Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_47207.353ON26126113730.0
ACL145W7.353ON2342394691e-57
KLLA0D12276g7.353ON2582753884e-45
KLTH0H01188g7.353ON2672772804e-29
Suva_10.2947.353ON2752772333e-22
NCAS0E028507.353ON2812842325e-22
NDAI0E044507.353ON2212242285e-22
Skud_12.2637.353ON2742762281e-21
YLR199C (PBA1)7.353ON2762782238e-21
CAGL0A03993g7.353ON2722782114e-19
TBLA0E020707.353ON2522832096e-19
Smik_12.2587.353ON2742822062e-18
TDEL0C019507.353ON2732782027e-18
Kpol_530.287.353ON2742882001e-17
KAFR0L015007.353ON2792851992e-17
ZYRO0F11770g7.353ON2722801973e-17
Kwal_56.246507.353ON2522531931e-16
TPHA0F030007.353ON2822921922e-16
KNAG0B026007.353ON2791751871e-15
SAKL0F11440g7.353ON2722811842e-15
YMR059W (SEN15)2.625ON12859662.6
ZYRO0C07502g6.30ON12243636.7
KNAG0E010404.23ON78567659.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4720
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...   533   0.0  
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...   185   1e-57
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   154   4e-45
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   112   4e-29
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...    94   3e-22
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...    94   5e-22
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...    92   5e-22
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...    92   1e-21
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...    91   8e-21
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...    86   4e-19
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...    85   6e-19
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...    84   2e-18
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...    82   7e-18
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...    82   1e-17
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...    81   2e-17
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...    80   3e-17
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...    79   1e-16
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...    79   2e-16
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...    77   1e-15
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...    75   2e-15
YMR059W Chr13 (391099..391485) [387 bp, 128 aa] {ON}  SEN15Subun...    30   2.6  
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...    29   6.7  
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...    30   9.2  

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MIFKQWEFDRIPRHQVQSINSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLLP 60
           MIFKQWEFDRIPRHQVQSINSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLLP
Sbjct: 1   MIFKQWEFDRIPRHQVQSINSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLLP 60

Query: 61  ADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRASYPIYELDDHT 120
           ADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRASYPIYELDDHT
Sbjct: 61  ADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRASYPIYELDDHT 120

Query: 121 LVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSLSELQPPEFIA 180
           LVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSLSELQPPEFIA
Sbjct: 121 LVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSLSELQPPEFIA 180

Query: 181 GALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVEYMKSTLGYSEEYV 240
           GALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVEYMKSTLGYSEEYV
Sbjct: 181 GALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVEYMKSTLGYSEEYV 240

Query: 241 TSAYRRWKSNSASQFQSGLYL 261
           TSAYRRWKSNSASQFQSGLYL
Sbjct: 241 TSAYRRWKSNSASQFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score =  185 bits (469), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 143/239 (59%), Gaps = 6/239 (2%)

Query: 23  DPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLLPADLIHFKQISCLTAVLKQSSNP 82
           DP SLL   EP +     + + Y  A+ +PS+L+WL+P +++    ++ L   L Q+   
Sbjct: 2   DPHSLLAGAEPQVEFSGKLGERYSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAGGG 61

Query: 83  DPVEIEDVNTSGFYEVDVKPSTKEVRASYPIYELDDHTLVVLIKEDELQHPPILHNFLAI 142
           +      V    FYE DV  + + VR +Y +YE     LVV+++E++L++PPI+HN LA 
Sbjct: 62  E-CATRLVAADQFYEADVPQAERHVRVAYQLYERGPGQLVVVVEENDLKYPPIVHNRLAQ 120

Query: 143 ALAKVLRTAIQKVYLLINSDKIIGFKSLSELQPPEFIAGALAAIVTALNSQSSSKEFQHE 202
            LA+ LR    +  +L+NSDK  G K L EL PPEFI GALAA+V AL    + +     
Sbjct: 121 QLAEKLRAVGAETTVLVNSDKSTGVKDLEELVPPEFITGALAALVCALAPSGAGR----- 175

Query: 203 IMVVQSEGPRGYEIHNITVVDLLVEYMKSTLGYSEEYVTSAYRRWKSNSASQFQSGLYL 261
           ++VVQSEGP G+E HN+TVVD LVE ++  L    EYV +  R WK  + SQFQ GLYL
Sbjct: 176 VLVVQSEGPHGFEKHNLTVVDALVERVRQILDQPPEYVAACTRHWKLQAGSQFQGGLYL 234

