Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47217.352ON1071075322e-71
ACL146C7.352ON1071074151e-53
KLLA0D12298g7.352ON1151073855e-49
KAFR0L014907.352ON1071053663e-46
ZYRO0F11748g7.352ON1091053603e-45
TDEL0C019607.352ON1071013579e-45
YLR200W (YKE2)7.352ON1141033473e-43
TBLA0E004407.352ON1151033473e-43
NDAI0E044607.352ON1061013464e-43
Suva_10.2957.352ON1141033465e-43
TPHA0F029907.352ON1071023431e-42
Kpol_530.297.352ON1071023412e-42
KNAG0B026107.352ON119993405e-42
CAGL0A03971g7.352ON1061033371e-41
SAKL0F11418g7.352ON1151073362e-41
Smik_12.2597.352ON1141053353e-41
Skud_12.2647.352ON1141013266e-40
NCAS0E028607.352ON1051013241e-39
Kwal_56.246487.352ON1131023213e-39
KLTH0H01210g7.352ON1131033041e-36
NDAI0I019606.73ON60850680.58
TDEL0F045108.326ON74339680.60
KLLA0F03355g2.245ON29535670.67
YIL129C (TAO3)2.232ON237670661.0
YOR320C (GNT1)8.798ON49144651.4
CAGL0A03058g5.453ON79273651.4
Skud_9.382.232ON237370641.9
KAFR0D004301.46ON45629632.3
Kwal_23.40103.425ON87450632.8
ZYRO0D09658gsingletonON55248623.0
Smik_9.402.232ON238770623.1
Kpol_1039.612.101ON129104613.1
Kpol_1009.36.73ON47977623.3
ZYRO0F01166g2.591ON74846623.4
TDEL0G039906.73ON58850623.5
KAFR0A049606.73ON59152623.6
NDAI0A082507.139ON11397603.7
Skud_15.4888.798ON49057623.9
ZYRO0D14388g6.73ON58350614.7
KAFR0K023806.233ON112486614.8
TPHA0K011206.73ON60450606.1
YEL003W (GIM4)7.139ON11199586.6
CAGL0F04983g6.73ON59550606.8
TBLA0J017307.139ON11151586.9
ZYRO0G05324g2.101ON12965587.0
Kpol_479.38.604ON79545607.0
Ecym_44897.139ON11363578.6
NCAS0A002701.23ON87780598.9
Smik_5.1107.139ON10594579.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4721
         (107 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   209   2e-71
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   164   1e-53
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   152   5e-49
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   145   3e-46
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   143   3e-45
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   142   9e-45
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   138   3e-43
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   138   3e-43
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   137   4e-43
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   137   5e-43
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   136   1e-42
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   135   2e-42
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   135   5e-42
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   134   1e-41
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   134   2e-41
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   133   3e-41
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   130   6e-40
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   129   1e-39
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   128   3e-39
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   121   1e-36
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73      31   0.58 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    31   0.60 
KLLA0F03355g Chr6 (316145..317032) [888 bp, 295 aa] {ON} similar...    30   0.67 
YIL129C Chr9 complement(106107..113237) [7131 bp, 2376 aa] {ON} ...    30   1.0  
YOR320C Chr15 complement(913619..915094) [1476 bp, 491 aa] {ON} ...    30   1.4  
CAGL0A03058g Chr1 (313662..316040) [2379 bp, 792 aa] {ON} some s...    30   1.4  
Skud_9.38 Chr9 complement(83199..90320) [7122 bp, 2373 aa] {ON} ...    29   1.9  
KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}...    29   2.3  
Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {O...    29   2.8  
ZYRO0D09658g Chr4 (820293..821951) [1659 bp, 552 aa] {ON} no sim...    28   3.0  
Smik_9.40 Chr9 complement(83938..91101) [7164 bp, 2387 aa] {ON} ...    28   3.1  
Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {...    28   3.1  
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    28   3.3  
ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON...    28   3.4  
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...    28   3.5  
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...    28   3.6  
NDAI0A08250 Chr1 (1891840..1892181) [342 bp, 113 aa] {ON} Anc_7....    28   3.7  
Skud_15.488 Chr15 complement(853334..854806) [1473 bp, 490 aa] {...    28   3.9  
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...    28   4.7  
KAFR0K02380 Chr11 complement(487938..491312) [3375 bp, 1124 aa] ...    28   4.8  
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....    28   6.1  
YEL003W Chr5 (148176..148194,148283..148599) [336 bp, 111 aa] {O...    27   6.6  
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...    28   6.8  
TBLA0J01730 Chr10 (383174..383192,383290..383606) [336 bp, 111 a...    27   6.9  
ZYRO0G05324g Chr7 complement(429815..430204) [390 bp, 129 aa] {O...    27   7.0  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    28   7.0  
Ecym_4489 Chr4 complement(988430..988746,988825..988849) [342 bp...    27   8.6  
NCAS0A00270 Chr1 (37484..40117) [2634 bp, 877 aa] {ON} Anc_1.23        27   8.9  
Smik_5.110 Chr5 (152227..152541) [315 bp, 105 aa] {ON} YEL003W (...    27   9.9  

