Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47227.351ON25325313590.0
ACL147W7.351ON2462417971e-107
KLLA0D12320g7.351ON2502467132e-94
YLR201C (COQ9)7.351ON2602486907e-91
KLTH0H01232g7.351ON2572486654e-87
TDEL0C019707.351ON2602596655e-87
Kpol_530.307.351ON2602486622e-86
Suva_10.2967.351ON2602466587e-86
Kwal_56.246447.351ON2582486578e-86
Skud_12.2657.351ON2602586552e-85
ZYRO0F11726g7.351ON2512416446e-84
SAKL0F11396g7.351ON2542446412e-83
TBLA0E004507.351ON2792476042e-77
NCAS0E028707.351ON2612476013e-77
NDAI0E044707.351ON2642515935e-76
Smik_12.2607.351ON2602585901e-75
KNAG0B026207.351ON2652465822e-74
TPHA0F029807.351ON2642485701e-72
CAGL0A03949g7.351ON2682505683e-72
KAFR0L014807.351ON2642425683e-72
Kpol_458.5singletonON102257810.11
NCAS0A020104.169ON152102730.42
Kpol_1061.143.266ON530100750.45
TPHA0M01160singletonON336166720.99
Kpol_2000.112singletonON98859711.5
Kpol_1038.1singletonON56257702.1
Kpol_272.1singletonON155557684.3
Kpol_177.2singletonON128648667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4722
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   528   0.0  
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   311   e-107
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   279   2e-94
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   270   7e-91
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   260   4e-87
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   260   5e-87
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   259   2e-86
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   258   7e-86
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   257   8e-86
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   256   2e-85
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   252   6e-84
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   251   2e-83
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   237   2e-77
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   236   3e-77
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   233   5e-76
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   231   1e-75
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   228   2e-74
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   224   1e-72
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   223   3e-72
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   223   3e-72
Kpol_458.5 s458 (34795..37863) [3069 bp, 1022 aa] {ON} (34795..3...    36   0.11 
NCAS0A02010 Chr1 complement(383789..384247) [459 bp, 152 aa] {ON...    33   0.42 
Kpol_1061.14 s1061 (38888..40480) [1593 bp, 530 aa] {ON} (38888....    33   0.45 
TPHA0M01160 Chr13 complement(233141..234151) [1011 bp, 336 aa] {...    32   0.99 
Kpol_2000.112 s2000 (269017..271983) [2967 bp, 988 aa] {ON} (269...    32   1.5  
Kpol_1038.1 s1038 complement(2344..4032) [1689 bp, 562 aa] {ON} ...    32   2.1  
Kpol_272.1 s272 complement(6450..11117) [4668 bp, 1555 aa] {ON} ...    31   4.3  
Kpol_177.2 s177 complement(2318..5617,5621..6181) [3861 bp, 1286...    30   7.3  

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%)

Query: 1   MNIRCHRIMLGGFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKD 60
           MNIRCHRIMLGGFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKD
Sbjct: 1   MNIRCHRIMLGGFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKD 60

Query: 61  SAIVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKTL 120
           SAIVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKTL
Sbjct: 61  SAIVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKTL 120

Query: 121 EELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLA 180
           EELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLA
Sbjct: 121 EELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLA 180

Query: 181 WYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLL 240
           WYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLL
Sbjct: 181 WYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLL 240

Query: 241 TTVNLARSQLVRG 253
           TTVNLARSQLVRG
Sbjct: 241 TTVNLARSQLVRG 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  311 bits (797), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 146/241 (60%), Positives = 188/241 (78%), Gaps = 1/241 (0%)

Query: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73
           RR YH N+ E+AVGN LRPL Y + SPQYKVL  ALE +VP  GF + AIV AA +LGY 
Sbjct: 6   RRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYG 65

Query: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQ-EGTKTLEELFLKRLEANK 132
           SAVL+A+ A NSPA+ NV ++V ELVKFHLVTKR  L +   +G  ++E+LFL+R+EA++
Sbjct: 66  SAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQRVEADR 125