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  154 bits (388), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 153/275 (55%), Gaps = 32/275 (11%)

Query: 1   MIFKQWEFDRIPRHQVQSINSADPTSLLLSPEPVITLDN---DINKGYEKAIALPSSLTW 57
           + FKQW+ D++PRHQ+  +  +DP SL+    P +T++    DI+  Y   I LP+SL W
Sbjct: 2   LTFKQWQNDQVPRHQIDPVVQSDPYSLVNKTTPTVTIEPESLDISP-YNHCIVLPTSLKW 60

Query: 58  LLPADLIHFKQISCLTAVLK-----QSSNPDPVEIEDVNTSGFYEVD--VKPSTKEVRAS 110
           LLP  +I+   I  ++  L      +S  P P         G Y+ +  +  ST++    
Sbjct: 61  LLPKSIINLVHIGIISGTLSNMNEWESMKPVP---------GMYDTEEHMINSTEQFVIH 111

Query: 111 YPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSL 170
           Y ++ L+D TL+ +I E+E+++P I+ NF+   LA++LR  I+ + +L+NSDKI   K L
Sbjct: 112 YNLWRLED-TLIAIIDENEVKYPAIVTNFMTRNLAQLLR-DIKDITILVNSDKITELKQL 169

Query: 171 SELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVEYMK 230
           S L PPEFI G++   + AL      KE +  ++VV SEGP G+E +N   VD LV+ M 
Sbjct: 170 SYLVPPEFITGSITNFILAL----PRKELK--VIVVPSEGPIGFEKYNFPTVDALVDEMS 223

Query: 231 STL----GYSEEYVTSAYRRWKSNSASQFQSGLYL 261
             L      +E YV+   + WK +  +  Q GLY+
Sbjct: 224 KLLCSYPSQTEYYVSECLKLWKLDECTTTQGGLYI 258

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  112 bits (280), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 137/277 (49%), Gaps = 26/277 (9%)

Query: 1   MIFKQWEFDRIPRHQVQSI--NSADPTSLLLSPEPVITLDNDINK-GYEKAIALPSSLTW 57
           M+FKQW     PRH + +    + D  SL  +P P + L+  I+  G+++A  + +    
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60

Query: 58  LLPADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRASYPIYELD 117
           L    L   +QIS    V +       +  ED  T    + D + + +  R  +P+++LD
Sbjct: 61  LFEDRLARAEQISSFVVVWQTKGREQHLYREDYQT----QEDSRSTDETKRLEFPVHKLD 116

Query: 118 DHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKI-----IGF----- 167
           D TL + ++ED L  PPI  N L+  +AK+      +V L  +SD++     +GF     
Sbjct: 117 DGTLFICVREDFLHVPPISINLLSREIAKL--CGGLEVLLFGSSDRVERVKYVGFPGNVG 174

Query: 168 KSLSELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVE 227
           K L  L PPE I    A+I+T L     S + + +  V  SEGP GYE  ++  +DLL++
Sbjct: 175 KGLPLLTPPELITNFTASIMTQL----LSNKVRFDGYVAPSEGPSGYEKLSMETMDLLID 230

Query: 228 YMKS--TLGYSEEYVTSAYRRWKSN-SASQFQSGLYL 261
              S    G  E+YV S +R W+ N +    Q+GLYL
Sbjct: 231 LCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score = 94.4 bits (233), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 137/277 (49%), Gaps = 20/277 (7%)

Query: 3   FKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWLLP 60
           FKQW     PRHQ+     S +  SL + P P + L  D++   Y + +     +  L P
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 61  ADLIHFKQISCL-TAVLKQSSNP-DPVEIEDVNTSGFYEVDVKPSTKEVRA--------S 110
            +L+    I  + T+++ +  NP  P +    N    +  ++ P+++   +        S
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120

Query: 111 YPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSL 170
           +PIY     TL+  I+E+ +   PI  N ++ ++A  L      V ++  SD+I   K +
Sbjct: 121 FPIYSFG-KTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIM 179

Query: 171 SE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLV 226
           +E    LQPPEF+ G + +++T L +  ++K  + + +VV SEGP G+E  +++ +  L+
Sbjct: 180 TEDECTLQPPEFVTGFIGSVLTQLIT-GANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLI 238