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  209 bits (532), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60
           MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP
Sbjct: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60

Query: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
           VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS
Sbjct: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  164 bits (415), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 84/107 (78%), Positives = 93/107 (86%)

Query: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60
           MS EQVA KYTQLQGELE+L+VTRQKLETQLQENKIVNEELQ+L+ + QVYKLTGGVLLP
Sbjct: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60

Query: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
           VE EEA  NVSKRLEFI+GEI RCE NIK KQ+E+E AR  L+KLR 
Sbjct: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  152 bits (385), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 88/107 (82%)

Query: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60
           MS E+   KYT+LQGELE+LIV RQKLETQLQENKIV++E  SLK+D  VYKLTGGVLLP
Sbjct: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60

Query: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
           VE  EA  NV KRLEFI+ EI RCE NIK+KQQELE AR EL+KLRS
Sbjct: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  145 bits (366), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 73/105 (69%), Positives = 89/105 (84%)

Query: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62
           + ++AA+Y +LQ ELE+LIV RQKLETQLQENKIVN+E +SLKE+ QVYKLTG VLLP+E
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
            +EA  NV KRLEFI+ EI RCEGNIK+KQ E+E  R+EL+KLRS
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRS 105

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  143 bits (360), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 72/105 (68%), Positives = 86/105 (81%)

Query: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62
           + ++AA+Y +LQGELE  IV RQKLETQLQENKIV++E   LK D +VYKLTG VLLPVE
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
            ++A +NVSKRLEFIQ EIDRCE NIK KQ+E E+ + ELIKLRS
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRS 105

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  142 bits (357), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 81/101 (80%)

Query: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65
           +AA Y  LQ ELE L++ RQKLETQLQENKIV+EE   LKED QVYKLTG VLLPVE  E
Sbjct: 4   LAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSE 63

Query: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLR 106
           ANSNV+KRLEFIQ EI RCE N+K KQQE E+ R ELIKLR
Sbjct: 64  ANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLR 104

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  138 bits (347), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 82/103 (79%)

Query: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62
           + ++ AKY QLQ ELE+ IV RQKLETQLQENKIVNEE   L+ED  VYKLTG VLLPVE
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105
             EA +NV KRLEFI+ EI RCE NI++KQ+ELE+ R ELIKL
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  138 bits (347), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (78%)

Query: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60
           MS  ++A KY   Q ELE  IVTRQKLETQLQENKIVN+E + LKE+ +V+KLTG VLLP
Sbjct: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60

Query: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELI 103
           +E +EA SN+ KRLEFIQ EIDRCE NIK KQ E+E+ R EL+
Sbjct: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  137 bits (346), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 80/101 (79%)

Query: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65
           + +KY  LQGELE LI+ RQKLETQLQENKIV EE   L  + QVYKLTG VLLPV+ EE
Sbjct: 5   LPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQEE 64

Query: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLR 106
           A+SNV KRLEFIQ EI RCE NIKNKQQEL+  R E++K+R
Sbjct: 65  AHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  137 bits (346), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 80/103 (77%)