Query: 133 SLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSMAY 192
            L   L ++LSIL++PG+FLVNT +PELF+L+DD+IYYS EKD  DLAWYSKR AV+MAY
Sbjct: 126 PLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAVAMAY 185

Query: 193 ISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQLVR 252
           +ST LFMA+D SP  + T+ FA+ R+ Q+D +GTAYNN+EEFAW+QLL  +NL +SQL R
Sbjct: 186 VSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKSQLTR 245

Query: 253 G 253
           G
Sbjct: 246 G 246

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  279 bits (713), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 182/246 (73%), Gaps = 5/246 (2%)

Query: 13  FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY 72
           F R YH N+ E+A+   ++PL YG  S Q+KVL+ AL K+VP  GF + AIV + NELG 
Sbjct: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGM 64

Query: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED-----QEGTKTLEELFLKR 127
            S+ L+ +G++NSP+ FNVS SV ELVKFHLV+KR  L  D      +    L+ LFL+R
Sbjct: 65  GSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSDKPLPDLKTLFLQR 124

Query: 128 LEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLA 187
           L+ N+ + PHL ++LSI+++PG+FL +T L EL +L DDMI+YS E+D ND AWYSKR+A
Sbjct: 125 LKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIA 184

Query: 188 VSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLAR 247
           +S AY+S+ELFMA+D S NFQ TMEFA+ ++N++ ++G+ YNN EE+ WF LL+++NLA+
Sbjct: 185 LSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAK 244

Query: 248 SQLVRG 253
           SQ+ RG
Sbjct: 245 SQITRG 250

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  270 bits (690), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 131/248 (52%), Positives = 177/248 (71%), Gaps = 7/248 (2%)

Query: 13  FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY 72
           F R YH N  E+     ++PL YG+ SPQYKVL+ AL+K+VP  GF + +IV++ NELGY
Sbjct: 13  FFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGY 72

Query: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQEGTKTLEELFL 125
            S+++++IGA NSP+ F+ ST+V EL+KF LV KRY L E        Q    +LE L L
Sbjct: 73  PSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLL 132

Query: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185
           KRLE +K +G HL E++S LAIP  FL  T +PEL +L+DDMIY+S EKD +D AWY+KR
Sbjct: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192

Query: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245
           LAVS  YI ++LFMA+D S N++ T  FAK +++++  +G  YNN EEFAW+ L++TVNL
Sbjct: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252

Query: 246 ARSQLVRG 253
            +SQLVRG
Sbjct: 253 IKSQLVRG 260

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  260 bits (665), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 173/248 (69%), Gaps = 8/248 (3%)

Query: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73
           RR YH ++ E+ + ++  PL YG  S Q+KVL  AL K+VP  GF + A+V + N+L   
Sbjct: 10  RRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLG 69

Query: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKT--------LEELFL 125
            ++L+ IGA+NSP+  N S +V EL+KFHLVTKRY L ++ +  +T        LE LF 
Sbjct: 70  PSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFH 129

Query: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185
           +RLE NK + PHL ++LS L+IPG+FLV T LPEL +L+DDM+Y+S E D ND AWYSKR
Sbjct: 130 RRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKR 189

Query: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245
           +A+S A++S+ELFMA+D S N+  T EFA  +++ + ++G  YNN EE+ W+ LL +VNL
Sbjct: 190 IALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNL 249

Query: 246 ARSQLVRG 253
           A+SQL R 
Sbjct: 250 AKSQLTRS 257

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  260 bits (665), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 131/259 (50%), Positives = 179/259 (69%), Gaps = 13/259 (5%)

Query: 3   IRCHRIMLGGFRR--FYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKD 60
           I   RI   G+R   F ++N       N+  PL YG+ SPQYKVL+  L K VP  GF +
Sbjct: 7   IAGSRIFARGYRPAGFEYINPI-----NSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNE 61

Query: 61  SAIVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED------Q 114
            AIV++ NELGY S +L+ IG++N P+ F+ S ++ EL+KFHLV KR  L E+       
Sbjct: 62  RAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPV 121

