGL 296

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 123/270 (45%), Gaps = 31/270 (11%)

Query: 2   SITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPE 61
           S ++G  +  KA I Y  G+ L  + I V  PK +E+ + + ++ +CHTD +   G  P 
Sbjct: 25  STSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPL 84

Query: 62  GI-FPSILGHEGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRA 119
               P + GHEG+GIV + G+ VTN ++GD+  +      C  C++C +G  + C     
Sbjct: 85  ATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADL 144

Query: 120 TQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCG 179
           +   G   DG                   +F +Y     V    I +   L +V  + C 
Sbjct: 145 S---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCA 182

Query: 180 VTTGYGAAVKTADVQKGDTVAV-FGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFD 238
             T Y  A+KTA++  G  VA+    G +G   VQ A++ G  +++ +D    K      
Sbjct: 183 GVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKK 240

Query: 239 FGATDFINPTKDLNDGETIVSKLIDMTDGG 268
            G   FI+ TK     + IV+ + + T+GG
Sbjct: 241 LGGEVFIDFTKS----KDIVADIQEATNGG 266

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 104/226 (46%), Gaps = 27/226 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA +  + G  L+ + I V  P + E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   KVGD   I      C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKK 234
           +AD++ G  VA+ GA G +G   VQ A++ G  +++ +D  DDK+K
Sbjct: 165 SADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 103/381 (27%), Positives = 171/381 (44%), Gaps = 62/381 (16%)

Query: 21  NPLKIETITVDPPK---AHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSG 74
            P KI    V+ PK   A++V ++I  T +C +D  Y   G     +   P +LGHE SG
Sbjct: 14  QPGKIVLTNVNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLGHESSG 73

Query: 75  IVESVGTGVTNVKVGDHV-----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPD 128
           +V  +G  V  +KVGD V      P  +++E +E      G+ NL   ++         D
Sbjct: 74  VVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKE------GRYNLDPDLKFAATPPY--D 125

Query: 129 GT-SRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAA 187
           GT +++  +  + +Y      +F E  ++  +SV                         A
Sbjct: 126 GTLTKYYRAPKDFVYKIPDHVSFEEGALMEPLSVAV----------------------HA 163

Query: 188 VKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINP 247
            + A ++ G    VFGAG VGL   + A   GA+ ++ VD+++ K + +  FGAT  +N 
Sbjct: 164 NRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN- 222

Query: 248 TKDLNDG---ETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           + DL  G   ET++ K I     G D  F+C+G    +R  +E C  G G  + +G+   
Sbjct: 223 SGDLPQGVSAETVIRKAIGKK--GADVVFECSGAQPCIRTGIEVCKAG-GTYVQVGM--- 276

Query: 305 GQEISTRPFQLVTGR--VWKGSAFGGIKG-RSEMGNLISDYFAGKLKVDEFVTHTRPFSE 361
           GQE    P   +  +   ++GS F   +G  S+   L+S   +GKL +   +T    F E
Sbjct: 277 GQEEIQFPISKIPAKEITFQGS-FRYCQGDYSDSIELVS---SGKLSLKPLITRRYQFKE 332

Query: 362 INDGLTDL--HHGDCLRTVLN 380
             +   +   H  D ++T++ 
Sbjct: 333 AIEAFDENRDHPLDNVKTIIE 353

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 107/239 (44%), Gaps = 39/239 (16%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE SGI+  VG  VT VKVGDHV+    + C              + C+ C  G
Sbjct: 67  LPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             NLC       G G++  G                    F+E  VV++  ++ + ++ P
Sbjct: 127 SENLCAH-SGFVGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+     T +  AVK +  +KG +  V GAG +GL  +   +  GA KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
           + + K +       F NP +  +    ++  L +  D G D+++DC+G       +L+A
Sbjct: 224 ERRLKMAKSLDVEVF-NPAQHGHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 108/239 (45%), Gaps = 39/239 (16%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE SGIV  VG  VT VKVGDHV+    + C              + C+ C  G
Sbjct: 67  LPLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             NLC +     G G++  G                    F+E   V++  ++ + ++ P
Sbjct: 127 SENLC-THGGFIGLGVISGG--------------------FAEQVAVSEHHIIPVPKEIP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+     T +  AVK +  +KG +  V GAG +GL  +   +  GA KI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
           + + + + + G   F NP+K       ++  L    D G D+++DC+G       +L+A
Sbjct: 224 ERRIEMAKNLGVEVF-NPSKHGQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 83.2 bits (204), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 114/260 (43%), Gaps = 28/260 (10%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y  G  L  + I V  PK +E+ + + ++ +CHTD +   G  P  +  P + GH
Sbjct: 31  KGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLSVKLPLVGGH 90

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V + G+ V N ++GD   I      C  C+ C SG  + C     +   G   DG
Sbjct: 91  EGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG 147

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I E   L +V  + C   T Y  A+K
Sbjct: 148 -------------------SFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITVY-KALK 187

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
            A +  G  V + G AG +G   VQ  ++ G  ++I +D    K++     G   FI+ T
Sbjct: 188 EASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVFIDFT 246

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K   D + +V+ +   T+GG
Sbjct: 247 KQKTDSD-MVAAIQKATNGG 265

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 83.2 bits (204), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 116/278 (41%), Gaps = 56/278 (20%)

Query: 37  EVRIKITHTALCHTDAYTLS----------GVDPEG--IFPSILGHEGSGIVESVGTGVT 84
           EV I+++   +C TD +  S          G  P      P  +GHE SGIV  +G+ VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 85  NVKVGDHVIPLYTAECQE--------------CKFCISGKTNLCGSVRATQGKGLMPDGT 130
            VKVGDHV+      C +              C  C  G  N+C     T   GL   GT
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT---GL---GT 141

Query: 131 SRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKT 190
           S                  F+E   V+    + I +  PLD   L+     T + A  K 
Sbjct: 142 SG---------------GGFAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 191 ADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKD 250
           A  QKG T  V GAG +GL+ +   +  GASKI+V ++   ++  +   G   F NP + 
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPAEH 243

Query: 251 LNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDAL 286
               +  +++L  + +G  G D  FDC+G       AL
Sbjct: 244 ----KDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 114/266 (42%), Gaps = 39/266 (14%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE +GIV  VG+GVT  KVGDHV    T  C              ++C  C  G
Sbjct: 67  LPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N+C  +      GL+ +G      S G           F+E  V+ +     +    P
Sbjct: 127 MYNVCSHL------GLIGNGV----QSGG-----------FAERVVINESHCYKLPNHIP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           ++ V L+     + +  AV+ +  + G +V + G G +GLS +      G ++I+V +  
Sbjct: 166 MEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEAC 289
             ++  +   GA  + +P +   +      + +     G D+ FDC+G    +R ++E C
Sbjct: 224 KIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-C 281

Query: 290 HKGWGQSIIIGVAAAGQEISTRPFQL 315
               G ++ + + A G+ I   P  +
Sbjct: 282 LTFRGTAVNVAMWATGKPIDFFPMDI 307

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 135/316 (42%), Gaps = 76/316 (24%)

Query: 14  AIAYTAGNPLKIETITVDPP--KAHEVRIKITHTALCHTDAY----------------TL 55
           A+AY     +   +   +P      EV I++++  +C TD +                 L
Sbjct: 3   AVAYYKKGDIHFSSTLPEPKINSPDEVLIEVSYCGICGTDLHEYTDGPIFFPKDGETNPL 62

Query: 56  SGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE------------- 102
           S +      P  +GHE SG V+++G+ VT V+VGD V+      C++             
Sbjct: 63  SNIP----LPQPMGHEFSGFVKAIGSNVTKVEVGDKVVVEAGCGCKDVHRWPDSKLYEKR 118

Query: 103 ----CKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCS----TFSEYT 154
               C  C +G  N C +                         Y F G       F+E  
Sbjct: 119 KDTFCSACENGIDNCCEN-------------------------YDFTGLGVVGGAFAERV 153

Query: 155 VVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQG 214
           VV +  +V + E+ P D V  L   ++  +  AV+ +  +KG +  + GAG +GL+ +  
Sbjct: 154 VVGERHIVKLPEEVPTD-VGALVEPISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILA 211

Query: 215 AQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHT 272
            ++ GASKI+V ++ + ++  +   G   F +P+K    G+  V++L ++  G  G D+ 
Sbjct: 212 LKAHGASKIVVSELAERRRILASKMGVEVF-DPSK---HGDNAVTELRNIPRGQHGFDYA 267

Query: 273 FDCTGNTKVMRDALEA 288
           FDC+G       AL+A
Sbjct: 268 FDCSGVKATFNTALKA 283

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 132/298 (44%), Gaps = 38/298 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           K  I Y +   L+ + I V  PKA+E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V    +GD   I      C  C++C  G  + C     +   G   DG
Sbjct: 68  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG 124

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    +     L +V  + C   T Y  A+K
Sbjct: 125 -------------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++  G  VA+ G AG +G   VQ A++ G  ++I +D  + K++     G   F++ T
Sbjct: 165 SANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFVDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAA 303
           K+    + IV  ++  T+GG         N  V   A+EA     +  G ++++G+ A
Sbjct: 224 KE----KDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPA 273

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 122/268 (45%), Gaps = 40/268 (14%)

Query: 36  HEVRIKITHTALCHTDA--YTLSGVDPEGIF----PSILGHEGSGIVESVGTGVTNVKVG 89
           H V+++I  T +C +D   Y    +   G F    P +LGHE SGI+  VG+ V  +KVG
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSI---GDFVVKSPMVLGHESSGIIAEVGSAVKTLKVG 87

Query: 90  DHVI--PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGT-SRFKNSKGEVIYHFMG 146
           D V   P Y +   E    +SG  NLC  +          DGT +++  +  + +Y    
Sbjct: 88  DRVALEPGYPSRYTEA--TMSGHYNLCPFMHFAATPPC--DGTLTKYYLTPFDFVYKLPD 143

Query: 147 CSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGT 206
             ++ E  ++  +SV                 GV      A K A  + GD V VFGAG 
Sbjct: 144 NVSYEEGALLEPLSV-----------------GVH-----ANKQAGTRFGDKVVVFGAGP 181

Query: 207 VGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTD 266
           VGL     A+  GA +++ +D+ D+K + +  FGAT  IN +K   + E  ++  I    
Sbjct: 182 VGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKL 241

Query: 267 GGLDH--TFDCTGNTKVMRDALEACHKG 292
           GG+D     +CTG    +R  + A   G
Sbjct: 242 GGVDPDIVLECTGAEPCIRAGIRALKTG 269

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 105/370 (28%), Positives = 165/370 (44%), Gaps = 60/370 (16%)

Query: 28  ITVDPPKAHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVT 84
           I  DP   H V+I I  T +C +D  Y  SG   + I   P +LGHE SG V  VG+ VT
Sbjct: 26  IIEDP---HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGSAVT 82

Query: 85  NVKVGDHV-----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKG 138
            VKVGD V     +P  Y+ E +E      G+ NLC  +       +  DGT        
Sbjct: 83  RVKVGDRVAIEPGVPSRYSDETKE------GRYNLCPHMAFAATPPI--DGT-------- 126

Query: 139 EVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDT 198
            ++ +++    F    +V     V+ +E A ++    L  GV +      K A V+ G  
Sbjct: 127 -LVKYYLSPEDF----LVKLPEGVSYEEGACVEP---LSVGVHSN-----KLAGVRFGSR 173

Query: 199 VAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
           V VFGAG VGL     A++ GAS ++ +D+ D+K   + +FGAT   N +K   D    +
Sbjct: 174 VVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQEL 233

Query: 259 SKLIDMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
           +  ++    G   D  F+C+G    + DA     K  G  + IG+   G+  +  P   V
Sbjct: 234 ADEVEKLLSGHHADIVFECSGADACI-DAGVKITKVGGTMVQIGM---GKNYTNFPIAEV 289

Query: 317 TGRVWK-----GSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDG--LTDL 369
           +G+  K       +FG  +      + +    +GK+ V   +TH   F +          
Sbjct: 290 SGKEMKLIGCFRYSFGDYR------DAVKLVASGKVNVKAMITHRFKFEDAAKAYDFNIA 343

Query: 370 HHGDCLRTVL 379
           H G+ ++T++
Sbjct: 344 HGGEVVKTII 353

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 120/280 (42%), Gaps = 35/280 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           KA I Y  G PL+ + I V  P A E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V ++G  V   K+GD+  I      C  C+ C     + C     +   G   DG
Sbjct: 71  EGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNCPEADLS---GYTHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L +V  + C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A++  GD VA+ GA G +G   +Q A + G  +++ +D   +K +     G   FI   
Sbjct: 168 SANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVFI--- 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
            D    + +  ++I  T+GG         N  V   A+E+
Sbjct: 224 -DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIES 258

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 141/299 (47%), Gaps = 46/299 (15%)

Query: 33  PKAHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTNVKVG 89
           P  H V++ I  T +C +D  Y  SG   + +   P +LGHE SG V  VG+ V ++KVG
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIKVG 86

Query: 90  DHV-----IP-LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYH 143
           D V     +P  Y+ E ++      G+ NLC  +       +  DGT         ++ +
Sbjct: 87  DRVAIEPGVPDRYSDETKQ------GRYNLCPDMAFAATPPI--DGT---------LVKY 129