Query: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62
           + ++ AKY  LQ ELE+ IV RQKLETQLQENKIVNEE   LKED  VYKLTG VLLPVE
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105
             EA  NV KRLEFI+ EI RCE NI+ KQ+ELEQ R+EL+KL
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  136 bits (343), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 80/102 (78%)

Query: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65
           VAAKY  +QGELE+LI+ RQKLETQLQENKIVN+E   L ED  +YKLTG V+LP+E  E
Sbjct: 4   VAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFE 63

Query: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
           A SNV KRLEFI+ EI RCE NIK KQ EL++ R EL+K+R 
Sbjct: 64  AKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRG 105

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  135 bits (341), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 83/102 (81%)

Query: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65
           +A KY ++QGELE++IV R++LETQLQENKIVNEE + LKED QVYKLTG VLLPVE  E
Sbjct: 4   LANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFE 63

Query: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
           A SNV KRLEFI+ EI +CE NIK+KQ EL + RDEL+K R 
Sbjct: 64  ARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  135 bits (340), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 70/99 (70%), Positives = 79/99 (79%)

Query: 7   AAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEA 66
           AAKY + Q  LE+LIV RQKLETQLQENKIV EE  +LKED +VYKLTG VLLPV+ +EA
Sbjct: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64

Query: 67  NSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105
            +NV KRLEFI GEIDRCE NIK KQ+ LE  R EL+KL
Sbjct: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  134 bits (337), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60
           MS E + AKY  LQ ELE+L+  RQKLETQLQENKIVNEE  +LKED  VYKLTG VLLP
Sbjct: 1   MSAE-LGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLP 59

Query: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELI 103
           VEH++A +NV KRLEFI  EI RCE NI++KQQELE  R +LI
Sbjct: 60  VEHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  134 bits (336), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 87/107 (81%)

Query: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60
           ++ ++++ +YT +Q ELE L++ RQKLETQLQENKIV +E  +L+++ QVYKLTGGVLLP
Sbjct: 4   LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63

Query: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
           VE EEA  NV KRL+FI+ EI RCE NIK KQ +LE+ R+EL++LR+
Sbjct: 64  VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRT 110

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  133 bits (335), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 82/105 (78%)

Query: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62
           + ++  KY  LQGELE+ IV RQKLETQLQENKIVNEE   L+E+  VYKLTG VLLPV+
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107
             EA  NV KRLEFI+ EI RCE NIK+KQ++LE+ R++LIKL +
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNN 105

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  130 bits (326), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%)

Query: 5   QVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHE 64
           ++ A+Y  LQ ELE+ IV RQKLETQLQENKIVNEE   + +D  VYKLTG VLLPVE  
Sbjct: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62

Query: 65  EANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105
           EA  NV KRLEFI+ EI RCE NI+ KQ ELE+ R+ELIKL
Sbjct: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  129 bits (324), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%)

Query: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65
           + A+Y  LQ ELE  I+ RQKLETQLQENKIV +E + L ++ +VYKLTG VLLPVE +E
Sbjct: 4   LPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVEQDE 63

Query: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLR 106
           A SNV KRLEFIQ EI +CE NIK KQ+ELE+ R E+IK+R
Sbjct: 64  ARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMR 104

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  128 bits (321), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 77/102 (75%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPV 61
           S +++   YT  Q ELE+L+  RQ+LETQLQENKIV +E  SLKE+ QVYKLTG VLLPV
Sbjct: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63

Query: 62  EHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELI 103
           E  EA SNVSKRLEFI  EI RCE NIKNKQ  LE+ R EL+
Sbjct: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELL 105

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  121 bits (304), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 76/103 (73%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPV 61
           S + +   Y   Q ELE+L++ RQKLETQLQENKIV +E   L+E+ QVYKLTG VLLPV
Sbjct: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63

Query: 62  EHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIK 104
           E  EA SNVSKRLEFI  EI+RCE NIK KQ  LE+ R EL++
Sbjct: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106

>NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73
          Length = 608

 Score = 30.8 bits (68), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 35/50 (70%), Gaps = 4/50 (8%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVY 51
           +V QVA +  +++ EL+Q ++T +KL+   +EN    +ELQSL+ DK+++
Sbjct: 500 AVTQVAVREARIK-ELKQELLTSEKLKRHFEENP---KELQSLRHDKELH 545