Query: 115 EGTKTLEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEK 174
           +   +LE L +KRLE N  +  HL ++LS L+IPG FLV+  +PEL +L+DDMIY+STEK
Sbjct: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181

Query: 175 DFNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEF 234
           D ND AWYSKRLAVS AY+S+ELFMA+D SP+++ T EFA+ +++++  +G  YNN EEF
Sbjct: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241

Query: 235 AWFQLLTTVNLARSQLVRG 253
           AW+ LL+T+NL +SQL RG
Sbjct: 242 AWYTLLSTINLVKSQLARG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  259 bits (662), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 178/248 (71%), Gaps = 6/248 (2%)

Query: 12  GFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELG 71
           G  RFYH N  EY    TL PL+YG+ S QYK+L+ +L+  VP  GF + AIV++ N LG
Sbjct: 13  GLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLG 72

Query: 72  YNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED------QEGTKTLEELFL 125
           Y S++L+ IG++N+P+  + ST++ EL+KF+LV KRY L ED       E   +LE+L +
Sbjct: 73  YPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLI 132

Query: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185
           KRL+ +  +GPHL ++++ L+IPG FL +T LPEL +LADDMIY+S+EKD  D AWY+KR
Sbjct: 133 KRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKR 192

Query: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245
           + VS AY+S++LFMA+D SP +  T EFAK ++ +I ++G  YNN EE+AW+ L+ ++N+
Sbjct: 193 MGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINM 252

Query: 246 ARSQLVRG 253
           A+S+  RG
Sbjct: 253 AKSKAARG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  258 bits (658), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 172/246 (69%), Gaps = 7/246 (2%)

Query: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74
           R YH N  E+     ++PL YG+ SPQYKVL+ AL++YVP  GF + +IV++ N+LGY S
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 75  AVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQEGTKTLEELFLKR 127
           +++++IGA+NSP+  + ST+V EL+KF LV KRY L E             +LE L LKR
Sbjct: 75  SMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134

Query: 128 LEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLA 187
           LE +K +G  L +++S LAIP  FL  T +PEL +L+DDMIY+S EKD +D AWY+KRLA
Sbjct: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 188 VSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLAR 247
           VS  YI ++LFMA+D S +F  T  FAK +++++  +G  YNN EEFAW+ L++TVNL +
Sbjct: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 248 SQLVRG 253
           SQL RG
Sbjct: 255 SQLARG 260

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  257 bits (657), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 170/248 (68%), Gaps = 8/248 (3%)

Query: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73
           RRFY  N  EY +   L PL YG  S Q+KVL+ AL+ +VP  GF + A+V + N+LG  
Sbjct: 11  RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLG 70

Query: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTK--------TLEELFL 125
           S VL++IGA NSP + N S +V ELVKFHLVTKRY L +D +  +         LE LF 
Sbjct: 71  SQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFH 130

Query: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185
           KRLE N  +  H+ ++L+ILA+PG+FL+ + LPEL +L+DDMIY+S E D ND AWYSKR
Sbjct: 131 KRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKR 190

Query: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245
            A+S A++S+ELFMA+D SPN+  T EFA  +++ + ++G  Y N EE+ W+ LL +VNL
Sbjct: 191 AAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNL 250

Query: 246 ARSQLVRG 253
           A+SQ+ R 
Sbjct: 251 AKSQITRS 258

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  256 bits (655), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 177/258 (68%), Gaps = 9/258 (3%)

Query: 5   CHRIMLGG--FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSA 62
           C  +   G  F R YH N  E+     ++PL YG+ SPQYKVL+ AL +YVP  GF + +
Sbjct: 3   CRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERS 62

Query: 63  IVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQE 115
           IV++ N+LGY S+++++IGA+NSP+ F+ ST+V ELVKF LV KRY L E        + 
Sbjct: 63  IVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRY 122

Query: 116 GTKTLEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKD 175
              +LE L LKRLE +K +G  L +++S LA+P   L  T +PEL +L+DDMIY+S E+D
Sbjct: 123 KLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEED 182