Query: 144 FMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFG 203
           ++  + F    +V     V+ +E A ++    L  GV      A K A V  G  V VFG
Sbjct: 130 YVSPADF----LVKLPDHVSFEEGACIEP---LSVGVH-----ANKLAKVHFGSVVVVFG 177

Query: 204 AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGE-TIVSKLI 262
           AG VGL     A++ GAS++I VD+ D+K + +  FGAT  IN +K L  GE   VS  +
Sbjct: 178 AGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTIN-SKSLPRGEGDAVSAAV 236

Query: 263 DMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGR 319
               GG   D  F+C+G    +   + +   G G  + IG+   G+     P   V+G+
Sbjct: 237 SNYLGGALADVVFECSGAEPCINSGVLSTKNG-GTMVQIGM---GKNYINFPLAEVSGK 291

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 117/260 (45%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSG-VDPEGIFPSILGH 70
           KA I    G  L+ + I V  PK++E+ I + ++ +CH+D +   G +      P + GH
Sbjct: 11  KAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPLVGGH 70

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   K+GD+  I      C  C+FC       C     T   G + DG
Sbjct: 71  EGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVHDG 127

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I +   L  +  L C   T Y  A+K
Sbjct: 128 -------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALK 167

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G  VA+ GA G +G   +Q A + G  +++ +D  ++K K+    G   FI   
Sbjct: 168 SANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVFI--- 223

Query: 249 KDLNDGETIVSKLIDMTDGG 268
            D    + +V+ +I  TDGG
Sbjct: 224 -DYKKSKDVVADVIKATDGG 242

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 107/241 (44%), Gaps = 43/241 (17%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE SGI+  VG  VT VKVGDHV+    + C              + C  C  G
Sbjct: 67  LPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             NLC       G G++  G                    F+E  VV++  ++ + ++ P
Sbjct: 127 CENLCTHA-GFIGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+     T +  AV+ +  +KG +  V GAG +GL  +   +  GA +I+V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDALE 287
           + + + +   G   F +P K    GE  V  L  +T    G D+++DC+G       +L+
Sbjct: 224 ERRMELARRLGVEIF-DPRK---HGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLK 279

Query: 288 A 288
           A
Sbjct: 280 A 280

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 124/280 (44%), Gaps = 35/280 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           K  I Y     L+ + + V  PK  E+ I + ++ +CHTD +   G  P +   P + GH
Sbjct: 13  KGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGH 72

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   K+GD   I      C  C+ C     + C     +   G   DG
Sbjct: 73  EGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNCPEADLS---GYTHDG 129

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I + A + +V  + C   T Y  A+K
Sbjct: 130 -------------------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY-KALK 169

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ GD VA+ G AG +G   VQ A++ G  +++ +D  D+K+K+    G   F+   
Sbjct: 170 SAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVFV--- 225

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
            D    + IV  + + T+GG      C  N  V   A+EA
Sbjct: 226 -DFMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 121/280 (43%), Gaps = 35/280 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI-FPSILGH 70
           K  I Y    PL+ + I V  P  +E+ I + ++ +CHTD +   G  P  +  P + GH
Sbjct: 10  KGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGH 69

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V   KVGD+  I      C  C+ C     + C     +   G   DG
Sbjct: 70  EGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNCPEADLS---GYTHDG 126

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I   A L  +  + C   T Y  A+K
Sbjct: 127 -------------------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIK 166

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ GD +A+ GA G +G   +Q  ++ G  +I+ +D   +K++     G   FI   
Sbjct: 167 SANLKAGDWLAISGACGGLGSLAIQYGKAMG-FRILGIDGGAEKEELFKKLGGEYFI--- 222

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
            D    + I++++   T+GG         N  V   A+EA
Sbjct: 223 -DFTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEA 257

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 121/261 (46%), Gaps = 32/261 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA +  T G  L+ + I V  P+ +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 10  KAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 69

Query: 71  EGSGIVESVGTGV-TNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPD 128
           EG+GIV + G+ V    ++GD   I      C  C++C     + C     +   G   D
Sbjct: 70  EGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADLS---GYTHD 126

Query: 129 GTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAV 188
           G                   +F +Y     V    + +   L +V  + C   T Y  A+
Sbjct: 127 G-------------------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KAL 166

Query: 189 KTADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINP 247
           K+A+++ G+ VA+ GA G +G   VQ A++ G  +++ +D  D+K K     G   FI+ 
Sbjct: 167 KSANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFIDF 225

Query: 248 TKDLNDGETIVSKLIDMTDGG 268
           TK     + +++++I  TDGG
Sbjct: 226 TKS----KDVIAEVIKATDGG 242

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 111/252 (44%), Gaps = 31/252 (12%)

Query: 20  GNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGHEGSGIVES 78
           G PL+   I V  PK  E+ I + ++ +CHTD +   G  P     P + GHEG+G+V +
Sbjct: 53  GGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 112

Query: 79  VGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSK 137
           +G  V   +VGD   I      C  C+ C  G  + C     +   G   DG        
Sbjct: 113 MGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNCPEADLS---GYTHDG-------- 161

Query: 138 GEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGD 197
                      +F +Y     V    I     L +V  + C   T Y  A+K+A+++ G+
Sbjct: 162 -----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGN 209

Query: 198 TVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGET 256
            VA+ GA G +G   +Q A++ G  +++ +D  D+K+      G   F+    D    + 
Sbjct: 210 WVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV----DFRKSKD 264

Query: 257 IVSKLIDMTDGG 268
           +V+ ++  T GG
Sbjct: 265 VVADVVKATGGG 276

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 103/242 (42%), Gaps = 44/242 (18%)

Query: 64  FPSILGHEGSGIVESVGTGVT-NVKVGDHVIPLYTAECQE--------------CKFCIS 108
            P  +GHE SGIV  VG GV  + KVGDHV+   T  C +              C  C  
Sbjct: 67  LPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACKR 126

Query: 109 GKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKA 168
           G  N C  +      GL   G                    FSE  V+++  V+ I ++ 
Sbjct: 127 GIYNCCTHLGFC---GLGAHG------------------GGFSEKVVISEQHVIKIPKEI 165

Query: 169 PLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDI 228
           PLD   L+     + +  AVK ++++ G +  V GAG +GL+ +   Q  GA KI+V + 
Sbjct: 166 PLDIAALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEP 223

Query: 229 NDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDAL 286
              +++ +   G   F NP      GE  V +L  +  G  G D +FDC+G        L
Sbjct: 224 AQIRREQAAKLGVETF-NP---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGL 279

Query: 287 EA 288
            A
Sbjct: 280 HA 281

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 128/298 (42%), Gaps = 38/298 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA I      PL+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 8   KAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGH 67

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G V ++G+ V N K+GD   I      C  C+ C     + C            PD 
Sbjct: 68  EGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDA 115

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                   G          +F +Y     V    I     L +V  + C   T Y  A+K
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALK 164

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G  VA+ G AG +G   VQ A++ G  +++ +D    K++     G   FI+ T
Sbjct: 165 SANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFIDFT 223

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHK---GWGQSIIIGVAA 303
           K+ +  E +    I  T+GG         N  V   A+ A  K     G S+++G+ A
Sbjct: 224 KEHDIAEAV----IKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGMPA 273

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 122/296 (41%), Gaps = 63/296 (21%)

Query: 23  LKIETITVDPPKAHEVRIKITHTALCHTD--AYTLSGV-------------DPEGIFPSI 67
           LK  TI  D     E+ I I+   +C TD   YT   +             +P    P  
Sbjct: 18  LKEPTIEAD----DELMIDISWCGICGTDLKEYTEGAIFFPNDGECHQISGEP---LPQA 70

Query: 68  LGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CKFCISGKTNL 113
           +GHE +G+V  VG GV   KVGDHV+   T  C++              C  C  G  N+
Sbjct: 71  MGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNI 130

Query: 114 CGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKV 173
           C  +    G G+   G                    F+E  V+ +     + +  PLD  
Sbjct: 131 CSKL-GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLPLDIA 169

Query: 174 CLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKK 233
            L+       +  A++  + +KG +  V G+G +GL ++      G + I+V +    ++
Sbjct: 170 ALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRR 227

Query: 234 KWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDALE 287
            ++ + GAT F +P+  L   E  +  L  +  G  G D+TFDC+GN      ++E
Sbjct: 228 DFAKELGATVF-DPS-SLPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 159/353 (45%), Gaps = 37/353 (10%)

Query: 35  AHEVRIKITHTALCHTDA-YTLSGVDPEGIF--PSILGHEGSGIVESVGTGVTNVKVGDH 91
           +H V+I +  T +C +D  Y   G   E +   P +LGHE SG+V  VG  VT V+VGD 
Sbjct: 29  SHYVKIHVKKTGICGSDIHYYTHGSIGEFVVKKPMVLGHESSGVVVEVGKDVTLVQVGDR 88

Query: 92  VIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFS 151
           V        +      SG  NLC  +          DGT         ++ +++    F 
Sbjct: 89  VAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY--DGT---------LVKYYLAPEDF- 136

Query: 152 EYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSV 211
              +V     V+ +E A  +    L  GV      A + A+   G  V VFGAG VGL  
Sbjct: 137 ---LVKLPDHVSFEEGACAEP---LAVGV-----HANRLAETSFGKNVVVFGAGPVGLVT 185

Query: 212 VQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDH 271
              A + GAS ++ VD+ ++K + S DFGAT+ IN TK  ++ E       ++     + 
Sbjct: 186 GAVAAAFGASAVVYVDVFENKLERSKDFGATNTINSTKYKSEDELTEVIKSELKGEQPEI 245

Query: 272 TFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWK--GSAFGGI 329
             DC+G    +R A++   K  G  + +G+   G++    P  ++  +  +  GS     
Sbjct: 246 AIDCSGAEICIRTAIKVL-KAGGSYVQVGM---GKDNINFPIAMIGAKELRVLGSFRYYF 301

Query: 330 KGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEINDGLT-DLHHG-DCLRTVLN 380
                   LIS+   GK+ V + +THT  F E  D    +L HG + ++T+++
Sbjct: 302 NDYKIAVKLISE---GKVNVKKMITHTFKFEEAIDAYNFNLEHGSEVVKTMID 351

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 127/298 (42%), Gaps = 38/298 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           K  +   +  PL+ + I V  PK +E+ I + ++ +CHTD +   G  P     P + GH
Sbjct: 39  KGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGH 98

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G V ++G+ V N KVGD   I      C  C+ C     + C     +   G   DG
Sbjct: 99  EGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNCPDADLS---GYTHDG 155

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L +V  + C   T Y  A+K
Sbjct: 156 -------------------SFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY-KALK 195

Query: 190 TADVQKGDTVAVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G  VA+ G AG +G   VQ A++ G  +++ +D    K++     G   FI   
Sbjct: 196 SANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVFI--- 251

Query: 249 KDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHK---GWGQSIIIGVAA 303
            D      IV  +++ T+GG         N  V   A+ A  K     G S+++G+ A
Sbjct: 252 -DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGMPA 304

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 94/362 (25%), Positives = 147/362 (40%), Gaps = 41/362 (11%)

Query: 2   SITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDA-YTLSG-VD 59
           S+     ++ K AI Y       IE    DP   H V++KI  T +C +D  Y L G + 
Sbjct: 4   SMQQAVVLREKGAIVYEHRPVPVIE----DP---HYVKVKIEKTGICGSDVHYYLHGSIG 56

Query: 60  PEGIF-PSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVR 118
           P  +  P +LGHE SG V  VG+ VT V++GD V        +  +   SG  NLC  +R
Sbjct: 57  PFVVRSPMVLGHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMR 116

Query: 119 ATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGC 178
                    DG                   T  +Y +  +  +V + +   L++  L  C
Sbjct: 117 FAATPPY--DG-------------------TLVKYYISPEDFLVKLPDSVSLEEGAL--C 153

Query: 179 GVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFD 238
                   A + A  Q    V VFGAG VGL     A++ GA+ + +VDI+  K   +  
Sbjct: 154 EPLAVAVHANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPA 213

Query: 239 FGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSII 298
            G T  ++ + D +  E + +KL       +D  FDC+G    +  A+  C  G      
Sbjct: 214 LGVTHPVD-SSDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTH--- 269

Query: 299 IGVAAAGQEISTRPFQLVTGRVWKGSAFGGIK-GRSEMGNLISDYFAGKLKVDEFVTHTR 357
           + V ++   +S   F L    V +    G  +    +    +    + ++     VTH  
Sbjct: 270 VQVGSSRDYVS---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRF 326

Query: 358 PF 359
           PF
Sbjct: 327 PF 328

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 128/307 (41%), Gaps = 58/307 (18%)

Query: 14  AIAYTAGNPLKIETITVDPPKAH---EVRIKITHTALCHTD--AYTLSGVD-PE------ 61
           A+AY     ++  T ++  P  H   +V I I+   +C TD   YT   +  PE      
Sbjct: 3   ALAYFGKGNVRF-TYSLKEPHIHAEDDVIIDISWCGICGTDLKEYTDGAIFFPEDGCVNH 61