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 30.8 bits (68), Expect = 0.60,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 12  QLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQV 50
           QL+  LE+     ++LE QLQENK+  E LQ + +++++
Sbjct: 171 QLRLALERQHEVNKRLEQQLQENKLQQERLQRVLDEQEM 209

>KLLA0F03355g Chr6 (316145..317032) [888 bp, 295 aa] {ON} similar to
           uniprot|P53944 Saccharomyces cerevisiae YNL063W MTQ1
          Length = 295

 Score = 30.4 bits (67), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 3/35 (8%)

Query: 68  SNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDEL 102
           +N+ +RL ++  E   C GNI + +QEL   ++EL
Sbjct: 13  ANIDRRLPYLLFE---CSGNISDAKQELSWIKNEL 44

>YIL129C Chr9 complement(106107..113237) [7131 bp, 2376 aa] {ON}
           TAO3Component of the RAM signaling network that is
           involved in regulation of Ace2p activity and cellular
           morphogenesis, interacts with protein kinase Cbk1p and
           also with Kic1p
          Length = 2376

 Score = 30.0 bits (66), Expect = 1.0,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 20  LIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEANSNVSKRLEFIQ- 78
           LI+  + LE  L+E +  N+E     E+K+   L G  LLP++ E+  SN +++LE+   
Sbjct: 876 LILYVELLECWLEEFQSSNKE-----ENKKETGLDGIRLLPIDAEQEESNETEKLEWKNT 930

Query: 79  -GEIDRCEGN 87
              I+  EGN
Sbjct: 931 VTVIEEVEGN 940

>YOR320C Chr15 complement(913619..915094) [1476 bp, 491 aa] {ON}
           GNT1N-acetylglucosaminyltransferase capable of
           modification of N-linked glycans in the Golgi apparatus
          Length = 491

 Score = 29.6 bits (65), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 40  ELQSLKEDKQVYKLTGGVLLPVEHEEANSNVSKRLEFIQGEIDR 83
           ++Q++ ED+ V KL   ++ P +    N +++K L F Q E DR
Sbjct: 150 KIQAIDEDQVVIKLIDNIVKPKDTTPWNESLTKLLVFNQTEFDR 193

>CAGL0A03058g Chr1 (313662..316040) [2379 bp, 792 aa] {ON} some
           similarities with uniprot|Q06407 Saccharomyces
           cerevisiae YDR379w RGA2
          Length = 792

 Score = 29.6 bits (65), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 10/73 (13%)

Query: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60
           + + ++      L  E+E L VTR+ L           +E++SLK DK+   L+   +  
Sbjct: 446 LEIRELTLSKKHLVDEIEHLTVTRENLL----------QEVESLKHDKEKSSLSSFEIFD 495

Query: 61  VEHEEANSNVSKR 73
               E NS  S++
Sbjct: 496 SHQGETNSQTSRK 508

>Skud_9.38 Chr9 complement(83199..90320) [7122 bp, 2373 aa] {ON}
           YIL129C (REAL)
          Length = 2373

 Score = 29.3 bits (64), Expect = 1.9,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 20  LIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEANSNVSKRLEFIQ- 78
           L++  + LE  L+E +  N+E     E+K+   L G  LLPV+ E+  SN +++LE+   
Sbjct: 873 LMLYVELLECWLEEFQSSNKE-----ENKKETGLDGIRLLPVDPEQEESNETQKLEWKNT 927

Query: 79  -GEIDRCEGN 87
              I+  EGN
Sbjct: 928 VTVIEEVEGN 937

>KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}
           Anc_1.46 YCL029C
          Length = 456

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 4/29 (13%)

Query: 74  LEFIQGEIDRCEGNIKNKQQELEQARDEL 102
           LE IQ  ID CE NI+    E+EQ RD+L
Sbjct: 211 LEEIQPTIDACENNIR----EIEQERDQL 235

>Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {ON}
           YGR089W - putative partner of Rpb8p [contig 255] FULL
          Length = 874