Query: 227 EYMKSTLGYSE-EYVTSAYRRWKSNSAS-QFQSGLYL 261
           +      G    +Y    +R W+ +SA+   QSGLY+
Sbjct: 239 DVCSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score = 94.0 bits (232), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 137/284 (48%), Gaps = 26/284 (9%)

Query: 1   MIFKQWEFDRIPRHQVQ-SINSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLL 59
           M+FKQW     PRHQ+   I S +  SL  SP P +   +   + YEK I     +  L 
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60

Query: 60  PADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYE----------VDVKPSTKEVRA 109
           P  LI  K +  +   L  + + + V  ED ++  F E           D +   +    
Sbjct: 61  PEKLIESKNLGKIETQLTLTEDQNAVN-EDGHSWNFNENFPNEFDPDNEDRENQQQAFNF 119

Query: 110 SYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKS 169
            +P++ +    +++ I+++ L+  PI  N ++  L + L   I K  +L +SD+I   K 
Sbjct: 120 EFPVFAVG-KVVIISIQDNFLKISPIFSNIISKKLIEQLPRTI-KPLILGSSDRIASVKE 177

Query: 170 LSE----LQPPEFIAGALAAIVTALNS-----QSSSKEFQHEIMVVQSEGPRGYEIHNIT 220
           +++    L PPEFI G +A+++T L       Q+   +FQ + ++V SEGP G+E  N+T
Sbjct: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLT 237

Query: 221 VVDLLVEYMKSTLGYSEE--YVTSAYRRWK-SNSASQFQSGLYL 261
           V+  L++  K      +   Y   +YR WK + S    QSGLY+
Sbjct: 238 VIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score = 92.4 bits (228), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 117/224 (52%), Gaps = 26/224 (11%)

Query: 58  LLPADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFY-----------EVDVKPSTKE 106
           L P DL+    +S ++  L  + NPD +   +   S  Y           + D+K S K 
Sbjct: 4   LFPEDLLPLVSVSNISTTL--TLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEKS 61

Query: 107 VRASYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIG 166
              ++PI+ +D  TLV+ I+E+ L+  PI  N ++  L + L    +++ +L  SD++  
Sbjct: 62  YDFNFPIFAID-RTLVISIQENFLKISPIFSNVISQTLVQALPLN-KEILILGTSDRVAV 119

Query: 167 FKSLSE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVV 222
            + +S     L+PPEF+ G + +++T LN  ++   F  + ++V SEGP G+E  N+T++
Sbjct: 120 MRKISNEIDTLEPPEFVTGFIGSLITELNLHNAKYNF--DAIIVPSEGPTGFEKLNLTIM 177

Query: 223 DLLVEYMKSTLGY----SEEYVTSAYRRWK-SNSASQFQSGLYL 261
             L++  K+   Y    S+ Y    YR WK + +A   QSGLY+
Sbjct: 178 QDLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 133/276 (48%), Gaps = 19/276 (6%)

Query: 3   FKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWLLP 60
           FKQW     PRHQ+     S +  SL   P P + L  D+N   Y   I     +  L P
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 61  ADLIHFKQISCLTAVL--KQSSNPDPVEIEDVNTSGFYEVDVKP-----STKEVRA--SY 111
            +L+    I  + + L  K SS     +    N    +  +V P     ++KE +   S+
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120

Query: 112 PIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSLS 171
           PIY   + TL+  I+E+ +   PI  N ++ ++   L      + ++ +SD+I   K ++
Sbjct: 121 PIYSFGE-TLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMT 179

Query: 172 E----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVE 227
           +    LQPPEFI G + +++T L     +K    + ++V SEGP G+E  +++ +  L++
Sbjct: 180 KSECTLQPPEFITGFIGSVLTQL-IIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLID 238

Query: 228 YMKSTLGYS-EEYVTSAYRRWKSNSAS-QFQSGLYL 261
                LG+   +Y    YR W+ +SA+   QSGLY+
Sbjct: 239 VCSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score = 90.5 bits (223), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 128/278 (46%), Gaps = 19/278 (6%)

Query: 1   MIFKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWL 58
           M+FKQW     P+H +     S +  SL + P P +    D++   Y  A+     +  L
Sbjct: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60

Query: 59  LPADLIHFKQISCL--TAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRA------- 109
            P +L+    I  +  T  +K  S P        N    +  +V P  K   A       
Sbjct: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120