Query: 62  ---GIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CK 104
                 P  +GHE SGI+ SVG G    K+GDHV+   TA C +              C+
Sbjct: 62  ISNNNLPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCE 121

Query: 105 FCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAI 164
            C +G  N+C  +  T G G+   G                    F+E  V+ +     I
Sbjct: 122 ACRNGMPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKI 160

Query: 165 DEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKII 224
               PLD   L+       +  AVK +  ++G +V + G G +GL  +   +  G   I+
Sbjct: 161 PHHMPLDVASLIQPISVCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIV 218

Query: 225 VVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVM 282
           V +    +++ +   GA  F      L++    +  L +M  G  G D+TFDC+G    +
Sbjct: 219 VSEPALIRRELAEKMGARVFDPSNMSLDNS---IKTLTEMAPGSQGFDYTFDCSGIPATL 275

Query: 283 RDALEAC 289
           + A+E C
Sbjct: 276 KVAIECC 282

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 116/260 (44%), Gaps = 31/260 (11%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           KA +    G  L+   I V   KA+E+ I + ++ +CH+D Y      P     P + GH
Sbjct: 21  KAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGH 80

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+G+V  +G+ V N K+GD   +    + C  C+ C  G    C     ++  G   +G
Sbjct: 81  EGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGFTRNG 137

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y  V  +    + +   L ++    C   T Y  A+K
Sbjct: 138 -------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIK 177

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           +A+++ G  +A+ GA G +G   +Q  ++ G  +++ +D  + K     + G   FI+ T
Sbjct: 178 SANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFIDFT 236

Query: 249 KDLNDGETIVSKLIDMTDGG 268
           K     + +V+ ++  T+GG
Sbjct: 237 KS----KDLVADVVSATNGG 252

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 107/240 (44%), Gaps = 40/240 (16%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE +G+V  +G GV   +VGDHV+   T+ C              + C  C  G
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N+C  +    G G+   G                    FSE  V+    V+ I +  P
Sbjct: 127 LYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+     + +  A++ + +  G +  V G G +GL  +   Q+ GASKI+V +  
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 230 DDKKKWSFDFGATDFINPTK-DLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEA 288
            ++++ +   GA  F +PT+ + ++    + K+    D G D++FDC+G     R ++ A
Sbjct: 224 KNRRELAKLMGAEVF-DPTEWEEHEAVEYLRKVAPGGD-GFDYSFDCSGLPVTFRASVHA 281

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 115/257 (44%), Gaps = 31/257 (12%)

Query: 12  KAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGH 70
           +A I       L++++I V  PKA+E+ I +  + +CH+D +   G  P +   P + GH
Sbjct: 14  RAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPLVGGH 73

Query: 71  EGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDG 129
           EG+GIV ++G  V   K+GD+  I    + C  C+ C       C     +   G   DG
Sbjct: 74  EGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYADIS---GFTRDG 130

Query: 130 TSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVK 189
                              +F +Y     V    I     L +V  + C   T +  A+K
Sbjct: 131 -------------------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF-KALK 170

Query: 190 TADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPT 248
           TA++  G+ VA+ GA G +G   +Q A++ G S ++ +D   +K+    D G   F+   
Sbjct: 171 TANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVFL--- 226

Query: 249 KDLNDGETIVSKLIDMT 265
            D +  E +V +++  T
Sbjct: 227 -DFSKSENLVPEVVSAT 242

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 123/303 (40%), Gaps = 54/303 (17%)

Query: 14  AIAYTAGNPLKIETITVDP--PKAHEVRIKITHTALCHTDAYTLSG-------------V 58
           A+AY   N +K      +P      E+ I ++   +C TD +                 +
Sbjct: 42  ALAYFGKNDIKFTNDLPEPTISAPDEMIIDVSWCGICGTDLHEFQDGPIFFPHDGCCHEI 101

Query: 59  DPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CK 104
             EG+ P  +GHE +G +   G GVT  KVGD V+   T  C++              C 
Sbjct: 102 SGEGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCA 160

Query: 105 FCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAI 164
            C  G  N+C ++    G G+   G                    F+E  V+ +     +
Sbjct: 161 ACKKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQCYKV 199

Query: 165 DEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKII 224
            +   +D   L+     + +  AV+ +  +KG +V + GAG +GL  +      G S+++
Sbjct: 200 PDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVV 257

Query: 225 VVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRD 284
           V +    ++ ++   GA  +    KD ++    +  +    D G D+ FDC+GN   ++ 
Sbjct: 258 VSEPAKIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGD-GFDYAFDCSGNPATLKA 316

Query: 285 ALE 287
           A+E
Sbjct: 317 AIE 319

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/346 (22%), Positives = 142/346 (41%), Gaps = 66/346 (19%)

Query: 14  AIAYTAGNPLKIETITVDPP--KAHEVRIKITHTALCHTDAYT----------------L 55
           A+AY A   +      V+P      E+ ++I +  +C TD +                 L
Sbjct: 3   ALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEYIDGPIFFPEDGETNEL 62

Query: 56  SGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE------------- 102
           SG       P  +GHE +G V  +G  VT  KVGDHV+      C++             
Sbjct: 63  SGSG----LPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKP 118

Query: 103 -CKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSV 161
            C  C  G  N+C ++      GL+ +G                GC   +E   + +   
Sbjct: 119 WCSACKKGHYNVCSNL------GLIGNGVQS------------GGC---AERMCINESHC 157

Query: 162 VAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGAS 221
             + +  P+D   L+     + +  A+K A  ++G +V V G G +GL  +   Q  G S
Sbjct: 158 FKVPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCS 215

Query: 222 KIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNT 279
            I+V +    +++ +   GAT + +P++  ++ E  +  L  M  G  G D+ FD +G  
Sbjct: 216 DIVVSEPAKVRRELAERMGATTY-DPSQ--HNTEKNIQNLRKMILGGDGFDYVFDNSGTP 272

Query: 280 KVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT-GRVWKGS 324
           + +  A+E C    G ++ + +    + +   P  +    +++ GS
Sbjct: 273 ETLETAIE-CLTVRGTAVNVAMWPPHKRVEFSPMAVTKEEKIYTGS 317

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 131/321 (40%), Gaps = 33/321 (10%)

Query: 12  KAAIAYTAGNPLKI-ETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILG 69
           K  I    G PL   E + V  P ++EV I + ++ +CHTD +T  G  P +   P + G
Sbjct: 30  KGVIFNKFGGPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGG 89

Query: 70  HEGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPD 128
           HEG+G+V + G  V   ++GD   +    + C  C+ C  G    C      +  G   D
Sbjct: 90  HEGAGVVVAKGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHD 146

Query: 129 GTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAV 188
           G                   TF +Y  +  +    +     L  V  + C   + Y  A+
Sbjct: 147 G-------------------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KAL 186

Query: 189 KTADVQKGDTVAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINP 247
           K  ++Q    VA+FGA G +G   VQ A++ G   + +    +++K+     G   F+  
Sbjct: 187 KNGNLQTNQWVAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFL-- 244

Query: 248 TKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQE 307
             D    + I + +   T GG     + T +       ++ C +  G  + +GV      
Sbjct: 245 --DYTQVDNIPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGL 301

Query: 308 ISTRPFQLVT-GRVWKGSAFG 327
           + T  F +V  G   KGSA G
Sbjct: 302 LKTDIFTIVQHGFSIKGSASG 322

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 127/304 (41%), Gaps = 52/304 (17%)

Query: 14  AIAYTAGNPLKIETITVDP--PKAHEVRIKITHTALCHTD--AYTLSGV--DPEGI---- 63
           A+AY   N ++  T   +P      E+ I +++  +C TD   YT   +   P+G     
Sbjct: 3   ALAYFGQNDVRFTTDLKEPVISADDELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEI 62

Query: 64  ----FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CKF 105
                P  +GHE SG+VE VG G    KVGDHV+   T  C++              C  
Sbjct: 63  SGNGLPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSA 122

Query: 106 CISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAID 165
           C  G TN+C  + A  G GL   G                    F+E  V+ +  V  I 
Sbjct: 123 CSIGMTNICAHL-ALCGAGLESGG--------------------FAERLVINEAHVHKIP 161

Query: 166 EKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIV 225
           +  PLD   L+       +  AVK A  +KG +  + G G +GL  +   +  G   I++
Sbjct: 162 DHMPLDIGALIQPISVCWH--AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVL 219

Query: 226 VDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDA 285
            +    +++++   GA  + +PT    D      + +     G D+TFDC+G    +  A
Sbjct: 220 SEPATIRREYAGKMGAKVY-DPTGVPFDESVKTLREMGPNGDGFDYTFDCSGLPITLNAA 278

Query: 286 LEAC 289
           +E C
Sbjct: 279 IECC 282

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 100/240 (41%), Gaps = 42/240 (17%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CKFCISG 109
            P  +GHE +G V  VG GV N+KVGD V+   T  C++              C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N+C S     G G+   G                    F+E  V+ +     + +  P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+       +  A++  + + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDALE 287
             +++ +   GA  + +PT   +  +  +  L  + DG  G D+TFDC+G    +  A++
Sbjct: 224 KVRRELAEKMGARVY-DPTA--HAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ 280

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 89/228 (39%), Gaps = 38/228 (16%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CKFCISG 109
            P  +GHE +G V  VG GVT  KVGD V+   T  C++              C  C  G
Sbjct: 67  LPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N+C S     G G+   G                    F+E  V+ +     + E  P
Sbjct: 127 LYNIC-SYLGLCGAGVQSGG--------------------FAERVVINESHCYKVPEFVP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+       +  A+   D + G T  + GAG +GL  +    + G S I V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTG 277
             +++ +   GA  F +PT           + +     G D+TFDC+G
Sbjct: 224 KVRRELAEKMGARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 103/243 (42%), Gaps = 43/243 (17%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE  G V+++G  VT V VGD V+      C              ++C  C  G
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVVEAGCGCKDVHRWPQSHVYGKEQCTACRKG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N C     T G G++                       F+E  VV +  VV + E+ P
Sbjct: 127 FDNCCTHAGFT-GLGVV--------------------GGAFAEQVVVGERHVVKLPEEVP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGD--TVAVFGAGTVGLSVVQGAQSRGASKIIVVD 227
            D   L+       +  AVK A  +KG      V GAG +GL+ +   ++ GASKI+V +
Sbjct: 166 TDVGALVEPLSVAWH--AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSE 223

Query: 228 INDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTD--GGLDHTFDCTGNTKVMRDA 285
           +   +++ +   G   F +P+K   D +  + KL ++ +   G D  FDC+G       A
Sbjct: 224 LAAIRRELALKMGVEVF-DPSKH-GDEKQGIKKLREIPEDHDGFDFAFDCSGVETTFNTA 281

Query: 286 LEA 288
           L +
Sbjct: 282 LHS 284

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 108/259 (41%), Gaps = 57/259 (22%)

Query: 23  LKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGHEGSGIVESVGT 81
           +K E   V      E+ IK  +T + + ++Y   G+ P E   P +LG E SG V + G 
Sbjct: 23  IKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEK--PYVLGREASGTVVAKGK 80

Query: 82  GVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVI 141
           GVTN +VGD V     A      F    K +  G V        +P GTS          
Sbjct: 81  GVTNFEVGDQV-----AYISNSTFAQYSKISSQGPVMK------LPKGTS---------- 119

Query: 142 YHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAV 201
                                  DE+  L    LL   V T      +   V+KGD V +
Sbjct: 120 -----------------------DEELKLYAAGLLQ--VLTALSFTNEAYHVKKGDYVLL 154

Query: 202 FGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSK 260
           F A G VGL + Q  + +GA  I V    D+K K + ++GA   IN +K     E I+ +
Sbjct: 155 FAAAGGVGLILNQLLKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASK-----EDILRQ 208

Query: 261 LIDMTDG-GLDHTFDCTGN 278
           ++  T+G G+D +FD  G 
Sbjct: 209 VLKFTNGKGVDASFDSVGK 227

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 104/232 (44%), Gaps = 23/232 (9%)

Query: 65  PSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKG 124
           P  +GHE SG V  VG  VT VKVGD V+   T  C +       K     +  A + + 
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 125 LMPDGTSRFKNSKGEVIYHFMGC----STFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180
              D    +          FMG       F+E  V  +  VV + +  P+D   L+   +
Sbjct: 128 ---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PL 175

Query: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240
           +  + AA + +    G +  V GAG +GL+++   +++GASKIIV +    +++ + D  
Sbjct: 176 SVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELA-DRM 233

Query: 241 ATDFINPTKDLNDGETIVSKLIDMT-DG-GLDHTFDCTGNTKVMRDALEACH 290
             +  +P+     G+  V+ L   T DG G D  FDC+G        L+A H
Sbjct: 234 HVETFDPS---THGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 100/240 (41%), Gaps = 42/240 (17%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CKFCISG 109
            P  +GHE +G V  VG GV ++KVGD V+   T  C++              C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N+C S     G G+   G                    F+E  V+ +     + +  P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+       +  A+   + + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDALE 287
             +++ +   GA  + +PT+  +  +  +  L  + +G  G D+TFDC+G    +  A++
Sbjct: 224 KLRRELAEKMGARVY-DPTE--HAAKESIDYLRSIAEGGDGFDYTFDCSGLEITLNAAIQ 280