Query: 176 FNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFA 235
            +D AWY+KRLAVS  YI ++LFMA+D S +F+ T  FAK +++++  +G  YNN EEFA
Sbjct: 183 HHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFA 242

Query: 236 WFQLLTTVNLARSQLVRG 253
           W+ L++TVNL +SQL RG
Sbjct: 243 WYTLMSTVNLVKSQLARG 260

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  252 bits (644), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 170/241 (70%), Gaps = 2/241 (0%)

Query: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74
           R YH +  E+   + L PL YG  SPQY VL+ AL+  VP  GF + AIV + N+L Y S
Sbjct: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70

Query: 75  AVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED--QEGTKTLEELFLKRLEANK 132
            +L+ IGA+NSP++ + S +V ELVKFHLV KR  L +D   E   +LE+LF+KRLE N 
Sbjct: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLEDLFIKRLELNV 130

Query: 133 SLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSMAY 192
            +  HL ++LS +++PG F V+T LPEL +L+DD+IYYS EKD +D AWYSKRL +S AY
Sbjct: 131 PIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLGISCAY 190

Query: 193 ISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQLVR 252
           +S+ELFMA+D S N++ T +FA+ ++ +  ++G  YNN EE+ W+ LL ++NLA+SQ+ R
Sbjct: 191 VSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAKSQMAR 250

Query: 253 G 253
           G
Sbjct: 251 G 251

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  251 bits (641), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 180/244 (73%), Gaps = 4/244 (1%)

Query: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73
           RR YH N+ E+A    L PLIY + SPQ+K+L  AL++ VP  GF + A+  + ++LGY+
Sbjct: 11  RRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYS 70

Query: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED-QEGT---KTLEELFLKRLE 129
           S+ L+ +GA+NSP+ FN S +V EL+KFHLV+KRY L +   +GT    +LE LFLKRLE
Sbjct: 71  SSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLKRLE 130

Query: 130 ANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVS 189
            NK +  HL ++LS LA+PG FL    +PEL +L+DDM+Y+S E D ND AWYSKRLA+S
Sbjct: 131 MNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLAIS 190

Query: 190 MAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQ 249
            AY+S+ELFMA+D S ++Q T++FAK ++  I ++G AYNN+EE+AW+ LL++++LA+SQ
Sbjct: 191 TAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAKSQ 250

Query: 250 LVRG 253
           + R 
Sbjct: 251 MTRS 254

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  237 bits (604), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 175/247 (70%), Gaps = 5/247 (2%)

Query: 11  GGFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANEL 70
            G R +Y V S +    + L PL+YG+ S QY++L  A++  VP  GF + AI+++ N+L
Sbjct: 34  NGIRTYYSV-SNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKL 92

Query: 71  GYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE----DQEGTKTLEELFLK 126
           GYNS++++ +G++N+  + + S +V EL+KF+LV+KR  L E    + +   +LE L LK
Sbjct: 93  GYNSSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKDLPSLEYLLLK 152

Query: 127 RLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRL 186
           RL+ +K++   L E+++ L+IPG FL  T +PELF+L+DDMIY+S EKD +D+AWYSKRL
Sbjct: 153 RLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRL 212

Query: 187 AVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLA 246
           AVS  YI++++FMA+D+S +   T+EFA+ ++N++  +G  YNN EEF WF L+T+VN+ 
Sbjct: 213 AVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIV 272

Query: 247 RSQLVRG 253
           +SQL R 
Sbjct: 273 KSQLARS 279

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  236 bits (601), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 174/247 (70%), Gaps = 8/247 (3%)

Query: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74
           R YH +  EY    TL PL Y + S QYK+L+ AL K+VP  GFK+ AI D+ NELG++S
Sbjct: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74

Query: 75  AVLAAIGANNSPAMF-NVSTSVQELVKFHLVTKRYGLQED-------QEGTKTLEELFLK 126
           ++L+ IGA+NSPA+F ++S +V EL+KF LV+KRY L E+       +    +LE L LK
Sbjct: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTPKNELPSLESLLLK 134

Query: 127 RLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRL 186
           RLE +K++G  +  + + LA P  FL +  LPEL +L+DDMIY+S EKD +D+AWY+KRL
Sbjct: 135 RLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194

Query: 187 AVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLA 246
            VS AY+S++L+MA+D+S +F+ T+ FAK ++++I ++G  YNN EE+AW+  + + NL 
Sbjct: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254

Query: 247 RSQLVRG 253
           R++L R 
Sbjct: 255 RARLARS 261

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  233 bits (593), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 170/251 (67%), Gaps = 9/251 (3%)

Query: 12  GFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELG 71
              R +H N+ EYA   TL PL Y + S QYK+L+ AL K+VP KGF D AI  + NEL 
Sbjct: 14  SINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELD 73

Query: 72  YNSAVLAAIGANNSPAMF-NVSTSVQELVKFHLVTKRYGLQED--------QEGTKTLEE 122
            +S++ + +G++NSP++F ++S +V EL+KF LV+KRY L E+        ++   +LE 
Sbjct: 74  LSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLET 133

Query: 123 LFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWY 182
           L ++RL+ ++ L   L  + + L IP   L N  LPELF L+DD+IY+S EKD +D+AWY
Sbjct: 134 LLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWY 193

Query: 183 SKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTT 242
           +KRL VS AY+S++L+M K++  NF  T++FAK ++++I  +G  YNN EE+AW+ L+ +
Sbjct: 194 AKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVS 253

Query: 243 VNLARSQLVRG 253
           +NL +++L RG
Sbjct: 254 MNLVKARLARG 264

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  231 bits (590), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 181/258 (70%), Gaps = 9/258 (3%)

Query: 5   CHRIMLGGFR--RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSA 62
           C  I+  G    R YH N  E+   + ++PL YG+ SPQYKVL+ ALE+YVP  GF + +
Sbjct: 3   CRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERS 62

Query: 63  IVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQE 115
           IV++ NELGY S+++++I A+NSP+ F+ ST+V EL+KF LV KRY L E        Q 
Sbjct: 63  IVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQY 122

Query: 116 GTKTLEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKD 175
              +LE L L+RLE +K +G  L E++S LAIP  FL  T +PEL +L+DDMIY+S EKD
Sbjct: 123 KLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKD 182

Query: 176 FNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFA 235
            +D AWY+KRLAVS  YI ++LFMA+D S N++ T +FAK ++N++  +G  YNN EEFA
Sbjct: 183 HHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFA 242

Query: 236 WFQLLTTVNLARSQLVRG 253
           W+ L++TVNL +SQLVRG
Sbjct: 243 WYTLMSTVNLVKSQLVRG 260

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  228 bits (582), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 164/246 (66%), Gaps = 8/246 (3%)

Query: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74
           R YH N  EYA    + PL Y   SPQ ++L   L+  VP  GF + A++ +   +GY+S
Sbjct: 19  RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYDS 78

Query: 75  AVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED--------QEGTKTLEELFLK 126
           ++++ +GA+NSP++F+ S +V ELVKF+LV KR+ L E              +LE L +K
Sbjct: 79  SMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHLLVK 138

Query: 127 RLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRL 186
           RL+ +  L   L ++ + LA+P  F+VN  +PELF+L+DDMIY+S EKD  D AWYSKRL
Sbjct: 139 RLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRL 198

Query: 187 AVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLA 246
            VS+AY +++LFMA+D+S N Q T+EFA+ ++++I  +G  YNN+EE+AW+ ++TTVN A
Sbjct: 199 GVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRA 258

Query: 247 RSQLVR 252
           ++   R
Sbjct: 259 KAGFSR 264

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  224 bits (570), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 169/248 (68%), Gaps = 9/248 (3%)

Query: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY-- 72
           RF+H  + EY + N L P  Y + SPQ+K+L+ A++  V   GF + AI++A  EL    
Sbjct: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76

Query: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQEGTKTLEELFL 125
            S +L+AIG++NSP+  + S SV EL+KF+LV KRY + E        QE   +LE L L
Sbjct: 77  QSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSLESLLL 136

