Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46238.848ON48048025740.0
SAKL0D01276g8.848ON50246113970.0
KLTH0C03696g8.848ON47447613680.0
Kwal_27.102198.848ON50047413620.0
TDEL0A079708.848ON48948813530.0
ZYRO0G14344g8.848ON47247813460.0
KLLA0D01386g8.848ON48949413271e-180
Kpol_1068.28.848ON49148513241e-180
YMR283C (RIT1)8.848ON51349413081e-177
NDAI0K003508.848ON50450512971e-175
NCAS0C003508.848ON48648612731e-172
KNAG0J002208.848ON49949212731e-172
Smik_13.4968.848ON49449412691e-171
Suva_13.4728.848ON51048912581e-169
Skud_13.4558.848ON49449412541e-169
TPHA0I003008.848ON49349412421e-167
KAFR0B039808.848ON48349112261e-165
AFR451C8.848ON40841611871e-160
Skud_10.611.192ON45288780.56
Smik_15.4778.765ON128990723.6
NCAS0A008502.1ON156881706.2
ZYRO0D14344g6.71ON767110697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4623
         (480 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   996   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   542   0.0  
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   531   0.0  
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   529   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   525   0.0  
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   523   0.0  
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   515   e-180
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   514   e-180
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   508   e-177
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   504   e-175
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   494   e-172
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   494   e-172
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   493   e-171
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   489   e-169
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   487   e-169
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   483   e-167
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   476   e-165
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   461   e-160
Skud_10.61 Chr10 complement(104460..105818) [1359 bp, 452 aa] {O...    35   0.56 
Smik_15.477 Chr15 (819649..823518) [3870 bp, 1289 aa] {ON} YOR29...    32   3.6  
NCAS0A00850 Chr1 (165458..170164) [4707 bp, 1568 aa] {ON} Anc_2....    32   6.2  
ZYRO0D14344g Chr4 (1215124..1217427) [2304 bp, 767 aa] {ON} high...    31   7.9  

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/480 (100%), Positives = 480/480 (100%)

Query: 1   MEDESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLW 60
           MEDESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLW
Sbjct: 1   MEDESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLW 60

Query: 61  YCNPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDAL 120
           YCNPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDAL
Sbjct: 61  YCNPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDAL 120

Query: 121 SKTIPIWCAVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNII 180
           SKTIPIWCAVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNII
Sbjct: 121 SKTIPIWCAVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNII 180

Query: 181 SGEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNSIPVILCTASYQC 240
           SGEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNSIPVILCTASYQC
Sbjct: 181 SGEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNSIPVILCTASYQC 240

Query: 241 QDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTE 300
           QDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTE
Sbjct: 241 QDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTE 300

Query: 301 KLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQS 360
           KLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQS
Sbjct: 301 KLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQS 360

Query: 361 VTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDIS 420
           VTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDIS
Sbjct: 361 VTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDIS 420

Query: 421 IGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480
           IGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL
Sbjct: 421 IGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/461 (55%), Positives = 338/461 (73%), Gaps = 8/461 (1%)

Query: 23  SLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYEQTCYFKSTDGHTNQ 82
           SLRNRLQS+ +D +F+   V+P FP+YPLVPNERCGLWYCNP  + Q  YFKSTDGH NQ
Sbjct: 47  SLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQ 106

Query: 83  WDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWCAVLNNLMLDYKGKE 142
           WDFSTRRLNFH+L  +A+ GGI+I+DSTRRGKK+PDALSKTIPIWCAV+N L+L+   + 
Sbjct: 107 WDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRS 166

Query: 143 DSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYNMFQGKVLRPFWVYPG 202
           + +  LFCPPGTV + E+D I +++P LVEKLK L I+SG+EL   F GK+LRP WVYPG
Sbjct: 167 EEV--LFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVYPG 224

Query: 203 SPLLDTSRDIFTG-EVLGNVWQ--SEQNSIPVILCTASYQCQDGEDKHHGFTYVQGAADD 259
           S L  +S DIFTG +     W+   +Q+ +PVILCTASYQCQDG DK +GFTYVQGAADD
Sbjct: 225 SSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAADD 284

Query: 260 HELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLTAQSNKQSDRESSSSFI 319
           HELWA GL P++FW N  FLGD  KSE EL ++V +  R  + T ++ + S  + +  F 
Sbjct: 285 HELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKR--EATERTKEASGNDLNQCF- 341

Query: 320 KVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAKADCNCERIKVYPINN 379
            VD ITK L+LGTV +G+ L E +  +L S+Y+L ++ S+SV   +       K++P+ +
Sbjct: 342 SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIASIQENPNTKIFPLTS 401

Query: 380 NSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDISIGIMLTALCQHYDLQWHLE 439
            +KKSS++LR  LIEI  LI+  +   LPILICCNTGKD+S+G++L  LCQ+YD  W + 
Sbjct: 402 GNKKSSKELRSKLIEICPLIQASLNSPLPILICCNTGKDMSVGVLLATLCQNYDEDWCIG 461

Query: 440 EQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480
              + NKTI++KHL R+I+ L G N+NPSR+TL +VNA+L+
Sbjct: 462 SPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYLM 502

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/476 (52%), Positives = 351/476 (73%), Gaps = 13/476 (2%)

Query: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68
           T+  + +EI+++  SLRNRLQS+ +D KF+  +V  +FP+YP++PNERCG+WYC+P  Y 
Sbjct: 8   TINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYL 67

Query: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128
           QT YFKSTDGHTNQWDFS RRLNFH+L  +A +GGI++VDSTRRGK+MPDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWC 127

Query: 129 AVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYNM 188
           AVLN+L+L+Y+G E  +  LFCPP TVS+ EF+ I S++PDLV K KK+NI++G ++  +
Sbjct: 128 AVLNSLLLEYQGLEGEV--LFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRL 185

Query: 189 FQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSE--QNSIPVILCTASYQCQDGEDK 246
           F+GK+LRP WV+PG+ LL + RD FTGEVL   W +   +N IPV+LCT SYQCQDG DK
Sbjct: 186 FKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDK 245

Query: 247 HHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQ-RIGRTEKLTAQ 305
            HGFTYVQGAADDHELWA GL  E+FWK+I  L + + S+ ELE FV+ +I   E  +A+
Sbjct: 246 RHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSAE 305

Query: 306 SNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAKA 365
           +    D+      +  D +T+ L+LG ++  + L E++ KEL+ KYSL II S +VT   
Sbjct: 306 NGLSLDQ-----ILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE 360

Query: 366 DCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDISIGIML 425
           D     IK++ + +  KKSS+ LR  LI+I  L + ++ + LP+L+CCNTGKD+S+ + L
Sbjct: 361 DEAA--IKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSL 418

Query: 426 TALCQHYDL-QWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480
             LC++Y++  W L  Q++++K  +KKHL++IITKL G N+NP R++L +VNA+L+
Sbjct: 419 AILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/474 (51%), Positives = 349/474 (73%), Gaps = 9/474 (1%)

Query: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68
           TL  + KEI+++  +LRNRLQS+ +D +F+  +VL +FPNYPL+PNERCGLWYC+P +Y 
Sbjct: 34  TLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPERYS 93

Query: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128
           QT YFKSTDGH+NQWDFS RRLN H+L  + + GGI+IVDSTRRGK+MPDALSKT+PIWC
Sbjct: 94  QTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVPIWC 153

Query: 129 AVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYNM 188
           AVLN++ML+ +  E+ +  LFCPP TVS  EF+ I S++P LV + K+L + + +EL+ +
Sbjct: 154 AVLNSIMLEGRQSEEEV--LFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSDELFKI 211

Query: 189 FQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSE-QNSIPVILCTASYQCQDGEDKH 247
             GK+LRP WVYPG+ LL++ RD FTG+++   W+++ +N +PV+LCT SYQCQDG DK 
Sbjct: 212 LDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEAQNENFMPVVLCTVSYQCQDGVDKR 271

Query: 248 HGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLTAQSN 307
           HGFTYVQGAADDHELWA GL  E+FW++IE   D   S+ EL  +V  +  +      +N
Sbjct: 272 HGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGD---ANN 328

Query: 308 KQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAKADC 367
           K +        +  +E+T+ L+LG VAE I L +N+  +LK KYSL ++ S S++   + 
Sbjct: 329 KLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLSTSISVYEE- 387

Query: 368 NCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDISIGIMLTA 427
             E I+++ + + SKKSSR LR AL +I  LI+ ++ + LP+LICCN GKD+S+ ++L+ 
Sbjct: 388 -AENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSLPVLICCNNGKDMSVCVVLSV 446

Query: 428 LCQHYDLQ-WHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480
           LC++++++ W LE++ +V+K+I+KKHLA++ITKL G N+NP R +L +VN +L+
Sbjct: 447 LCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVNDYLM 500

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/488 (52%), Positives = 348/488 (71%), Gaps = 15/488 (3%)

Query: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62
           D + +D+L+ I K+I+++  SLRNRLQS+  D  F+  EVLP FP YPLVPNERCGLWYC
Sbjct: 7   DNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYC 66