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 99/240 (41%), Gaps = 42/240 (17%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE--------------CKFCISG 109
            P  +GHE +G V  VG GV ++KVGD V+   T  C++              C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N+C S     G G+   G                    F+E  V+ +     + +  P
Sbjct: 127 YYNIC-SYLGLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+       +  A+   + + G T  + GAG +GL  +    + G   I+V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDALE 287
             +++ +   GA  + +PT+  +     +  L  + +G  G D+TFDC+G    +  A++
Sbjct: 224 KLRRELAEKMGARVY-DPTE--HAARESIDYLRSVAEGGDGFDYTFDCSGLEVTLNAAIQ 280

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 94/373 (25%), Positives = 149/373 (39%), Gaps = 67/373 (17%)

Query: 28  ITVDPPKA---HEVRIKITHTALCHTDAYTLS---GVDPEGIFPS-------ILGHEGSG 74
           +T   PKA   H+V I++    +C ++ + L    G  P     S       ++GHE  G
Sbjct: 23  LTSFEPKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVG 82

Query: 75  IVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRF 133
            V +VG  V+   VGD V +    + C +C  C SG    C +  +T  K   PDG    
Sbjct: 83  KVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCKP-YPDGYV-- 139

Query: 134 KNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADV 193
             S+G    H      F             I  + P + V  L CG  T +    +    
Sbjct: 140 --SQGGYASHVRAHEQF----------CFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQG 187

Query: 194 QKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLND 253
           +    VAV G G +G   +  A++ GA ++        K+  +   GA  F+  T D + 
Sbjct: 188 KHDPKVAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVA-TGDAD- 244

Query: 254 GETIVSKLIDMTDGGLDHTFD----CTGNTKVM-RDALEACHKGWGQSIIIGVAAAGQEI 308
                       + GLD TFD    C  +T  +  +A+  C K     + +G+    +E+
Sbjct: 245 -----------WNAGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEEL 293

Query: 309 STRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE------- 361
           S +PF         GS+   +  RSE   L+      +L V+    + RP+ E       
Sbjct: 294 SVKPFSFFKNGCNIGSS--KLGSRSEAIELM------QLAVEH---NFRPWVETIKVSEA 342

Query: 362 -INDGLTDLHHGD 373
            +++GLT L+ GD
Sbjct: 343 GVSEGLTRLNKGD 355

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 115/280 (41%), Gaps = 45/280 (16%)

Query: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECKFCISG 109
            P  +GHE SGIV  VG  VT VK GD V+   ++ C              ++C  C  G
Sbjct: 67  LPLAMGHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARG 126

Query: 110 KTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAP 169
             N C     T G G +  G                    F+E  +V +  +V I ++ P
Sbjct: 127 YDNCCAYAGFT-GLGFIGGG--------------------FAEQILVGEQHIVRIPDEIP 165

Query: 170 LDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDIN 229
           LD   L+     T + A  K     KG T  + G+G +GL+++   ++ GASKI+V ++ 
Sbjct: 166 LDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVA 223

Query: 230 DDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEAC 289
             ++K +       F       N    +  +L+     G D  FDC+G    M  A+   
Sbjct: 224 QVRRKLAEKMKVEVFDPSVHGKNTSNEL--RLLTENKDGFDFAFDCSGLEVTMNTAI--- 278

Query: 290 HKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGI 329
           H    +  I+ VA  G   ST  F ++   + + +  G I
Sbjct: 279 HATKCRGTIVNVAVWG---STMEFNMMDITLQEKTLIGSI 315

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 83/350 (23%), Positives = 139/350 (39%), Gaps = 80/350 (22%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPL 95
           +E+ IK  +  +   +AY   G+ P  + P ILG E +G+V + G  V N  +GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPVQL-PQILGREATGVVVAKGQSVKNFDIGDKV--- 92

Query: 96  YTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTV 155
                                                           +M  STF++YT 
Sbjct: 93  -----------------------------------------------AYMSSSTFAQYTK 105

Query: 156 VADVSVVA-IDEKAPLDKVCLLGCGVTTGYGAAV---KTADVQKGDTVAVFGA-GTVGLS 210
            +   +++ +  +   D++ +    +  G  A     +   V++GD + ++ A G VGL 
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGDYILLYAAAGGVGLL 165

Query: 211 VVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMT-DGGL 269
           + Q  + RGA  I VV   ++K++ +  FGA   IN +K     E I+ + +++T D G+
Sbjct: 166 MDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK-----EDILKRALEITNDKGV 219

Query: 270 DHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV-----TGRVWKGS 324
           D  FD  G  K   D      K  G  +  G A+        PF L        R+ + +
Sbjct: 220 DAVFDSVG--KDTFDISLNALKLKGSFVSFGNASG----PVPPFALSRLSSKNIRLMRPT 273

Query: 325 AFGGIKGRSEMGNLISDYF----AGKLKVDEFVTHTRPFSEINDGLTDLH 370
            FG +    +  +     F    +GKLK+   +T T P SE      +L 
Sbjct: 274 LFGYLAEPEDWDHYSKKLFELIDSGKLKIA--ITKTYPLSEYKIATQELE 321

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 131/309 (42%), Gaps = 29/309 (9%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTN-VKVGDHV-I 93
            ++ +KI    +C +D +  SG   +   P I+GHE  G V  VG   T+ VKVGD V +
Sbjct: 34  RDIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGL 93

Query: 94  PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY 153
                 C +CK C++G  + C +   T         ++ +++        ++    +++Y
Sbjct: 94  GAQALSCMKCKRCLNGNESYCPNAIQTY--------STPYEDG-------YVSKGGYADY 138

Query: 154 TVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQ 213
             V +   V I E  P      L CG  T +   ++      G  VA+ G G +G   V 
Sbjct: 139 VRVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVL 197

Query: 214 GAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTF 273
            A++ GA ++  +     KK+ +   GA  FI  TK+  D      K  D     LD   
Sbjct: 198 LAKAMGA-EVYAISRTSSKKEDAMKLGADHFIA-TKEEPDWH---EKYFDE----LDLVV 248

Query: 274 DCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR 332
            C G+ T +  + L       G+ + I +    + +  +PF LV G     S  G ++  
Sbjct: 249 VCAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSMEEL 307

Query: 333 SEMGNLISD 341
            ++  L+S+
Sbjct: 308 KQLLKLVSE 316

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 133/334 (39%), Gaps = 84/334 (25%)

Query: 37  EVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLY 96
           EV IK  +T + + ++Y   G+ P  + P +LG E  G V ++G  V ++KVGD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYPAEL-PYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 97  TAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVV 156
                                                          ++  +TF+++T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 157 ADVS-VVAIDEKAPLDKVCLLGCGVTTGYGAAV---KTADVQKGDTVAVFGA-GTVGLSV 211
            + + V  + +    +++ L   G+  G  A     +  DV+KGD V ++ A G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 212 VQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG-GLD 270
            Q  + RGA  I V   N +K   + + GA   IN  +D      I+ K+  +T G G+D
Sbjct: 166 NQLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVD 219

Query: 271 HTFDCTGNTKVMRDALE---ACHKGWGQSIIIGVAAAGQEISTRPFQLV-----TGRVWK 322
             FD  G     +D  E   +C K  G  +  G A+        PF L        R+ +
Sbjct: 220 VAFDSVG-----KDTFETTLSCLKRKGTFVSYGNASG----PVPPFPLSRLSPKNIRLLR 270

Query: 323 GSAFGGIKGRSEMGN----LISDYFAGKLKVDEF 352
              FG +    E  +    LIS   +GKL +  F
Sbjct: 271 PQLFGYVAQADEFRHYTEELISLIDSGKLNIKLF 304

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 122/303 (40%), Gaps = 54/303 (17%)

Query: 14  AIAYTAGNPLKIETITVDPP--KAHEVRIKITHTALCHTDAYTLSG-------------V 58
           A+AY   N +K      +P      E+ I I+   +C TD +                 +
Sbjct: 3   ALAYFGKNDIKFTNDLPEPKITAPDELIIDISWCGICGTDLHEFQDGPIFFPENGCCHEI 62

Query: 59  DPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAEC--------------QECK 104
             EG+ P  +GHE +GIV  +G  V   +VGD V+   T  C              +EC 
Sbjct: 63  SGEGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECA 121

Query: 105 FCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAI 164
            C  G  N+C ++    G G+   G                    F+E  V+ +     I
Sbjct: 122 ACKKGLYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAKCYKI 160

Query: 165 DEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKII 224
            E   +D   L+     + +  AV+ +  + G +V + G G +GL  +      G ++++
Sbjct: 161 PEHLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVV 218

Query: 225 VVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRD 284
           V +    ++  +   GA  +   T+D ++    +  +    D G D+TFDC+GN   ++ 
Sbjct: 219 VSEPAKIRRDLAEKMGAVVYDPMTRDHDESIKYLRSIAPGGD-GFDYTFDCSGNPATLKA 277

Query: 285 ALE 287
           A+E
Sbjct: 278 AIE 280

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 116/292 (39%), Gaps = 55/292 (18%)

Query: 14  AIAYTAGNPLKIETITVDP--PKAHEVRIKITHTALCHTDAYTLSGVDPEGIFP------ 65
           A+AY     ++  T   +P   K  +V I I    +C TD + L  +D    FP      
Sbjct: 3   ALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETH 60

Query: 66  --------SILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQE----------CKFCI 107
                     +GHE +G+V  VG+ VT  + GDHV+   T  CQ+          CK C 
Sbjct: 61  EISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACK 120

Query: 108 SGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEK 167
            G  N+C  +    G G+   G                    F+E  V+ +     +   
Sbjct: 121 RGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKVPSW 159

Query: 168 APLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVD 227
            PLD   L+       +  AVK   V++G +  + G G +GL ++   Q  G + I+V +
Sbjct: 160 IPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSE 217

Query: 228 INDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG--GLDHTFDCTG 277
               ++  +   GA   ++   D    E  +  L  ++    G D TFDC+G
Sbjct: 218 PAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 88/322 (27%), Positives = 137/322 (42%), Gaps = 29/322 (9%)

Query: 21  NPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVG 80
           NP K+E  + +    ++V +KI    +C +D +T SG   E   P ++GHE  G V  +G
Sbjct: 24  NPKKVEFESKNL-YDYDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIG 82

Query: 81  TGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGE 139
           +    +KVGD V I      C EC  C S     C     T  K    D T  + NSKG 
Sbjct: 83  SQCNELKVGDRVGIGAQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGY-NSKG- 136

Query: 140 VIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTV 199
                     +++Y  + +   V I E  P      L CG  T +   ++      G  V
Sbjct: 137 ---------GYADYIRLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKV 186

Query: 200 AVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVS 259
            + G G +G   +  A++ GA +   +  +  KK+ +   GA  FI  TK+  D  T   
Sbjct: 187 GIMGIGGIGHMGLIFAKAMGA-ETFAISRSSAKKEDAIKMGADHFI-ATKEEPDWAT--- 241

Query: 260 KLIDMTDGGLDHTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTG 318
           K  D      D    C+ + T +  + +    K  G+ + I V    + ++ +PF L+ G
Sbjct: 242 KYFDT----FDLIVVCSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-G 296

Query: 319 RVWKGSAFGGIKGRSEMGNLIS 340
                SA GGI    +M +L+S
Sbjct: 297 VSISNSALGGINEIKQMLDLVS 318

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 115/262 (43%), Gaps = 65/262 (24%)

Query: 23  LKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGHEGSGIVESVGT 81
           +K E   V      ++ IK  +T + + ++Y   G+ P E   P ILG E +G + + G 
Sbjct: 23  IKYEDYPVPSISGKDLLIKNKYTGVNYIESYFRKGLYPCEK--PYILGREAAGTIVAKGK 80

Query: 82  GVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVI 141
            VTN ++GD V                                                 
Sbjct: 81  DVTNFEIGDKV------------------------------------------------- 91

Query: 142 YHFMGCSTFSEYT-VVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTAD---VQKGD 197
             ++  STF++YT   ++ +V+ + ++   +++ L   G+     A   T +   V+KGD
Sbjct: 92  -AYISNSTFAQYTKFPSEGTVMKLSKETNDEELKLYAAGLLQALTALSFTNEAYHVRKGD 150

Query: 198 TVAVF-GAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGET 256
            + +F  AG VGL + Q  + +GA  I V    D+K + + ++GA   IN +K     E 
Sbjct: 151 YILLFAAAGGVGLILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK-----ED 204

Query: 257 IVSKLIDMTDG-GLDHTFDCTG 277
           I+ K++++T+G G+D +FD  G
Sbjct: 205 ILKKVLEITNGEGVDASFDSVG 226

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 141/358 (39%), Gaps = 52/358 (14%)

Query: 34  KAHEVRIKITHTALCHTDAYTLSGV---DPEGIFPS-------ILGHEGSGIVESVGTGV 83
           +AH+V I++    +C ++ ++L      +P     S       ++GHE  G V +VG+ V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 84  TNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIY 142
           T   +GD V +      C +C  C SG    C     T          SR+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYADG------ 139