Query: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185
           KRLE +  +G H+   +S L IPG FL+++ LPEL +LADDMIY+S EKD +D AWYSKR
Sbjct: 137 KRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196

Query: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245
           L VS AYIS++LFMA+D+S N++ T++FAK ++ ++  +G  YNN EE+AW+ LL +VN+
Sbjct: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256

Query: 246 ARSQLVRG 253
            +S++ R 
Sbjct: 257 VKSRMSRA 264

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  223 bits (568), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 159/250 (63%), Gaps = 7/250 (2%)

Query: 9   MLGGFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAAN 68
           +L   RR YH  S EY       PL Y   SP++K+L+  +E  VP  GF + AIV++ N
Sbjct: 19  LLSAVRR-YHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLN 77

Query: 69  ELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRY----GLQEDQEGTK--TLEE 122
            +   S +L  IGA+NS    + S +V EL+KF LV KR+    G+ E  E +K  +LE 
Sbjct: 78  AMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASKLPSLES 137

Query: 123 LFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWY 182
           L LKRL+ +  +  HL ++ + L +P  F+ N  LPEL +LADDMIYYS EKD +D AWY
Sbjct: 138 LLLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWY 197

Query: 183 SKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTT 242
           +KR A++  Y++++ FMA+D S NF  TMEFA+ +++++  +G  YNN+EEF WF L++ 
Sbjct: 198 TKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSA 257

Query: 243 VNLARSQLVR 252
           VNL +SQ+ R
Sbjct: 258 VNLTKSQMAR 267

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  223 bits (568), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 108/242 (44%), Positives = 164/242 (67%), Gaps = 2/242 (0%)

Query: 13  FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGY 72
            RR YH  S EY    T+ PL Y   S Q K+L+ +L++YVP  GF + +I+ + N+LGY
Sbjct: 22  LRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGY 81

Query: 73  NSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKTLEELFLKRLEA-- 130
           +S++++ IGA+NSP+  + S +V EL+K++LV+KR  L +D     T     L       
Sbjct: 82  SSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTTTLKELLLKRLEM 141

Query: 131 NKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSM 190
           +  +   L+ + + LA PG F+ +  LPELFQLADDMI++S EKD +D+AWYSKRLAVSM
Sbjct: 142 DIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAVSM 201

Query: 191 AYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQL 250
           AY+++++FM +D+S NFQ TM+FA  +++++  +G  YNN+EE+AWF L+ ++NL +SQ 
Sbjct: 202 AYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKSQF 261

Query: 251 VR 252
            R
Sbjct: 262 SR 263

>Kpol_458.5 s458 (34795..37863) [3069 bp, 1022 aa] {ON}
           (34795..37863) [3069 nt, 1023 aa]
          Length = 1022

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 166 DMIYYSTEKDFNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQID 222
           D+ YY+T  D  ++ WY+    V ++ I  E  + KD S +    ++  +G IN ID
Sbjct: 386 DLTYYAT--DNKNILWYNFVKNVPLSRIDKEFILTKDRSESITLALQLVEGIINTID 440

>NCAS0A02010 Chr1 complement(383789..384247) [459 bp, 152 aa] {ON}
           Anc_4.169 YGR030C
          Length = 152

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 102 HLVTKRYGLQEDQEGTKTLEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELF 161
           H V K  GL E  EG   LE           + GPHL+++LSIL I    +         
Sbjct: 52  HTVDKLQGLLESTEGFVCLE-----------AHGPHLQKMLSILEITKKVIKEKDTSTTI 100

Query: 162 QLADDMI-YYSTEKDFNDLAWYSKRLAVSMAYISTELFMAKD 202
              + M+ + S +   N+L      + + + +IST   +A D
Sbjct: 101 HQWNRMLSFQSIQPGRNELLERKINIPILICFISTSSDLAND 142

>Kpol_1061.14 s1061 (38888..40480) [1593 bp, 530 aa] {ON}
           (38888..40480) [1593 nt, 531 aa]
          Length = 530