Query: 110 SYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKS 169
           S+PIY     TL+  ++E+ +   PI  N ++ ++   L      + ++  SDKI   K 
Sbjct: 121 SFPIYSFG-KTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKV 179

Query: 170 LSE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLL 225
           ++E    LQPPEFI G + +++T L     SK  + + +V  SEGP G+E  +++ +  L
Sbjct: 180 MTENECTLQPPEFITGFIGSVLTQL-IVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSL 238

Query: 226 VEYMKSTLGYS-EEYVTSAYRRWKSNSAS-QFQSGLYL 261
           V+     LG+    Y    YR W+ +SA+   QSGLY+
Sbjct: 239 VDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 141/278 (50%), Gaps = 23/278 (8%)

Query: 1   MIFKQWEFDRIPRHQVQSINSADPT-SLLLSPEPVITLDNDINKGYE-KAIALPSSL--T 56
           M+FKQW     PR+ + + N  + T SL L P P + + +++ +G   K + L +    T
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDT 60

Query: 57  WLLPADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEV---DVKPSTKEVRASY-- 111
           + L    +  K+++ +T  L+   N    E    +T  F E    +V+P   E + ++  
Sbjct: 61  FFLLDKTMKVKKLADITCSLEIPKNLQTHEA--THTWDFGENFPNEVEPLQDEEQRTFSL 118

Query: 112 --PIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKI----I 165
             PIY L+D TL V I E+ L   PI    ++  ++K L     ++ +L  SD+I    I
Sbjct: 119 RFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNRG-HEIVILGCSDRIEDTKI 177

Query: 166 GFKSLSELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLL 225
              +   L PPEF+ G L ++++ L ++++ + F   I    SEGP+G+E  + T VD +
Sbjct: 178 CTNNNCSLVPPEFVTGFLGSLMSDL-TKTNDQLFTAAIF--PSEGPQGFEKLSSTTVDSI 234

Query: 226 VEYMKSTLGYSE-EYVTSAYRRWKSNSASQ-FQSGLYL 261
           +++    +   +  Y    Y+RWK N++S   QSGLYL
Sbjct: 235 IDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score = 85.1 bits (209), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 129/283 (45%), Gaps = 53/283 (18%)

Query: 1   MIFKQWEFDRIPRHQVQSINSADPT-----SLLLSPEPVITLDNDIN--KGYEKAIALPS 53
           M+FKQW+    PRH V S+ +  P      SL  +P P++ + + +     YE+ I    
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60

Query: 54  SLTWLLPADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRA---S 110
            L  L P ++++F  +                            ++VK +  E  A    
Sbjct: 61  VLMPLFPKEILNFTSLG--------------------------NIEVKLNVSEATAHLVK 94

Query: 111 YPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSL 170
            PIY+ ++ TL++++ E+ +Q  PI  N ++  +  +    + K  +   SD+I   K++
Sbjct: 95  TPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQL-KFLIFGTSDRISKIKTI 153

Query: 171 SELQ----PPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLL- 225
           + L     PPEFI G + +I++ L+  ++SK       +V SEGP G+E   +  ++ L 
Sbjct: 154 NHLNCTLIPPEFITGFIGSIISDLSLTANSK---FNGFLVPSEGPLGFEKLTLETMEFLI 210

Query: 226 ------VEYMKSTLGYSEEYVTSAYRRWK-SNSASQFQSGLYL 261
                 V+ + S L   E Y    YR W+ + +    QSGLY+
Sbjct: 211 KEGGRIVKTIDSNLNL-ELYEKECYRNWRLTGTTIGTQSGLYI 252

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 130/282 (46%), Gaps = 31/282 (10%)

Query: 3   FKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWLLP 60
           FKQW     PRH +     S +  SL   P P + L  D++   Y   +     +  L P
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 61  ADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFY----------EVDVKPS---TKEV 107
            +L+       L AV K  +    V    V ++G +          EVD  P    + E 
Sbjct: 61  KNLLQ------LIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDET 114

Query: 108 RA--SYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKII 165
           +   S+PIY     TL+  I+E+ L   PI  N ++  +   L  +  ++ ++  SDKI 
Sbjct: 115 KYDFSFPIYSFG-KTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIA 173

Query: 166 GFKSLSE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITV 221
             K +++    L+PPEFI G + +++T L     +K  + + +VV SEGP GYE  +++ 
Sbjct: 174 NMKVMTKDECSLKPPEFITGFIGSVLTQLVG-GVNKGMKFKCLVVPSEGPNGYEKLSLSD 232