Query: 143 HFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVF 202
            ++    ++ +    +     I +  P + V  L CG  T Y    +  +  K   VA+ 
Sbjct: 140 -YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 203 GAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLI 262
           G G +G   +  +++ GA ++        KK+ +   GA  FI        GE       
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFI------ATGE------- 244

Query: 263 DMTDGGLDHTFDCTGN-----TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
           +  + GL+ TFD   N     T +  + L  C K     I +G+    ++   +PF   +
Sbjct: 245 EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPFSFFS 304

Query: 318 GRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE--INDGLTDLHHGD 373
                GS+   +  R E   L+    A K     +V  T   SE  +++GLT L  GD
Sbjct: 305 NGCCIGSS--KLGSREEAIELME--LATKHNFSPWV-ETIKVSEAGVSEGLTRLDQGD 357

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 131/317 (41%), Gaps = 56/317 (17%)

Query: 37  EVRIKITHTALCHTDAYTLSG------VDPE------GIFPSILGHEGSGIVESVGTGVT 84
           E+ + I +  +C TD + L+       +D E         P  +GHE +GIV +VG+GV 
Sbjct: 28  ELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSGVK 87

Query: 85  NVKVGDHVIPLYTAECQE--------------CKFCISGKTNLCGSVRATQGKGLMPDGT 130
             +VGDHV    T  C++              C  C  G  N C  +      GL+ +G 
Sbjct: 88  KFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL------GLIGNGV 141

Query: 131 SRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKT 190
                S G           F+E  VV +       +  P +   L+       +  A+  
Sbjct: 142 ----QSGG-----------FAERIVVNESHCYKCPDNLPWEVAALIQPIAVCWH--AINI 184

Query: 191 ADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKD 250
           A  + G +V + G G +GL  +      G ++IIV +    ++ ++   GA  + +P + 
Sbjct: 185 AQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPLQ- 242

Query: 251 LNDGETIVSKLIDMTDG--GLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
               E  +  L  M  G  G D+ FDC+G    ++ ++E C    G ++ + + A  + +
Sbjct: 243 -CSHEQSIPNLRKMAPGADGFDYCFDCSGTPATLKASIE-CLTFRGTAVNVAMWATNKAV 300

Query: 309 STRPFQLVTG-RVWKGS 324
           +  P  +    +++ GS
Sbjct: 301 NFYPMDITKQEKIYTGS 317

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 147/357 (41%), Gaps = 43/357 (12%)

Query: 26  ETITVDPPK--AHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGV 83
           + I+ +P K   ++V ++I    +C +D +  SG       P ++GHE  G V  VG   
Sbjct: 22  KKISYEPKKFDDYDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKC 81

Query: 84  -TNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVI 141
            T VKVGD V +    + C +C  C S     C     T  +   PDG      S+G   
Sbjct: 82  HTGVKVGDRVGVGAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDGYV----SQGGYA 136

Query: 142 YHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKT--ADVQKGDTV 199
            H      F          V+ I EK P      L CG  T +   +       +K   V
Sbjct: 137 SHIRAHEHF----------VIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIV 186

Query: 200 AVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVS 259
            + G G +GL     A++ GA ++  +  +  KK+ +   GA  FI  TK+  D E   +
Sbjct: 187 GIGGIGHMGLIF---AKALGA-EVYAISRSSAKKEDAMKLGADHFIA-TKEEPDWEKKYA 241

Query: 260 KLIDMTDGGLDHTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTG 318
             +D+          C  + T++  + L    +  G+ I I V    +E++ +PFQL +G
Sbjct: 242 STLDL-------VIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SG 293

Query: 319 RVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE--INDGLTDLHHGD 373
                S  G  K   ++  L++D     LK+      T P SE  ++D    +  GD
Sbjct: 294 ITIGNSQLGSRKELIQLLQLVAD---KDLKI---WVETLPISEESVHDAFVRMEKGD 344

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 138/329 (41%), Gaps = 42/329 (12%)

Query: 21  NPLKIETITVDPPKA--HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVES 78
           NP K+E    +P K   H++ IKI    +C +D +T SG   +   P ++GHE  G V  
Sbjct: 21  NPKKVE---YEPKKFLDHDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVR 77

Query: 79  VGTGVTN-VKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNS 136
           +G   T+ +K+GD V +      C EC  C S     C     T       DG     NS
Sbjct: 78  LGDKCTSGLKLGDRVGVGAQAFSCLECGRCKSDNEPYCTKSVWTYSTNY-EDGY----NS 132

Query: 137 KGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKG 196
           KG           +++Y  + +   + I E  P      L CG  T +   ++     +G
Sbjct: 133 KG----------GYADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRG 181

Query: 197 DTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGET 256
             V + G G +G   +  A++ GA ++  +     KK  S   GA  FI  TK+  D  T
Sbjct: 182 KKVGIMGIGGIGHMALIFAKAMGA-EVYAISRTSAKKDDSIKMGADHFI-ATKEEPDWAT 239

Query: 257 IVSKLIDMTDGGLDHTFD----CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
              K  D        TFD    C+ + T +  D +    K  G+ + I      + I+ +
Sbjct: 240 ---KYFD--------TFDLIVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLK 288

Query: 312 PFQLVTGRVWKGSAFGGIKGRSEMGNLIS 340
           PF L+ G     SA GGI    +M +L+S
Sbjct: 289 PFGLL-GVSISNSALGGINEIKQMLDLVS 316

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 88/331 (26%), Positives = 136/331 (41%), Gaps = 52/331 (15%)

Query: 66  SILGHEGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKG 124
            ++GHE  G V +VG  VT    G+ V +      C +C  CI+G    C     T    
Sbjct: 78  QVVGHEIVGHVVNVGNKVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE 137

Query: 125 LMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGY 184
             PDG              ++    ++ +    +  +V +  +     V  L CG  T Y
Sbjct: 138 -YPDG--------------YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVY 182

Query: 185 GAAVKTA--DV-QKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGA 241
            + +K A  DV  K   VA+ G G +G   +  +++    ++  +  +D KK+ +   GA
Sbjct: 183 -SPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGA 240

Query: 242 TDFINPT-KDLNDGETIVSKLIDMTDGGLDHTF----DCT-GNTKVMRDALEACHKGWGQ 295
             F+N T KD+               GGL  TF     CT   TK+  ++L       G+
Sbjct: 241 DHFVNTTEKDVW--------------GGLQDTFHLILSCTISYTKLPFESLLGTLVATGK 286

Query: 296 SIIIGVAAAGQEISTRPFQLVT-GRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVT 354
            I +G+ +  Q +   P QL   G  +  S  G IK   E+  L S     K  V+E   
Sbjct: 287 FISVGLPSKDQPLEIHPMQLAAHGVSFSASHLGSIKELEELLAL-SVKHDIKPWVEEL-- 343

Query: 355 HTRPFSE--INDGLTDLHHGDCLR--TVLNF 381
              P SE  +++GLT L+ GD     T+ NF
Sbjct: 344 ---PISEDSLHEGLTRLNKGDVRYRFTLTNF 371

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/348 (19%), Positives = 131/348 (37%), Gaps = 76/348 (21%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPL 95
           +E+ IK  +  + + ++Y   G+ P    P +LG E SG+V + G  VT   V D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKV--- 114

Query: 96  YTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTV 155
                                                           ++  +TF++YT 
Sbjct: 115 -----------------------------------------------AYLSSNTFAQYTK 127

Query: 156 VADVSVVAIDEKAPLDKVCLLGCG----VTTGYGAAVKTADVQKGDTVAVFGAGTVGLSV 211
           +++   V+   +   D+   L  G      T      +   V+KGD + ++ A       
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 212 VQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG-GLD 270
                 +  +  I V   D+K + + ++GA   IN +KD      ++++++++T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 271 HTFDCTGNTKVMRDALEACHKGWGQS-IIIGVAAAGQEISTRPFQLVTG---RVWKGSAF 326
             FD  G     +D  E   K   +   ++    A   +      ++T    ++ + S F
Sbjct: 243 AAFDSVG-----KDTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLLRPSLF 297

Query: 327 GGIKGRSEMGNLISDYF----AGKLKVDEFVTHTRPFSEINDGLTDLH 370
           G I    E  +  S+ F    +G LK+   ++ T P  E N     L 
Sbjct: 298 GYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLE 343

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 104/388 (26%), Positives = 158/388 (40%), Gaps = 55/388 (14%)

Query: 1   MSITAGKTIQCKAAIAYT-AGNPLKIETITVDPPKA--HEVRIKITHTALCHTDAYTLSG 57
           M+ T+ +  Q  A + +    NP K++    DP K   H++ IK+    +C +D +  SG
Sbjct: 1   MAYTSPEKFQGIAVLDHKDWKNPKKVQ---FDPRKLYDHDIEIKVECCGVCGSDIHAASG 57

Query: 58  VDPEGIFPSILGHEGSGIVESVGTGVTN-VKVGDHV-IPLYTAECQECKFCISGKTNLCG 115
              +   P ++GHE  G V  +G    + +K+GD V +      C +C+ C +     C 
Sbjct: 58  NWGDLTKPLVVGHEIIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCE 117

Query: 116 SVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCL 175
               T G+   PDG S    SKG           +++Y  V +   V I E  P      
Sbjct: 118 GFVTTYGQD-YPDGYS----SKG----------GYADYFRVHEHFAVPIPENIPSHLAAP 162

Query: 176 LGCGVTTGYGAAVKT--ADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKK 233
           L CG  T Y   V+      +K   V + G G  GL     A++ GA ++  +     KK
Sbjct: 163 LMCGGLTVYSPLVRNGCGPNKKVGIVGIGGIGHQGLLF---AKAMGA-EVYAISRTSAKK 218

Query: 234 KWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFD----CTGN-TKVMRDALEA 288
           + +   GA  FI  TK+  D  T   K  D        TFD    C  + T V  + +  
Sbjct: 219 EDAMKLGADHFI-ATKEEPDWGT---KYFD--------TFDLIVVCASSLTDVDFNTVPN 266

Query: 289 CHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLK 348
             K  G  + I V    + +S +PF L  G     SA G I   SEM +L+       +K
Sbjct: 267 TMKIGGSIVSISVPEQNETLSLKPFGL-KGVSISNSALGSI---SEMRDLLKLVSENNIK 322

Query: 349 VDEFVTHTRPFSE--INDGLTDLHHGDC 374
           +      T P  E  + +    +  GDC
Sbjct: 323 L---WVETIPIGEKGVKEAFERMDKGDC 347

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 100/249 (40%), Gaps = 63/249 (25%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPL 95
           +E+ IK  +T +   ++Y   G+ P    P +LG E SG V + G  V+   + D V   
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAVSKFNLADKV--- 102

Query: 96  YTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTV 155
                                                           ++   TF++YT 
Sbjct: 103 -----------------------------------------------AYLSAGTFAQYTK 115

Query: 156 VADVSVVAIDEKAPLDKVCLLGCG----VTTGYGAAVKTADVQKGDTVAVFGA-GTVGLS 210
           +A+   ++   +   DK   L       V T    A +   V+KGD V ++ A G VGL+
Sbjct: 116 IAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLA 175

Query: 211 VVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG-GL 269
             Q  +  GA  I V    D+K + + +FGA   +N +K     E ++++++++T G G+
Sbjct: 176 FNQILKRLGAHTIAVAS-TDEKLQLAKEFGAEYLVNSSK-----EDVLARVLEITQGQGV 229

Query: 270 DHTFDCTGN 278
           D  +D  G 
Sbjct: 230 DVAYDSIGK 238

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 107/258 (41%), Gaps = 64/258 (24%)

Query: 25  IETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVT 84
           I T T+  P  +++ IK  +  + + ++Y   G+ P  + P+ILG E SG+V   GT + 
Sbjct: 43  IATPTIQTP--NDIIIKNKYAGVNYIESYFRKGIYPCAL-PAILGREASGVVVDKGTNIK 99

Query: 85  NVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHF 144
           N ++GD V   Y   C   +F                                       
Sbjct: 100 NFEIGDKV--AYIGNCSMAQF--------------------------------------- 118

Query: 145 MGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGA---AVKTADVQKGDTVAV 201
                    T + +  ++ +   +  + + L   G+  G  A     +  +V+KGD + V
Sbjct: 119 ---------TKIDNSMIMKLSSDSTNEDLKLYAAGILQGLTALSFVTEAYEVKKGDYILV 169

Query: 202 F-GAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSK 260
           +  AG  GL   Q  ++RGA  +I V  +D+K + + + GA   IN   D      I++K
Sbjct: 170 YAAAGGAGLIFDQLIKARGAH-VIAVCSSDEKLQLAKENGAEYLINSKTD-----DILTK 223

Query: 261 LIDMTDG-GLDHTFDCTG 277
           ++++TD  G+   FD  G
Sbjct: 224 VMEITDNKGVQAAFDSVG 241

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 107/258 (41%), Gaps = 57/258 (22%)

Query: 23  LKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGHEGSGIVESVGT 81
           +K E   V      ++ IK  +T + + ++Y   G+ P E   P +LG E +G++ + G 
Sbjct: 23  IKYENYPVPLISDKDILIKNKYTGVNYIESYFRKGLYPCEK--PYVLGREATGVIVAKGK 80