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 2   NIRCHRIMLGGFRRFYHVNSAEYAVGNTLRPL--IYGRCSPQYKVLNCALEKYVPFKGFK 59
           NI   R+ +G    ++HVN+ ++  G    PL  +Y + +P  K+ N     YV  K + 
Sbjct: 148 NITALRVPIG----YWHVNNGQFVDGTPFAPLKSVYQKAAPWDKLKNLI---YVA-KQYG 199

Query: 60  DSAIVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELV 99
              +VD     G  ++  A+   NN P  F   T + ++V
Sbjct: 200 IGILVDVHGLPGGANSSDASGSINNPPTFFKNPTYISKMV 239

>TPHA0M01160 Chr13 complement(233141..234151) [1011 bp, 336 aa] {ON}
           
          Length = 336

 Score = 32.3 bits (72), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 63/166 (37%), Gaps = 37/166 (22%)

Query: 83  NNSPAMFNVSTSVQELVKFHLVTKRYGLQED----------QEGTKTLEELFL------- 125
           NN    F + + + +L  F    K++G + D          +EG    E  +L       
Sbjct: 45  NNPNLSFEIISDITKLDAFDETLKKHGKEIDNVIHMASPLPEEGNTDFENHYLLPAVNGT 104

Query: 126 -KRLEANKSLGPH-LKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYS 183
              L A K   P  +K V+   +I     VN           D    +TEKD+N + W  
Sbjct: 105 KSILSAIKKFAPRSVKHVVMTSSIAAIINVN-----------DFSVVTTEKDWNPITWEQ 153

Query: 184 KRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYN 229
            + +  M Y+ ++ +  K       A  +F K   +++D   TA N
Sbjct: 154 AKTSSFMCYLGSKTYSEK-------AAWDFLKENKDEVDFKFTAVN 192

>Kpol_2000.112 s2000 (269017..271983) [2967 bp, 988 aa] {ON}
           (269017..271983) [2967 nt, 989 aa]
          Length = 988

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 164 ADDMIYYSTEKDFNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQID 222
           + D+ Y +T  D  ++ WY+    V ++ I  E  + KD S +   T++  +G I  ID
Sbjct: 384 SQDLTYDAT--DNKNILWYNFVKNVPLSRIDKEFILTKDRSESITLTLQLVEGIIKSID 440

>Kpol_1038.1 s1038 complement(2344..4032) [1689 bp, 562 aa] {ON}
           complement(2344..4032) [1689 nt, 563 aa]
          Length = 562

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 166 DMIYYSTEKDFNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQID 222
           D+ Y +T  D  ++ WY+    V ++ I  E  + KD S +    ++  +G IN ID
Sbjct: 13  DLTYDAT--DNKNILWYNFVKNVPLSRIDKEFILTKDRSESITLALQLVEGIINTID 67

>Kpol_272.1 s272 complement(6450..11117) [4668 bp, 1555 aa] {ON}
            complement(6450..11117) [4668 nt, 1556 aa]
          Length = 1555

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 166  DMIYYSTEKDFNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQID 222
            D+ Y  T  D  ++ WY+    V ++ I  E  + KD S +   T++  +G I  ID
Sbjct: 1006 DLTYDVT--DNKNILWYNFVKNVPLSRIDKEFILTKDRSESITLTLQLVEGIIKSID 1060

>Kpol_177.2 s177 complement(2318..5617,5621..6181) [3861 bp, 1286
           aa] {ON} complement(2318..5617,5621..6181) [3861 nt,
           1287 aa]
          Length = 1286

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 175 DFNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQID 222
           D  ++ WY+    V ++ I  E  + KD S +   T++  +G I  ID
Sbjct: 694 DDKNIFWYNFVKNVPLSRIDKEFILTKDRSESITLTLQLVEGIIKSID 741

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,510,042
Number of extensions: 1058562
Number of successful extensions: 2854
Number of sequences better than 10.0: 38
Number of HSP's gapped: 2914
Number of HSP's successfully gapped: 38
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)