Query: 222 VDLLVEYMKSTLGYSE-EYVTSAYRRWKSNSAS-QFQSGLYL 261
           +  LV      LG+    Y    YR W+ +SA+   QSGLY+
Sbjct: 233 MGSLVSLCGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score = 82.4 bits (202), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 136/278 (48%), Gaps = 22/278 (7%)

Query: 1   MIFKQWEFDRIPRHQVQS-INSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLL 59
           M+FKQW     PRHQ+ S +  A+  +L  S  P +TL     + + + I   + +  L 
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLPPIDLQNFSRVILTSAIMNPLF 60

Query: 60  PADLIHFKQISCLTAVLKQSSNP----DPVEIEDVNTSGFYEVD----VKPSTKEVRASY 111
           P  L+    +  L  +L  SS       P+   + + +   EVD    V+  +K      
Sbjct: 61  PEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEERSKTFELCA 120

Query: 112 PIYELDDHTLVVLIKEDELQHPPILHNFLAIAL-AKVLRTAIQ-KVYLLINSDKIIGFKS 169
           PI      TL++ +KE+ L+  PI  N +A ++  K+ + A + +V +L  SD+I   K 
Sbjct: 121 PIVSFG-RTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQITELKP 179

Query: 170 LSE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLL 225
           +S+    L PPEF+   + A++T L  +S    FQ   ++  SEGP G+E  N+  ++ L
Sbjct: 180 VSDKETTLNPPEFVTSFVGAVITQLIEKSLP--FQG--LIAPSEGPVGFEKLNLVTMEEL 235

Query: 226 VEYMKSTLGYSEE-YVTSAYRRWKSNSAS-QFQSGLYL 261
           +      +  ++E Y    YRRW+ + A+   QSGLY+
Sbjct: 236 ITLCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 138/288 (47%), Gaps = 41/288 (14%)

Query: 1   MIFKQWEFDRIPRHQVQS--INSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWL 58
           M+FKQW     PRH++ S  I   D +  LLS   V   + D++K Y+  +     +  L
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPETDLSK-YKNVVLTTKIMDPL 59

Query: 59  LPADLIHFKQISCLTAVLKQSSNPDPVEIE----DVNTSGFYEVDVKPSTKEVRA---SY 111
            P+ L+  ++I+ +T  LK   + D  E E    D   +   EV  K  +   R    S 
Sbjct: 60  FPSKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVGFKRDSNNRRLLSFSS 119

Query: 112 PIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLIN----------- 160
           PI+   D T++++I+E+ ++   I  N +A    +V+       +LLIN           
Sbjct: 120 PIFAFKD-TIIIMIEENFIKMSAIFSNVIA---EQVIN------HLLINGNPDLNFIAIG 169

Query: 161 -SDKIIGFKSLSE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYE 215
            SD+I+  K L++    L+PPEF+ G + +I+T L S+  +       ++  SEGP G+E
Sbjct: 170 TSDRILNIKKLTQDHCSLEPPEFVTGFIGSILTQLISKEVN---VFTGILAPSEGPIGFE 226

Query: 216 IHNITVVDLLVEYMKSTLGY-SEEYVTSAYRRWKSNSAS-QFQSGLYL 261
              + V+  L++  +  L   S EY     R W+ + A+   QSGLY+
Sbjct: 227 KMTLDVIKELIDICQELLDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 134/285 (47%), Gaps = 30/285 (10%)

Query: 1   MIFKQWEFDRIPRHQVQS-INSADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWL 58
           M+FKQW     PRHQ+ S +   +  SL  SP P + + + +N   Y+K I     +  L
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60

Query: 59  LPADLIHFKQISCL--TAVLKQSSNPDPVEIE---DVNTSGFYEVDVKPSTKEVRAS--- 110
            P +L+  + +  +  T +L +S   D  +     D N +  +  +  PS +    +   
Sbjct: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNEN--FPNEFNPSMESATGNNNF 118

Query: 111 ---YPIYELDD-HTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKI-- 164
              +PIY +    TL++ I E+ L+  PI  N ++  L   +      + LL  SDKI  
Sbjct: 119 SFKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISN 178