 Score = 28.9 bits (63), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYK 52
           VE+ + K  +LQ EL QLI  R K+  + Q+   + +E+    ED + +K
Sbjct: 775 VEEHSLKLVKLQQELTQLIAKRDKMNVKQQK---LRKEVSQCTEDMENFK 821

>ZYRO0D09658g Chr4 (820293..821951) [1659 bp, 552 aa] {ON} no
           similarity
          Length = 552

 Score = 28.5 bits (62), Expect = 3.0,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 24  RQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEANSNVS 71
           R   E ++ EN+I N    S+++ +Q +   GG + P+EH   +S ++
Sbjct: 85  RLHKEEKVVENQIKNSVTASVEKPQQFHLRDGGTVSPIEHGAKDSTIT 132

>Smik_9.40 Chr9 complement(83938..91101) [7164 bp, 2387 aa] {ON}
           YIL129C (REAL)
          Length = 2387

 Score = 28.5 bits (62), Expect = 3.1,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 20  LIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEANSNVSKRLEFIQ- 78
           L++  + LE  L+E +  N+E     E+K+   L G  LLP++ E+  SN +++LE+   
Sbjct: 887 LMLYVELLECWLEEFQSSNKE-----ENKKETGLDGIRLLPIDPEQEESNETEKLEWKNT 941

Query: 79  -GEIDRCEGN 87
              I+  EGN
Sbjct: 942 VTVIEEVEGN 951

>Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {ON}
           complement(169465..169854) [390 nt, 130 aa]
          Length = 129

 Score = 28.1 bits (61), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 11/104 (10%)

Query: 6   VAAKYTQLQGELEQLIVTRQKLETQLQ---ENKI----VNEELQSLKEDKQVYKLTGGVL 58
           V+ K  QL  E  +LI+ +  +E QL    E K     V+ E++ + ED+ V+   G V 
Sbjct: 14  VSYKDQQLINEFSKLIMRKDSIEEQLNLQNEEKSYLEDVSLEIELIDEDQLVHYKIGDVF 73

Query: 59  LPVEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDEL 102
           L +  EE  + +    E I  +ID    N++N + E++    EL
Sbjct: 74  LMLPQEEVVNLLESDTEVIDSKID----NLQNSKSEIDDRLKEL 113

>Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON}
           complement(4730..6169) [1440 nt, 480 aa]
          Length = 479

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 12/77 (15%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVY--------KL 53
           +V QVA +  +++ EL+  ++  +KL+   +EN    +ELQSL+ DK+++        K 
Sbjct: 371 AVTQVAIREARVK-ELKDELLASEKLKRHFEENP---QELQSLRHDKELHPSRVQQHLKR 426

Query: 54  TGGVLLPVEHEEANSNV 70
               LLP E  E    V
Sbjct: 427 VPDYLLPAEAREGKKKV 443

>ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON}
           similar to uniprot|Q05080 Saccharomyces cerevisiae
           YMR032W HOF1 Bud neck-localized SH3 domain-containing
           protein required for cytokinesis
          Length = 748

 Score = 28.5 bits (62), Expect = 3.4,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 7/46 (15%)

Query: 4   EQVAAKYTQLQGELEQLIVTR-------QKLETQLQENKIVNEELQ 42
           EQ+ A+YT L G++E+L V +       + LE +LQE ++   +LQ
Sbjct: 110 EQLQARYTTLSGKVERLRVDKYNKKVGCENLEKRLQEAQVRARDLQ 155

>TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.73
           YLR276C
          Length = 588

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 4/50 (8%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVY 51
           +V QVA +  +++ EL+Q ++   KL+   +EN    +ELQSL+ DK+++
Sbjct: 484 AVTQVAVREARIK-ELKQELLASDKLKRHFEENP---QELQSLRHDKELH 529

>KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.73
           YLR276C
          Length = 591

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 35/52 (67%), Gaps = 4/52 (7%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKL 53
           +V QVA +  +++ EL++ ++  +KL+   +EN    +ELQSL+ DK+++ +
Sbjct: 484 AVTQVAVREARIK-ELKEELLASEKLKRHFEENP---KELQSLRHDKELHPM 531