Query: 82  GVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVI 141
            VTN + GD V     A      F    K    G++        +P GTS          
Sbjct: 81  DVTNFETGDQV-----AYISNSTFAQYTKFPSEGTIMK------LPSGTS---------- 119

Query: 142 YHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAV 201
                                  DEK  L    LL     T      +   V+KGD + V
Sbjct: 120 -----------------------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILV 154

Query: 202 F-GAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSK 260
           +  AG VGL + Q  + + A  I V     +K + + D+GA   I+ +K     E I+++
Sbjct: 155 YAAAGGVGLILNQLLRMKDAHAIAVASTY-EKLETAKDYGAEFLIDSSK-----EDILTR 208

Query: 261 LIDMTDG-GLDHTFDCTG 277
           ++++TDG G+D +FD  G
Sbjct: 209 VLEITDGKGVDASFDSVG 226

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 129/309 (41%), Gaps = 29/309 (9%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTN-VKVGDHV-I 93
           +++ IKI    +C +D +  SG   +   P ++GHE  G V  VG+  T+ +KVGD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 94  PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY 153
                 C  C  C +     C +V  T G    PDG     N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFDY-PDGY----NGKG----------GYANY 138

Query: 154 TVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQ 213
             V +   V I E  P      L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 214 GAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTF 273
            A+S GA ++  +  +D KK+ +F  GA  FI  TKD  D      K  D     LD   
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFI-ATKDEPDWG---KKYFDT----LDLIV 248

Query: 274 DCTGNTK-VMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR 332
            C G+ K V  D L       G+ + I +  A +++    F L  G     S+ G +   
Sbjct: 249 ICAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL-AGISIGNSSLGSMVEL 307

Query: 333 SEMGNLISD 341
            ++  L+S+
Sbjct: 308 KQLLKLVSE 316

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 131/328 (39%), Gaps = 38/328 (11%)

Query: 21  NPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVG 80
           NP K+E     P   H++ IKI    +C +D +  +G   +   P ++GHE  G V  +G
Sbjct: 20  NPKKVE-FPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIG 78

Query: 81  TGV-TNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKG 138
               T +KVGD V +      C EC  C +     C     T  +    DG         
Sbjct: 79  PKCNTGLKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTTYSQP-YEDG--------- 128

Query: 139 EVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDT 198
                ++    ++ Y  V +   V I E  P      L CG  T Y   ++         
Sbjct: 129 -----YVSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKV 183

Query: 199 VAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
             V   G   + ++  A++ GA ++  +  ++ KK+ S   GA  +I   ++ N GE   
Sbjct: 184 GIVGIGGIGHMGLL-FAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPNWGE--- 238

Query: 259 SKLIDMTDGGLDHTFD----CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPF 313
            K  D        TFD    C  + T V  D +    K  G+ + I +    Q ++ +PF
Sbjct: 239 -KYFD--------TFDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPF 289

Query: 314 QLVTGRVWKGSAFGGIKGRSEMGNLISD 341
            L+ G     SA G IK   ++  L+S+
Sbjct: 290 GLL-GVSIANSALGSIKEIEQLLKLVSE 316

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 123/321 (38%), Gaps = 54/321 (16%)

Query: 67  ILGHEGSGIVESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGL 125
           ++GHE  G V +VG  V+  KVGD V +    + C +C  C S     C     T     
Sbjct: 75  VVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP- 133

Query: 126 MPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYG 185
            PDG      S+G    H      F             I  + P + V  L CG  T + 
Sbjct: 134 YPDGYV----SQGGYASHVRAHEQF----------CFPIPPEIPSELVAPLQCGGLTVFS 179

Query: 186 AAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFI 245
              +    +K   VA+ G G +G   +  +++ GA ++  V     K+  +   GA  FI
Sbjct: 180 PIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFI 238

Query: 246 NPTKDLNDGETIVSKLIDMTDGGLDHTFD----CTGNTKVM-RDALEACHKGWGQSIIIG 300
             T + N             + GLD TFD    C  +T  +  +AL  C K     + +G
Sbjct: 239 A-TSEPN------------WNAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVG 285

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360
           +    ++   +PF         GS+   +  R E   L+      +L V     + RP+ 
Sbjct: 286 LPHIDEDFKVKPFSFFHNGCNIGSS--KLGSREEAIELM------QLAVKH---NFRPWV 334

Query: 361 E--------INDGLTDLHHGD 373
           E        +++GLT L  GD
Sbjct: 335 ETIKVSEAGVSEGLTRLDKGD 355

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 89/364 (24%), Positives = 148/364 (40%), Gaps = 50/364 (13%)

Query: 21  NPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVG 80
           NP KI+     P   H+V IKI    +C +D +  +G   +   P ++GHE  G V  +G
Sbjct: 20  NPKKIK-YDPKPFYDHDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLG 78

Query: 81  TGVTN-VKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKG 138
           +   + ++VG  V +      C EC  C S     C     T G+    DG         
Sbjct: 79  SKSNSGLQVGQRVGMGAQVFSCLECDRCKSDNEPYCTKFVTTYGQPY-EDG--------- 128

Query: 139 EVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKT--ADVQKG 196
                ++    +++Y  V +  VV I E  P      L CG  T Y   V+      +K 
Sbjct: 129 -----YVSQGGYADYVRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKV 183

Query: 197 DTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGET 256
             V   G G++G  +   A++ GA +  V+  +  K++ +   GA  +I   ++ N GE 
Sbjct: 184 GIVGFGGIGSMGTLI---AKAMGA-ETYVISRSSKKREDAMKMGADHYIATLEEENWGE- 238

Query: 257 IVSKLIDMTDGGLDHTFD----CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
              K  D        TFD    C  + T +  D +    K  G+ + I +    + ++ +
Sbjct: 239 ---KYFD--------TFDLIVVCASSLTGIDFDVMPKAMKVGGRIVSISIPEQHEVLTLK 287

Query: 312 PFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE--INDGLTDL 369
           P+ L    +   SA G IK   ++  L+S+      K  +    T P  E  +++ L  +
Sbjct: 288 PYGLKAVSI-SYSALGSIKELKQLLKLVSE------KNVKIWVETLPVGEAGVHEALERM 340

Query: 370 HHGD 373
             GD
Sbjct: 341 EKGD 344

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 130/324 (40%), Gaps = 30/324 (9%)

Query: 21  NPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVG 80
           NP KI+         H+++IK+    +C +D +  SG       P ++GHE  G V  VG
Sbjct: 20  NPKKIQ-FKAKTFNDHDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVG 78

Query: 81  TGVTN-VKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKG 138
               N +KVGD V +      C EC  C +   + C    AT G G  PDG         
Sbjct: 79  DRCDNGLKVGDRVGVGAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------- 128

Query: 139 EVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDT 198
                ++    ++++  V +  VV I E  P +    L CG  T +   ++      G  
Sbjct: 129 -----YISKGGYADFVRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRNG-CGPGKK 182

Query: 199 VAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
           V + G G +G   V  A + GA ++  +     KK  +F  GA  FI  TK+  D  T  
Sbjct: 183 VGIVGIGGIGHQGVIFANAMGA-EVYAISRTSKKKDDAFKLGAHHFI-ATKEEPDWGTKY 240

Query: 259 SKLIDMTDGGLDHTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
               D+          C  + T +  D +    K  G+ + I +    Q +  +PF L  
Sbjct: 241 YDTFDL-------IVVCANSLTDIDFDVVPHTMKIGGRIVSISIPEMSQVLKLKPFGL-K 292

Query: 318 GRVWKGSAFGGIKGRSEMGNLISD 341
           G     S  G IK    +  L+S+
Sbjct: 293 GVSISNSHLGSIKELKTLLKLVSE 316

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 100/251 (39%), Gaps = 58/251 (23%)

Query: 34  KAHEVRIKITHTALCHTD----AYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVG 89
           K +E+ IK  +  L H D     Y  S       FP + G E SGIV         V+ G
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYS----FPWVNGRESSGIV---------VRRG 118

Query: 90  DHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCST 149
           + V         E KF + G+  +  +                         Y  +  ST
Sbjct: 119 EKV--------DEEKFPLGGEVFIASTT------------------------YRDLRTST 146

Query: 150 FSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADV----QKGDTVAVFGAG 205
           F EYTV     V  + E+  LD    +G  + T   A     +V    ++  ++ ++G  
Sbjct: 147 FQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGS 206

Query: 206 T-VGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDM 264
           T VG+ VVQ A+S G +KII +  +   +++    GAT  I+  +   D   IV+++  +
Sbjct: 207 TGVGIFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREEKTED---IVNEIKKI 262

Query: 265 TDGGLDHTFDC 275
              G+ H  D 
Sbjct: 263 CPNGVSHGVDL 273

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 132/324 (40%), Gaps = 30/324 (9%)

Query: 21  NPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVG 80
           NP K+E     P   ++V IKI    +C +D +  +G   +   P ++GHE  G V  VG
Sbjct: 19  NPKKVE-FPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVG 77

Query: 81  TGV-TNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKG 138
               T +K+GD V +      C EC+ C +     C     T  +    DG         
Sbjct: 78  PKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTTYSQPY-EDG--------- 127

Query: 139 EVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDT 198
                ++    ++ Y  V +   V I E  P +    L CG  T Y   ++      G  
Sbjct: 128 -----YVSQGGYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKK 181

Query: 199 VAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
           V + G G +G   +  A++ GA ++  +  ++ KK+ S   GA  +I   ++ + G    
Sbjct: 182 VGILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPDWG---- 236

Query: 259 SKLIDMTDGGLDHTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
           +K  D      D    C  + T V  D +    K  G+ + I V    + ++ +PF L+ 
Sbjct: 237 TKYFDT----FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISVPEQDEVLTMKPFGLI- 291

Query: 318 GRVWKGSAFGGIKGRSEMGNLISD 341
           G     S  G I    ++  L+S+
Sbjct: 292 GVSIANSILGSIAEMKQLLKLVSE 315

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 134/339 (39%), Gaps = 77/339 (22%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPL 95
           +E+ +K  ++ +   ++Y   G+ P    P ILG E SG V + G  V +  +GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKV--- 107

Query: 96  YTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTV 155
                                                           ++  S F++YT 
Sbjct: 108 -----------------------------------------------AYLSGSAFAQYTK 120

Query: 156 V-ADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAV---KTADVQKGDTVAVFGA-GTVGLS 210
           V A   VV + + A  + + L   G+     A     +  +V+KGD +  + A G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 211 VVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG-GL 269
           + Q  + RGA  I VV   ++K + +   GA   I  +K     E IV+++ ++T+  G+
Sbjct: 181 LDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGIISSK-----EDIVTRVKEITNNQGV 234

Query: 270 DHTFDCTGNTKVMRDALEACHKGWGQS-IIIGVAAAGQEISTRPFQLVTG--RVWKGSAF 326
           D  FD  G     +D  E       +    +    A   +S  P   +TG  ++ + S F
Sbjct: 235 DAAFDSIG-----KDTFETTISALKRKGTFVSYGNASGPVSPFPLTKLTGNIKILRPSLF 289

Query: 327 GGIKGRSEMGNLISDYF----AGKLKVDEFVTHTRPFSE 361
             I    E  +   ++     +GKLK++  + H  P SE
Sbjct: 290 SYIATSEEWKHYSREFVSLVSSGKLKIN--IGHVFPLSE 326

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 86/337 (25%), Positives = 131/337 (38%), Gaps = 44/337 (13%)

Query: 22  PLKIETITV-------DPPKA---------HEVRIKITHTALCHTDAYTLSGVDPEGIFP 65
           P K+E I +        P KA          +V IK+    +C +D +  +G        
Sbjct: 4   PAKVEGIAITDKKDWLHPKKASYDLKTAGDRDVDIKVIACGVCGSDVHCAAGRHLPLFED 63

Query: 66  SILGHEGSGIVESVGTGVT-NVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGK 123
            ++GHE  G V  VG   T  VKVGD V +   +  C EC+ CI+G    C         
Sbjct: 64  CVVGHEIIGEVVKVGPKCTAGVKVGDRVGVGAQSLSCLECESCIAGNEQYCKKNTVYTIA 123

Query: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183
            + PDG+         V  H        EY V      +     APL       CG  T 
Sbjct: 124 SIYPDGSKAQGGFGSHVRTH--------EYFVHPIPKELDTVNAAPLL------CGGITA 169

Query: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243
           +   ++   V  G TV + G G +G   +  A++ GA K+I +  +  KK+     GA +
Sbjct: 170 FSPLLR-GQVGPGKTVGIVGIGGIGHIAILFAKAMGA-KVIAISRSASKKEDCLKLGADE 227

Query: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGN-TKVMRDALEACHKGWGQSIIIGVA 302
           +I       +G+    K      G +D    C  + +K   D+L +  K  G+   IG+ 
Sbjct: 228 YIASA----EGDDWKQKFA----GSIDFMLLCNSSFSKSNFDSLFSLIKLGGEVCSIGIP 279

Query: 303 AAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLI 339
                +S  P  L+ G  +  SA G      +M  L+
Sbjct: 280 DMSYRLSISPLSLL-GIKFGFSALGSRNEFQKMFELV 315