Query: 165 ----IGFKSLSELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNIT 220
               +  K+ S + PPEFI G + +++  L    +      E ++V SEGP G+E  +++
Sbjct: 179 NIKTVTNKNCS-INPPEFITGFIGSLLYELLEIGTD---NFECIIVPSEGPIGFEKLSLS 234

Query: 221 VVDLLVEYMKSTLGYSEEYVT---SAYRRWK-SNSASQFQSGLYL 261
            ++ L+      LG   ++ T     +R WK   SA+  QSGLY+
Sbjct: 235 TMEELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 123/280 (43%), Gaps = 27/280 (9%)

Query: 1   MIFKQWEFDRIPRHQVQS--INSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWL 58
           M+FKQW     PRH + S      D  SL     P++ L N     + K       +  L
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELPNINWNKFHKIFLTTGIMDPL 60

Query: 59  LPADLIHFKQISCLTAVLKQSSNPDPVEIE-----------DVNTSGFYEVDVKPSTKEV 107
            P +L+   ++  +   L    N      E           +VN +G  + D   S   V
Sbjct: 61  FPKELLGVMKLGDIRTTLTIDRNQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQSLTFV 120

Query: 108 RASYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGF 167
                  E     L+V +KE+ L+  PI++N +A  L  V      ++ +L  SD+I   
Sbjct: 121 TT----VEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITEL 176

Query: 168 KSL----SELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVD 223
           KS+    S+LQPPEF+ G + +I+T L    + K    E  +  SEG  G+E  ++  + 
Sbjct: 177 KSISHLRSDLQPPEFVTGFIGSILTQL----TVKNIPFEGFIAPSEGAIGFEKMSMNTMP 232

Query: 224 LLVEYMKSTL-GYSEEYVTSAYRRWKSNSASQFQ-SGLYL 261
            L++     + G SE+Y +  YR W+ +S +    SGLY+
Sbjct: 233 ELIDICGQWINGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 112/253 (44%), Gaps = 24/253 (9%)

Query: 23  DPTSLLLSPEPVITLDNDI-NKGYEKAIALPSSLTWLLPADLIHFKQISCLTAVLKQSSN 81
           D  SL L+P P + L   + +  +++   +      L    L H +QIS      +    
Sbjct: 10  DSNSLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQISTFEVKWQTKGR 69

Query: 82  PDPVEIEDVNTSGFYEVDVKPSTKEVRASYPIYELDDHTLVVLIKEDELQHPPILHNFLA 141
              +  ED       + D     +    S P+ ++D+ T ++ + ED L  PPI+ N L+
Sbjct: 70  EQHLYREDFQV----QEDCTKENESCGLSIPVLKIDEDTFLLCVAEDFLHVPPIVGNLLS 125

Query: 142 IALAKVLRTAIQKVYLLINSDKI----------IGFKSLSELQPPEFIAGALAAIVTALN 191
             +AK+ R    +V ++  SD+I           G   +  L PPE I    A+I T L 
Sbjct: 126 QEMAKLCRDL--RVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSFTASITTQL- 182

Query: 192 SQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVEYMKSTL--GYSEEYVTSAYRRWK- 248
                 +   +  V  SEGP GYE  ++  +D L++   S +  G  +EYV   +R W+ 
Sbjct: 183 ---LLCKVPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGNRDEYVKETHRNWRL 239

Query: 249 SNSASQFQSGLYL 261
             +++  Q+GLYL
Sbjct: 240 HGTSTGTQTGLYL 252

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 132/292 (45%), Gaps = 41/292 (14%)

Query: 1   MIFKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLL 59
           M+FKQW     PRHQ+ S + S +  SL L   P +++ N   + +E  I    ++  L 
Sbjct: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60

Query: 60  PADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPS---------------- 103
           P   ++  ++  L++ L  + N      E V T+  Y  D K +                
Sbjct: 61  PNKTLNLTKVGELSSSLVLNEN------EKVPTAEHYSWDYKENFPNEVDIYSQEAIESE 114

Query: 104 -----TKEVRASYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQK---V 155
                +K+     PI   D  TL++ I+E+ ++  PI  N  A  + KV+ T       +
Sbjct: 115 IGSNESKKYNFQIPIMAYD-KTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGI 173

Query: 156 YLLINSDKIIGFKSL----SELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGP 211
             L  SD++   + L    S L  PEFI G + + ++ L          ++ ++V SEGP
Sbjct: 174 LTLGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP---NYKAVIVPSEGP 230