>NDAI0A08250 Chr1 (1891840..1892181) [342 bp, 113 aa] {ON} Anc_7.139
           YEL003W
          Length = 113

 Score = 27.7 bits (60), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 14/97 (14%)

Query: 9   KYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEANS 68
           KY + +  LEQL     +L     E+ IV + L++   +++ Y++ GG L+        S
Sbjct: 13  KYNEYKQTLEQLQSKVIELGNDKDEHDIVLDTLKTADPERKCYRMIGGALV-------ES 65

Query: 69  NVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105
           NV   L  +Q +        +N Q  +   R ELIK+
Sbjct: 66  NVKTTLPILQTK-------RQNLQDAVNTMRSELIKI 95

>Skud_15.488 Chr15 complement(853334..854806) [1473 bp, 490 aa] {ON}
           YOR320C (REAL)
          Length = 490

 Score = 28.5 bits (62), Expect = 3.9,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 27  LETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEANSNVSKRLEFIQGEIDR 83
           + T+L     +  +++++ ED+ V KL   ++ P +    N +++K L F Q E DR
Sbjct: 137 ISTELGHINSLLAKIRAIDEDQVVIKLIDNIVKPDDTTSWNESLTKLLVFNQTEFDR 193

>ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]
           {ON} highly similar to uniprot|Q06218 Saccharomyces
           cerevisiae YLR276C DBP9 ATP-dependent RNA helicase of
           the DEAD-box family involved in biogenesis of the 60S
           ribosomal subunit
          Length = 583

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 4/50 (8%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVY 51
           +V QVA +  +++ EL+Q ++   KL+   +EN    +ELQSL+ DK+++
Sbjct: 479 AVTQVAVREARIK-ELKQELLMSDKLKRHFEENP---QELQSLRHDKELH 524

>KAFR0K02380 Chr11 complement(487938..491312) [3375 bp, 1124 aa] {ON}
            Anc_6.233 YGL133W
          Length = 1124

 Score = 28.1 bits (61), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 10/86 (11%)

Query: 26   KLETQLQENKIVNEELQSLKE-DKQVYKLTGGVLLPVEHEEAN-SNVSKRLEFIQGEIDR 83
            KL  QLQEN++  +EL   KE +  V   T G   P E  E   +N+  +LE I  EI +
Sbjct: 933  KLFKQLQENELTEQELHIGKEIENGVAGTTDG---PGESSEVRLANIEDKLEDIAEEIMK 989

Query: 84   CEG-----NIKNKQQELEQARDELIK 104
             +       + N+ ++LE+ RD+L+K
Sbjct: 990  LDDLSSTRKVTNELKDLEEERDKLLK 1015

>TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6.73
           YLR276C
          Length = 604

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 4/50 (8%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVY 51
           +V QVA +  +++ EL++ ++  +KL+   +EN    +EL+SL+ DK++Y
Sbjct: 497 AVTQVAIREARIK-ELKEELLASEKLKRHFEENP---QELKSLRHDKELY 542

>YEL003W Chr5 (148176..148194,148283..148599) [336 bp, 111 aa] {ON} 
           GIM4Subunit of the heterohexameric cochaperone prefoldin
           complex which binds specifically to cytosolic chaperonin
           and transfers target proteins to it
          Length = 111

 Score = 26.9 bits (58), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 7/99 (7%)

Query: 8   AKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEAN 67
           AKY + +  LE+L     +L     E+ IV + L+  +  ++ Y++ GG L+        
Sbjct: 10  AKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGALV-------E 62

Query: 68  SNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLR 106
           S+V   L  ++ + +  EG I   ++ L Q   E  K +
Sbjct: 63  SDVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWK 101

>CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {ON}
           highly similar to uniprot|Q06218 Saccharomyces
           cerevisiae YLR276c DBP9
          Length = 595

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 34/50 (68%), Gaps = 4/50 (8%)

Query: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVY 51
           +V QVA +  +++ EL++ ++  +KL+   +EN I   EL+SL+ DK+++
Sbjct: 489 AVTQVAVREARIK-ELKEELLASEKLKRHFEENPI---ELKSLRHDKELH 534