Query: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122
           NP  + QT YFKSTDGHTNQWDFS+RRLNFHI+  +A++ GIIIVDSTRRGKK+PDALSK
Sbjct: 67  NPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSK 126

Query: 123 TIPIWCAVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISG 182
           TIPIWCAVLN+LML+ +G      +L+ PP TVS+ EF  I S++P+LVEKLK L +I+G
Sbjct: 127 TIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVING 186

Query: 183 EELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNS-IPVILCTASYQCQ 241
           +EL+    GK+LRPFW+YPGS +L ++ DIFTGEV  + W    NS IP+ILCT SYQ Q
Sbjct: 187 KELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCTVSYQAQ 246

Query: 242 DGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEK 301
           DG DK  GFTYVQGAADDHELW++GLN +IFW NI+ LG+ + SE ELE FV ++     
Sbjct: 247 DGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLS---- 302

Query: 302 LTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSV 361
                +   + + S +F ++D +T  L LG V + +     +  E++  +SL I+ SQSV
Sbjct: 303 -LRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSV 361

Query: 362 -----TAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITD----QLPILIC 412
                 A+ +   E I ++ + + SK SSR+L+  L++I  LI++HI D    + P+LIC
Sbjct: 362 NFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLIC 421

Query: 413 CNTGKDISIGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTL 472
           CN+G D+SIG++L  LC++Y++ W L    +V+K +VKKHLA++I+ L G N+NP R+TL
Sbjct: 422 CNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATL 481

Query: 473 KNVNAFLL 480
            +VN++L+
Sbjct: 482 NSVNSYLM 489

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/478 (52%), Positives = 341/478 (71%), Gaps = 19/478 (3%)

Query: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68
           +L QI ++I+++ TSLRNR+QS+ +D+ FIA  V+P FPNYPL+PNERCGLWYC+P  ++
Sbjct: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67

Query: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128
           QT YFKSTDGHTNQWDFSTRRLN H+L  + E  GIIIVDSTRRGK MPDALSKTIPIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127

Query: 129 AVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYNM 188
           AVLN+LM     + D    LF PP  VS+ E D I +++P LV++L+KL+I+  ++L N 
Sbjct: 128 AVLNSLM-----QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLRNK 182

Query: 189 FQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNS--IPVILCTASYQCQDGEDK 246
           FQGK+LRPFWVYPGS +L +S D FTGE++   W+   N   IP+ILCTASY+ QDG DK
Sbjct: 183 FQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGVDK 242

Query: 247 HHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLTAQS 306
            HGFTYVQGAADDHELW+ GL+P++ W N  +  D D+++ ELE  V+ +    + T   
Sbjct: 243 RHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAETTDHR 302

Query: 307 NKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAKAD 366
           N  +D       +++D ITK L LG + +  A+T NI +EL S++SL II SQSVT    
Sbjct: 303 NHLAD------IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSKP 356

Query: 367 CNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQL----PILICCNTGKDISIG 422
            +   IK Y + + SK+SS+DLR ALIEI  ++  H+   +    PI++CCN+G DIS+G
Sbjct: 357 FDF--IKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVG 414

Query: 423 IMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480
           ++L  LC++Y   W L + ++VNK ++++HL +II K+   N+NPSR+TL ++N+FL+
Sbjct: 415 VILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  515 bits (1327), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/494 (51%), Positives = 345/494 (69%), Gaps = 22/494 (4%)

Query: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62
           D+  L  +K+I KE+R++  SL+NRLQS+ +D+ F+  +V P F  YP+VPNERCGLWYC
Sbjct: 2   DKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWYC 60

Query: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122
           +P  Y+ T YFKSTDGH NQWDFSTRRLNFH+L  + E GG++I+DSTRRGKK+PDALSK
Sbjct: 61  DPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALSK 120

Query: 123 TIPIWCAVLNNLMLDYKGK----EDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLN 178
           T+PIWCAVLN LML+  GK    E+ I  LF PP TV + EFD + +K+P+LV+KLKKL+
Sbjct: 121 TVPIWCAVLNYLMLEADGKQWPFEEEI--LFVPPSTVPESEFDRMFAKLPELVQKLKKLD 178

Query: 179 IISGEELYNMFQ-----GKVLRPFWVYPGSPLLDTSRDIFTGEVLGNV-WQSEQNSIPVI 232
           II  ++L    Q      K+LRP WVYPGS LL    D+F+GEV+ N  W+   N IPVI
Sbjct: 179 IIDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPPSNIIPVI 238

Query: 233 LCTASYQCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDF 292
           LCT SYQCQDG DK +GFTYVQGAADDHELWA  L P++FW+NI+ LGD  KS+ EL+D 
Sbjct: 239 LCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKDS 298