Query: 212 RGYEIHNITVVDLLVEYMKSTLGYSE-EYVTSAYRRWK-SNSASQFQSGLYL 261
            G+E  +I  +  L++  K  L  ++ +Y   ++R WK + SA   Q+GLY+
Sbjct: 231 IGFEKLSIETISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 97/175 (55%), Gaps = 18/175 (10%)

Query: 99  DVKPSTKEVRASYPIYELDD-HTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYL 157
           D +  TK +    PI EL+  +TL++ + E+ L+  PI  N +A  L  +L T   K+ L
Sbjct: 111 DTREDTKSIVLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQT-KILL 169

Query: 158 LINSDKIIGFK--SLSE--LQPPEFIAGALAAIVTAL--NSQSSSKEFQHEIMVVQSEGP 211
           + +SDKI   K  SL+E  LQPPEFI G L  ++  L  N  S+ K F     +VQSEGP
Sbjct: 170 VGSSDKIYSTKMVSLNECTLQPPEFITGFLGGMIDELVKNRFSNFKGF-----IVQSEGP 224

Query: 212 RGYEIHNITVVDLLVEYM----KSTLGYSEEYVTSAYRRWKSNSASQ-FQSGLYL 261
            G+E  ++  +D L++++     S    ++ +  + ++ WK + A+   QSGLY+
Sbjct: 225 TGFEKLSLESMDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 127/281 (45%), Gaps = 29/281 (10%)

Query: 1   MIFKQWEFDRIPRHQVQSINSADPT--SLLLSPEPVITLDNDIN-KGYEKAIALPSSLTW 57
           M+FK W     PRHQ+ +  + +    SL  +P P + L   I+   + + +     L  
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRP 60

Query: 58  LLPADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGF----YEVDVKPSTK--EVRASY 111
           L P+ +     IS     +     P P  I+  + S +    YE +  P  K  E+  S+
Sbjct: 61  LFPSTICPMTTISEFQVTIP----PQPTAIKKAHGSSYGDEDYEQESLPDKKPEEIIVSF 116

Query: 112 PIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTA-IQKVYLLINSDKIIGFKS- 169
            + + +D  L + I+E+ L   PI  N L+  + ++ ++    +  +L  SD+I   KS 
Sbjct: 117 QVEKFND-ILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRITTLKSV 175

Query: 170 -----LSELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDL 224
                L +L+PPEF+    A+++T L       +   + ++  SEGP G+E  ++  +D 
Sbjct: 176 GSTLGLPDLEPPEFVTNCTASLITTLILH----DLPFKSLIAPSEGPSGFEKLSLVSMDQ 231

Query: 225 LVEYMKSTLGYSEE---YVTSAYRRWK-SNSASQFQSGLYL 261
           L E     +   E    Y+   +R W+   +A   Q+GLY+
Sbjct: 232 LAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>YMR059W Chr13 (391099..391485) [387 bp, 128 aa] {ON}
          SEN15Subunit of the tRNA splicing endonuclease, which
          is composed of Sen2p, Sen15p, Sen34p, and Sen54p
          Length = 128

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 28 LLSPEPVITLDNDINKGYEKAIALPSSLTWLLPADLIHFKQ----ISCLTAVLKQSSNP 82
          LL   P   L ND++  +E +++ P  L ++LP ++  +K+    + CL+       +P
Sbjct: 39 LLRGRPPHKLSNDVDTEHENSLSSPRPLEFILPINMSQYKENFLTLECLSQTFTHLCSP 97

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 94  GFYEVDVKPSTKEVRASYPIYELDDHTLVVLIKEDELQHPPIL 136
           G  ++ V P TK   A    +E +DHTL  LI+ + L  P +L
Sbjct: 15  GESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVL 57

>KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {ON}
           Anc_4.23 YLL034C
          Length = 785

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 152 IQKVYLLINSDKIIGFKSLSELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGP 211
           ++K+   +  D  I F  L++L P  F+   L A++TA  + +  + F+H ++    E  
Sbjct: 354 LKKLSSTLKLDGEIDFLQLAKLTPG-FVGADLKALITAAGTCAIKRIFEHSVVSDTMEVD 412

Query: 212 RGYEIHN 218
           R  E+ N
Sbjct: 413 RDTELKN 419

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,662,571
Number of extensions: 1145314
Number of successful extensions: 3150
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3171
Number of HSP's successfully gapped: 32
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)