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 133/342 (38%), Gaps = 80/342 (23%)

Query: 35  AHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIP 94
           A EV IK   + +   ++Y   G+ P    P +LG E +G V + G  V+   +GD V  
Sbjct: 49  ADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSKFNIGDKV-- 105

Query: 95  LYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYT 154
                                                            ++   TF++YT
Sbjct: 106 ------------------------------------------------AYLSPGTFAQYT 117

Query: 155 VVADV-SVVAIDEKAPLDKVCLLGCGVTTGYGAAV---KTADVQKGDTVAVFGA-GTVGL 209
              +   ++ + ++   +++      +  G  A        DV+KGD + ++ A G  GL
Sbjct: 118 KYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDAYDVKKGDYILLYAAAGGAGL 177

Query: 210 SVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG-G 268
              Q  + +GA  I V    D+K K + ++GA   IN +KD       +SK++++T+G G
Sbjct: 178 IFNQLLKLKGAHTIAVAS-TDEKLKLAREYGAEYVINSSKD-----DTLSKVLEITNGEG 231

Query: 269 LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQL-----VTGRVWKG 323
           +   FD  G       +L+A  +  G  +  G A+        PF +        +V + 
Sbjct: 232 VAAAFDSIGK-DTFEISLQAIKRK-GTLVSFGNASG----PVPPFSINRLSSKNLKVLRP 285

Query: 324 SAFGGIKGRSEMGN----LISDYFAGKLKVDEFVTHTRPFSE 361
             FG I    E  +    LI    +G LKV  F++ T P SE
Sbjct: 286 QVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSE 325

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 107/259 (41%), Gaps = 59/259 (22%)

Query: 23  LKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGHEGSGIVESVGT 81
           +K E   V      ++ IK  +  + + ++Y   G+ P E   P +LG E +G V + G 
Sbjct: 23  IKYEDYPVPLISDEDLLIKNKYAGVNYIESYFRKGLYPCEK--PYVLGREATGTVVAKGK 80

Query: 82  GVTNVKVGDHVIPL-YTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEV 140
            V N ++GD V  + ++   Q  KF                             +SKG V
Sbjct: 81  DVNNFQIGDQVAYISHSTFAQYTKF-----------------------------SSKGNV 111

Query: 141 IYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVA 200
           +     C++               DEK  L    LL     T      +   V+KGD + 
Sbjct: 112 M-RLPKCTS---------------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYIL 153

Query: 201 VF-GAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVS 259
           V+  AG VGL + Q  + +GA  I V    D+K   +   GA   IN +K     E ++ 
Sbjct: 154 VYAAAGGVGLILNQLLKMKGAHAIAVAS-TDEKLDIAKKNGAEYLINSSK-----EDVLE 207

Query: 260 KLIDMTDG-GLDHTFDCTG 277
           +++++T+G G+D +FD  G
Sbjct: 208 RVLEITNGEGVDSSFDSIG 226

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 120/284 (42%), Gaps = 28/284 (9%)

Query: 35  AHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTN-VKVGDHV- 92
           A ++ +K+    +C +D +  +G       P ++GHE  G V  VG+G    +KVGD V 
Sbjct: 56  ARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVG 115

Query: 93  IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSE 152
           +      C EC  C S     C ++           GT  F    G     ++    ++ 
Sbjct: 116 VGAQALSCLECSRCESENEQYCSNM----------TGTYNFPYPDG-----YISQGGYAS 160

Query: 153 YTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVV 212
           + +V +   + I +  P      L CG  T +   +++ +V  G +V V G G +G   V
Sbjct: 161 HVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAV 219

Query: 213 QGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHT 272
             A++ GA+ +  +    +KK  +   GA  +I   +D +  +T  +         LD  
Sbjct: 220 IFAKALGAN-VTAISRRSNKKDDALKLGADVYIAAVEDKDWHKTYANT--------LDLI 270

Query: 273 FDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
             C+ + T++  D + +  K  G+ + I +  A + +  RP  L
Sbjct: 271 VVCSSSLTELDFDRIPSLLKVGGKVLSIAIPEASERLVLRPLLL 314

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 12/141 (8%)

Query: 144 FMGCSTFSEYT-VVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAV---KTADVQKGDTV 199
           ++  STF+++T    +  ++ + +    +K  ++   +  G        +  +VQKGD +
Sbjct: 112 YLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQKGDFI 171

Query: 200 AVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
            V+ A G VGL   Q  ++RGA + I V   D+K + + ++GA   IN TKD      IV
Sbjct: 172 LVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD-----DIV 225

Query: 259 SKLIDMTDG-GLDHTFDCTGN 278
            K+ + T+G G+   FD  G 
Sbjct: 226 EKVKEFTNGEGVAAAFDSIGK 246

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 113/271 (41%), Gaps = 66/271 (24%)

Query: 25  IETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVT 84
           I+T TV+   ++E+ IK +++ +   +AY   G+ P  + P + G E SGIV  VG  V 
Sbjct: 44  IQTPTVE--NSNEMVIKNSYSGINFIEAYFRKGIYPCEL-PYLPGREASGIVAEVGKDVK 100

Query: 85  NVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHF 144
           N ++GD V  L+                                         GE     
Sbjct: 101 NFQIGDKVAYLH-----------------------------------------GE----- 114

Query: 145 MGCSTFSEYTVVADV-SVVAIDEKAPLDKVCLLGCGVTTGYGAAV---KTADVQKGDTVA 200
               T +E+T + +   ++ + + A  + + L   G+     A     +  +V+KG+ V 
Sbjct: 115 ----TMAEFTKIKETDPIIKLSKDASDENLKLYAAGLLQSLTAITLINEAHEVKKGEYVL 170

Query: 201 VF-GAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVS 259
           V+  AG VGL + Q  + +GA  I V     +K + +   GA   IN  +     E +V 
Sbjct: 171 VYAAAGGVGLLLDQLLKMKGAHTIAVCS-TKEKLELAKANGAEFSINSKE-----ENVVQ 224

Query: 260 KLIDMTDG-GLDHTFDCTGNTKVMRDALEAC 289
           +++++T+  G+D  +D  G      D L A 
Sbjct: 225 RVMEITNNKGVDVAYDSIGKA-TFEDTLAAL 254

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 133/343 (38%), Gaps = 37/343 (10%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGV-TNVKVGDHV-I 93
           H++ I++    +C +D +  SG   E   P ++GHE  GIV   G    + +KV D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 94  PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY 153
                 C +C  C       C +  +T  K    DG              ++    +++Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 154 TVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQ 213
             V +   V I E  P      L CG  T +   ++      G  V + G G +G   V 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVGILGIGGIGHMGVL 197

Query: 214 GAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTF 273
            A++ GA ++  +     KK  +   G   FI  TK+  D      K  D     LD   
Sbjct: 198 LAKAMGA-EVYAISRTSSKKADAVKLGTDHFIA-TKEEPDWH---EKYFDT----LDLLV 248

Query: 274 DCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR 332
            C G+ T V  D L       G+ + I +    + +  +PF LV G     S  G +K  
Sbjct: 249 ICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMKEL 307

Query: 333 SEMGNLISDYFAGKLKVDEFVTHTRPFSE--INDGLTDLHHGD 373
            E+  L++      +K+      T P  E  +N+  T +  GD
Sbjct: 308 KELLELVA---KNNIKI---WVETIPIGEKGVNEAFTRMEKGD 344

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 128/328 (39%), Gaps = 85/328 (25%)

Query: 34  KAHEVRIKITHTALCHTDAYTLSGVDP-EGIFPSILGHEGSGIVESVGTGVTNVKVGDHV 92
           +  ++ IK  +  +   + Y  +G+ P E   P +LG E  G+V ++G  V   KVGD V
Sbjct: 34  RGSDILIKNRYAGVNFIETYFRTGLYPCEK--PYVLGREAVGVVAAIGADVRRFKVGDRV 91

Query: 93  IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSE 152
                        C+S                                        TF++
Sbjct: 92  A------------CLS--------------------------------------SGTFAQ 101

Query: 153 YTVVADVSVVAIDEKAPLD----KVCLLGCGVTTGYGAAVKTADVQK---GDTVAVF-GA 204
           YT V++ S V    K P D    ++  +   +  G  A     +  K   G+ V V+  A
Sbjct: 102 YTAVSEKSNVL---KLPDDIQDGELQAVAGSLVNGLTALTLVDEAYKPQVGEIVLVYAAA 158

Query: 205 GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDM 264
           G VG  ++Q   +R   ++I V   D+K + +   GA   IN ++     E IV+K+++ 
Sbjct: 159 GGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSRGAEFLINSSR-----EDIVAKVLEF 212

Query: 265 TDG-GLDHTFDCTGNTKVMRDALEACHKGWGQS-IIIGVAAAGQEISTRPFQLVTG---R 319
           TDG G+  ++D  G     +D  E   +   +   I+    A   +     Q +T    +
Sbjct: 213 TDGEGVGASYDSVG-----KDTFETTLQSVKRKGTIVSFGNASGAVPPFSIQRLTPKNLK 267

Query: 320 VWKGSAFGGIKGRSEMGNLISDYFAGKL 347
           + +   +G +  R E      +Y++ KL
Sbjct: 268 ILRPQLYGYLATREEW-----EYYSSKL 290

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 112/284 (39%), Gaps = 28/284 (9%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTN-VKVGDHV-I 93
           H++ IKI    +C +D +  SG   +   P ++GHE  G +  +G    +  K+GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 94  PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY 153
                 C EC  CI+     C  V  T       DG S    S+G           ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPY-EDGYS----SRG----------GYANY 138

Query: 154 TVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQ 213
             V +   V I E  P      L CG  T + + +K      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 214 GAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTF 273
            A++ GA ++  +     K+  +   GA  FI   ++ +  +    K        LD   
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFIAIKEEPDWHKEYFDK--------LDLVV 248

Query: 274 DCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
            C G+ T +  + L       G+ + I +    + +  +PF LV
Sbjct: 249 ICAGSLTDIDFNTLPNILTVGGRIVSIAIPEQHEVLKMKPFGLV 292

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 80/345 (23%), Positives = 139/345 (40%), Gaps = 41/345 (11%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTN-VKVGDHV-I 93
           H+V IKI    +C +D +  +G       P ++GHE  G V  +G    + +K+G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 94  PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY 153
                 C EC  C S     C     T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTTYSQPY-EDG--------------YVSQGGYANY 138

Query: 154 TVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKT--ADVQKGDTVAVFGAGTVGLSV 211
             V +  VV + +  P      L CG  T Y   ++      +K   V   G G++G  +
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSMGSLI 198

Query: 212 VQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDH 271
              A++ GA +  V+  +  KK+ +   GA  +I   ++ + GE    K  D  D  +  
Sbjct: 199 ---AKAMGA-ETYVISRSSKKKEDAMKMGADHYIATLEEEDWGE----KYFDTFDLIVVC 250

Query: 272 TFDCTG-NTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIK 330
               TG +  VM  A+    K  G+ + I +    + ++ +P+ L    +   SA G IK
Sbjct: 251 ASSLTGIDFNVMPKAM----KVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSIK 305

Query: 331 GRSEMGNLISDYFAGKLKVDEFVTHTRPFSE--INDGLTDLHHGD 373
              ++  L+S+     +K+      T P  E  +++ L  +  GD
Sbjct: 306 ELKQLLKLVSE---NDIKI---WVETLPIGEAGVHEALERMEKGD 344

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 139/355 (39%), Gaps = 53/355 (14%)

Query: 32  PPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVG-TGVTNVKVGD 90
           P   H+V IKI    +C +D +  +G       P ++GHE  G V  +G    + +KVG 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQ 89

Query: 91  HV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCST 149
            V +      C EC  C S     C     T  +    DG              ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKSDNEPYCTKFVTTYSQPY-EDG--------------YISQGG 134

Query: 150 FSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKT--ADVQKGDTVAVFGAGTV 207
           ++ Y  V +  +V I E  P      L CG  T Y   V+      +K   V + G G++
Sbjct: 135 YANYVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 208 G--LSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMT 265
           G  +S   GA++       V+  +  KK+ +   GA  +I   ++ + GE    K  D  
Sbjct: 195 GTLISKAMGAET------YVISRSSKKKEDAIKMGADHYIATLEEGDWGE----KYFD-- 242

Query: 266 DGGLDHTFD----CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRV 320
                 TFD    C  + T +  + +    K  G+ + I +    + ++ +P+ L    +
Sbjct: 243 ------TFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI 296

Query: 321 WKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSE--INDGLTDLHHGD 373
              SA G IK   ++  L+S+      K  +    T P  E  +++ L  +  GD
Sbjct: 297 -SYSALGSIKELKQLLALVSE------KNIKVWVETLPVGEAGVHEALERMERGD 344

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 80/353 (22%), Positives = 138/353 (39%), Gaps = 78/353 (22%)

Query: 23  LKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTG 82
           +K +   V    + +V +K  +  +   +AY   G  P  + P +LG E SG V  VG+ 
Sbjct: 22  IKYQDFAVPSIGSTDVLVKNKYAGVNFIEAYFRKGYYPCEL-PYVLGREASGEVVQVGSE 80