>TBLA0J01730 Chr10 (383174..383192,383290..383606) [336 bp, 111
          aa] {ON} Anc_7.139 YEL003W
          Length = 111

 Score = 26.9 bits (58), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 31/51 (60%)

Query: 9  KYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLL 59
          KY   +  LE+L     +L  + +E+++V + L+  + D++VY++ GG L+
Sbjct: 11 KYNNFKNSLEELQERVIQLGHEKEEHEVVLKTLKDSESDRKVYRMVGGALV 61

>ZYRO0G05324g Chr7 complement(429815..430204) [390 bp, 129 aa] {ON}
           highly similar to uniprot|P53900 Saccharomyces
           cerevisiae YNL153C GIM3 Subunit of the heterohexameric
           cochaperone prefoldin complex which binds specifically
           to cytosolic chaperonin and transfers target proteins to
           it
          Length = 129

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 25  QKLETQLQENKIVNE---ELQSLKEDKQVYKLTGGVLLPVEHEEANSNVSKRLEFIQGEI 81
           Q+L  Q QE +  ++   EL+ + ED+ V    G + L ++ +EA   + K +E  QG I
Sbjct: 37  QELNIQRQEKEYSDDVSLELELIDEDEPVQYKVGVIFLHLKQKEAVEQLEKDMESTQGRI 96

Query: 82  DRCEG 86
           D  E 
Sbjct: 97  DELES 101

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
           [2388 nt, 796 aa]
          Length = 795

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 58  LLPVEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDEL 102
           LL  EHE+A  N  K+L   Q E+D+   +    ++  E+ + +L
Sbjct: 313 LLRAEHEKAKDNFEKQLNLAQAEVDQSTEDANKHKERFEKIKKKL 357

>Ecym_4489 Chr4 complement(988430..988746,988825..988849) [342 bp,
          113 aa] {ON} similar to Ashbya gossypii ADL004W
          1-intron
          Length = 113

 Score = 26.6 bits (57), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 1  MSVEQ----VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGG 56
          MSVEQ    +  KY + +  LE+L     +L    +E++IV   L++ ++ ++ Y++ GG
Sbjct: 1  MSVEQRSNVLQIKYNEYKQTLEELQTKIIELGNDKEEHEIVLSTLKTTEDTRKCYRMVGG 60

Query: 57 VLL 59
           L+
Sbjct: 61 ALV 63

>NCAS0A00270 Chr1 (37484..40117) [2634 bp, 877 aa] {ON} Anc_1.23
          Length = 877

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 16/80 (20%)

Query: 16  ELEQLIVTRQ------------KLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEH 63
           ++E LIV RQ            KL T L++  I   +L +L  + +   L G  LLP+ H
Sbjct: 178 QMESLIVERQRPFWKSLNESILKLSTNLRQVSIDWSQLINLLTNSKNCFLPGSPLLPLIH 237

Query: 64  EEAN----SNVSKRLEFIQG 79
           E+ +     N S+ L  I+G
Sbjct: 238 EQWSLWSQENQSRTLALIKG 257

>Smik_5.110 Chr5 (152227..152541) [315 bp, 105 aa] {ON} YEL003W
           (REAL)
          Length = 105

 Score = 26.6 bits (57), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 47/94 (50%)

Query: 8   AKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEEAN 67
           +KY + +  LE L     +L     E+ IV + L+  +  ++ Y++ GG L+  + + + 
Sbjct: 4   SKYNEYKQILEDLQTKIIELGHDKDEHTIVLKTLKDAEPTRKCYRMIGGALVESDVQTSL 63

Query: 68  SNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDE 101
             +  + E I+G I++ +  +    QE E+ + E
Sbjct: 64  PILETKKENIEGTINKMKETLIQTAQEFEKWKKE 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.128    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,651,586
Number of extensions: 437030
Number of successful extensions: 3059
Number of sequences better than 10.0: 399
Number of HSP's gapped: 3006
Number of HSP's successfully gapped: 447
Length of query: 107
Length of database: 53,481,399
Length adjustment: 77
Effective length of query: 30
Effective length of database: 44,652,117
Effective search space: 1339563510
Effective search space used: 1339563510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)