Query: 83  VTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIY 142
           V + K+GD V                                                  
Sbjct: 81  VKDFKIGDKVA------------------------------------------------- 91

Query: 143 HFMGCSTFSEYTVVA-DVSVVAIDEKAPLDKVCLLGCGVT---TGYGAAVKTADVQKGDT 198
            ++G STF++YT  + +  ++ + +  P + + L G  +    T      +   V +GD 
Sbjct: 92  -YLGGSTFAQYTKKSTENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDY 150

Query: 199 VAVFGA-GTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETI 257
           + V+ A G VG  + Q    R A  +I V  + +K   + + GA   IN  +D      I
Sbjct: 151 ILVYAASGGVGSILCQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DI 204

Query: 258 VSKLIDMTDG-GLDHTFDCTGNTKVMRDALEACHKG----WGQSIIIGVAAAGQEISTRP 312
           + K++  T+G G+   FD  G      D      KG    +G +  +    A  ++S + 
Sbjct: 205 LEKVMQYTNGKGVHAAFDSIGKDTFETDLAALRRKGTLVSFGNASGMVPPFAINKLSPKN 264

Query: 313 FQLVTGRVWKGSAFGGIKGRSEMGNL--ISDYF--AGKLKVDEFVTHTRPFSE 361
            +L+  +V+     G +  RSE  +   I  +F  +  LKVD  ++   P SE
Sbjct: 265 LKLLRPQVY-----GYLGTRSEWDHYCSIFKHFVQSKSLKVD--ISGIYPLSE 310

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 127/317 (40%), Gaps = 45/317 (14%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTN-VKVGDHV-I 93
           H++ IKI    +C +D +  +G       P ++GHE  G V  +G    + +KVG  V +
Sbjct: 34  HDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGV 93

Query: 94  PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY 153
                 C EC  C +     C     T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKNDNEPYCTKFVTTYSQPY-EDG--------------YVSQGGYANY 138

Query: 154 TVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKT--ADVQKGDTVAVFGAGTVG--L 209
             V +  VV I E  P      L CG  T Y   V+      +K   V + G G++G  +
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLI 198

Query: 210 SVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGL 269
           S   GA++       V+  +  K++ +   GA  +I   ++ + GE    K  D      
Sbjct: 199 SKAMGAET------YVISRSSRKREDAMKMGADHYIATLEEGDWGE----KYFD------ 242

Query: 270 DHTFD----CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGS 324
             TFD    C  + T +  + +    K  G+ + I +    + +S +P+ L    +   S
Sbjct: 243 --TFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SYS 299

Query: 325 AFGGIKGRSEMGNLISD 341
           A G IK  +++  L+S+
Sbjct: 300 ALGSIKELNQLLKLVSE 316

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 123/311 (39%), Gaps = 29/311 (9%)

Query: 34  KAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGV-TNVKVGDHV 92
           K  +V I+I    +C +D +  SG   E     ++GHE  G V  +G    T +K+GD V
Sbjct: 32  KECDVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRV 91

Query: 93  -IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFS 151
            +    A C +C+ C       C     T  +   PDG              ++    ++
Sbjct: 92  GVGAQVASCLDCERCEHDNEPYCPKFVTTYNQAY-PDG--------------YISQGGYA 136

Query: 152 EYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSV 211
            +  V +  V+ + EK P      L CG  T Y   V+           V   G   + +
Sbjct: 137 SHIRVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVRGGCAPGKKVGIVGIGGIGHMGI 196

Query: 212 VQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDH 271
           +  A++ GA ++     +++K++ S   GA  +I   ++    E    K  +     LD 
Sbjct: 197 L-FAKAMGA-EVYAFSRHENKREDSMKLGADHYIATLEE----EGWTEKYFN----SLDV 246

Query: 272 TFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIK 330
              C  + +++  D L    K  G+ I I V    + +  +P  L+ G     S  G  K
Sbjct: 247 MILCASSLSQINLDDLIKVMKVEGKIISICVPENDEMMIVKPLGLL-GVYVSNSLLGSRK 305

Query: 331 GRSEMGNLISD 341
              E+ +++++
Sbjct: 306 ELLELLHMVAE 316

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 63/150 (42%), Gaps = 20/150 (13%)

Query: 151 SEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGA-GTVGL 209
           +EY VV++ +V    +     +   LG  +TT    A++ A V+  D V+V GA G+VG 
Sbjct: 51  AEYCVVSEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVGS 109

Query: 210 SVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDG-G 268
            VVQ AQS G   +                      +PT      +   S L  +T G G
Sbjct: 110 YVVQLAQSMGCRVLRAAR-----------------QSPTDVCIAEDEEFSALTSLTQGRG 152

Query: 269 LDHTFDCTGNTKVMRDALEACHKGWGQSII 298
           +D   D  G   +M+ A E    G   ++I
Sbjct: 153 VDVVIDTVGMPALMKAAAEKLAHGGRMAVI 182

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 106/284 (37%), Gaps = 71/284 (25%)

Query: 34  KAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVI 93
           K +E+ ++  +  L H D  +         FP I G E SGIV   G+ V          
Sbjct: 71  KEYEILVQNKYVGLNHVDWKSKKYRFNIYSFPWINGRESSGIVIRRGSKVDT-------- 122

Query: 94  PLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEY 153
                     KF IS +  L  +                         Y  +  STF EY
Sbjct: 123 ---------QKFPISAEVFLASTS------------------------YRDLETSTFQEY 149

Query: 154 TVVADVSVVAIDE-KAP---------LDKVCLLGCGVTTGYGAAVKT---------ADVQ 194
           TV     V  + + + P         L+    +G G+ T  G+A+ +         AD Q
Sbjct: 150 TVFDSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVDLSLRDQADHQ 208

Query: 195 K-GDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLND 253
           K G+ V   G+ +VGL V+Q A++    + IVV      K++  + GA+  I+  +    
Sbjct: 209 KLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCIIDRHQ---S 265

Query: 254 GETIVSKLIDMTDGGLDHTFDCTGN------TKVMRDALEACHK 291
            E I+  ++     G+D   D          TK++++  E   K
Sbjct: 266 EEEILDDILSHCPEGIDFGIDVISKETATLLTKILQNNNENVKK 309

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 83/363 (22%), Positives = 135/363 (37%), Gaps = 49/363 (13%)

Query: 29  TVDPPK--AHEVRIKITHTALCHTDAYTLSG----------VDPEGIFPSILGHEGSGIV 76
           + +P K   H++ I++    +C ++ ++L                G    ++GHE  G V
Sbjct: 29  SYEPKKFGEHDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKV 88

Query: 77  ESVGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKN 135
             VG  VT  K+G  V +    + C +C  C S     C     T      PDG      
Sbjct: 89  VKVGEKVTLAKLGQRVGLGAQASSCMQCGRCSSNNEQYCLKSVGTYC-SRYPDGYV---- 143

Query: 136 SKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQK 195
           S+G    H      F             I +  P   V  L CG  T Y    +  +  +
Sbjct: 144 SQGGYASHVRAHEQF----------CFPIPDDVPSAFVAPLMCGGLTVYSPIKRNIEGVE 193

Query: 196 GDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGE 255
              V + G G +G   +  A++ GA ++     ++ KK  +   GA  F+   ++    E
Sbjct: 194 KPKVGIIGIGGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVATGEE----E 248

Query: 256 TIVSKLIDMTDGGLDHTFDCTGNTKVM-RDALEACHKGWGQSIIIGVAAAGQEISTRPFQ 314
              S+L D          +C  +T  +  +A  +  K   Q + +G+   G+     PF 
Sbjct: 249 NWSSRLAD----NFHLVLNCASSTTSLDLNAFVSILKVNCQLVSVGLPEKGETFDLSPFT 304

Query: 315 LVTGRVWKGSAFGGIK--GRSEMGNLISDYFAGKLKVDEFVTHTRPFSE--INDGLTDLH 370
            +      G + G  K   R E   L+    A K     +V  T   SE  +++GLT L 
Sbjct: 305 FIRN----GCSMGVSKLGSRQEAIELLD--LASKHSFQPWV-ETIDVSEDGVHEGLTRLD 357

Query: 371 HGD 373
            GD
Sbjct: 358 RGD 360

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 187 AVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFI 245
           AV+   V+ GD V V     +GL V    +  G  K++++   D KK+ S  FG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 115/308 (37%), Gaps = 52/308 (16%)

Query: 25  IETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVT 84
           +E   V   K H+  +KI    LCH+D   L G  P     + +GHE  G +        
Sbjct: 100 LENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQRYA-MGHEICGELVQTYADEP 158

Query: 85  NVKVGDHVIPLYTAECQECKFCISGKTNLC-----GSVRATQGKGLMPDGTSRFKNSKGE 139
              VG+    +  A C  C  C  G  + C      +    Q  G+  DG          
Sbjct: 159 KYAVGELYTVVGNAPCGGCDSCKKGWESCCTANGEKACGLGQCYGIGRDG---------- 208

Query: 140 VIYHFMGCSTFSEYTVVADVSVVAI-DEKAPLDKVCLLGC-GVTTGYGAA------VKTA 191
                     ++EY  +    +V +  E     ++C +    V T Y A        KT 
Sbjct: 209 ---------GYAEYIAIDLRHLVKVPKELVNKPEICAVATDAVLTPYHAIKNIPGFAKTP 259

Query: 192 DVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDL 251
           D        V G G +GL+ +Q A + G S++I VD  D + + + + GA          
Sbjct: 260 DY----CTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA---------- 304

Query: 252 NDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
              E +  +L      G+D   D  G+T  +  A+    K  G   ++G++AAG EI   
Sbjct: 305 ---EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISAAGYEIRFP 360

Query: 312 PFQLVTGR 319
               + G+
Sbjct: 361 ALSYMLGK 368

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 106/295 (35%), Gaps = 64/295 (21%)

Query: 36  HEVRIKITHTALCHTDAYTLSGVDPEGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPL 95
           HE+ I+  +T L H D  +         FP I G E SGIV   G               
Sbjct: 72  HEILIRNKYTGLNHVDWKSKKYRFNIHSFPWINGRESSGIVVRRG--------------- 116

Query: 96  YTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTV 155
             A+    +F I  +  L  +                         Y  +  STF E+TV
Sbjct: 117 --AKVDRDRFPIGAEVFLASTC------------------------YRELKTSTFQEFTV 150

Query: 156 VADVSVVAIDEKAPLDKVCL--LGCGVTTGYGAAVKTA--------------DVQKGDTV 199
                V  +  +   D       G     G G  + TA                 +G ++
Sbjct: 151 FDSRLVWRLPREILPDGTTRKRFGLDFAAGVGVPLVTAGSALSSFVDFNEIGKADQGRSL 210

Query: 200 AVFG-AGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIV 258
            V+G + +VG+  +Q A++ G  K I+   +   + +  + GAT  I+ T      E +V
Sbjct: 211 VVWGGSSSVGIFTIQLARNLGIFKNIIAVSSLRYEDYLKELGATAVIDRTL---PSEELV 267

Query: 259 SKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWG--QSIIIGVAAAGQEISTR 311
            K  ++   G+D+  D   + K     LE    G G  +S++    A G+++  +
Sbjct: 268 QKFQELCPTGVDYGVDVI-SKKTAELVLEILKDGKGTKKSLVCLSGAPGEDVRAK 321

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 221 SKIIVVDINDDKKKWSFDFGATDFINPTK-DLNDGETIVSKLIDMTDG-GLDHTFDCTG 277
           S +I VD+ D+K + + DFGAT   N +K  +++ + +  +L  +  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 13/98 (13%)

Query: 31  DPPK--AHEVRIKITHTALCHTDAYTLSG----------VDPEGIFPSILGHEGSGIVES 78
           +P K  AH+V I++    +C ++ ++L                G    ++GHE  G V +
Sbjct: 29  EPKKFDAHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVA 88

Query: 79  VGTGVTNVKVGDHV-IPLYTAECQECKFCISGKTNLCG 115
           VG  V+  KVGD + +    + C  C  C       C 
Sbjct: 89  VGDKVSLCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>KLTH0F01056g Chr6 complement(80904..83219) [2316 bp, 771 aa] {ON}
           similar to uniprot|P25574 Saccharomyces cerevisiae
           YCL045C
          Length = 771

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 222 KIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCT 276
           KI V+D+ D ++ W+++ G  D +N     +D E ++      T  G   TFD T
Sbjct: 339 KIAVLDVRDGRQLWNYESGLKDILNIEALRSDTEVVI-----FTKSGPSLTFDIT 388

>Smik_2.3 Chr2
           complement(6099..6290,6294..6323,6327..6398,6402..6608,
           6612..6758) [648 bp, 216 aa] {OFF} YJR159W (PSEUDO)
          Length = 216

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%)

Query: 189 KTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKII 224
           K ADV+ G TV V G G V L  V  A + GA  I+
Sbjct: 64  KLADVRLGTTVVVLGTGPVSLLTVAVAHTFGAKDIV 99

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,708,448
Number of extensions: 1688252
Number of successful extensions: 4130
Number of sequences better than 10.0: 182
Number of HSP's gapped: 4023
Number of HSP's successfully gapped: 193
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)