Query: 293 VQRIGRTEKLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYS 352
              +    K+    +   D    S  +++D IT  L+LG +     +T    K L  KYS
Sbjct: 299 YNAVILRAKVQNSLDISGD---ISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYS 355

Query: 353 LCIICSQSVTAKADCNCER-IKVYPINNNSKKSSRDLRVALIEISGLIKQHIT-----DQ 406
             ++C ++++        R I ++P+ + SKKSSR+LR  LI+I+ LI++ ++       
Sbjct: 356 AVVLCHEAISVTEITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAAN 415

Query: 407 LPILICCNTGKDISIGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININ 466
           LPILI C++GKDIS+ I+L ALC++Y+L W L+ Q++VNKTI+KKHLA+II  L G N+N
Sbjct: 416 LPILIACDSGKDISVSILLVALCKYYNLDWELQPQDSVNKTIIKKHLAKIIESLQGRNVN 475

Query: 467 PSRSTLKNVNAFLL 480
           PSR++L +VN+FL+
Sbjct: 476 PSRASLNSVNSFLM 489

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  514 bits (1324), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/485 (50%), Positives = 344/485 (70%), Gaps = 18/485 (3%)

Query: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68
           ++ QI K+I+++  SL+NR+QS+  D++F+ + V+P FP +P++PNERCGLWYCNP  +E
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128
           QT YFKSTDGH NQWDFSTRRLNFH+L  +A+ GGI+IVDSTRRGKK+PDALSKT+PIWC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 129 AVLNNLMLDYKGK--EDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELY 186
           AVLN+LML+   +  +D    LF PP TV   E+  I  K+P L+E+L KL II G +LY
Sbjct: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189

Query: 187 NMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNS--IPVILCTASYQCQDGE 244
             F GK+LRP W++PGS LL ++ DIFTGE   +VW++ ++   IP+ILCT SY+ QDG 
Sbjct: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCTVSYRAQDGV 249

Query: 245 DKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLTA 304
           DK HGFTYVQGAADDHELW++GLNP++FW NIE   D D+SE  L+  V+ +     L A
Sbjct: 250 DKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDL-----LAA 304

Query: 305 QSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCII----CSQS 360
           +  + S+ E+  +F  +D IT +++LG +A+G+ + +++  EL SK+S+ I+    C  S
Sbjct: 305 KQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLS 364

Query: 361 VTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHIT-----DQLPILICCNT 415
           V+   +   +RI +  + + SKKSS+ LR  L E+   I+   +      +LPILICCN+
Sbjct: 365 VSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNS 424

Query: 416 GKDISIGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNV 475
           G D+SI ++L  LC+HYDL W+  +   VNK I++KHL ++I+ L G N+NPSR+TL +V
Sbjct: 425 GTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSV 484

Query: 476 NAFLL 480
           N +L+
Sbjct: 485 NEYLM 489

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  508 bits (1308), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 256/494 (51%), Positives = 340/494 (68%), Gaps = 17/494 (3%)

Query: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62
           DE+   +L QI K+IR++  S+RNRLQS+  D+KF+ + V+P+FP+YPL+PNERCGLWYC
Sbjct: 21  DENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYC 80

Query: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122
           NP  ++QT YFKSTDGH NQWDFSTRRLNFH+L  + +  GIIIVDSTRRGKK+PDALSK
Sbjct: 81  NPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSK 140

Query: 123 TIPIWCAVLNNLMLDYKGKEDSIPS-LFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIIS 181
           T+PIWCAVLN LML    K  +I   L+ PP TV K E+D I  K+P+LV KL+KLNII 
Sbjct: 141 TVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIID 200

Query: 182 GEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLG-NVWQS--EQNSIPVILCTASY 238
            ++L  +F GK+LRP WV+PGS LLD S D FTGEV     W++  +QN IP+ILCT SY
Sbjct: 201 SKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSY 260

Query: 239 QCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGR 298
           Q QDG DK +GFTYVQGAADDHELW+ GL+  +FW +IE+LGD   S+ +L D++  +  
Sbjct: 261 QAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA- 319

Query: 299 TEKLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICS 358
             KL  Q   Q        F  +D+IT  + LG V+ G+ + +N++++LKS+Y   II S
Sbjct: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379

Query: 359 QSVTAKADCNCER-------IKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQ----L 407
            SVT   D + E        I +Y + +  KKSS+ LR     I G I+   T++     
Sbjct: 380 NSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439

Query: 408 PILICCNTGKDISIGIMLTALCQHYDLQWHL-EEQETVNKTIVKKHLARIITKLSGININ 466
           P+LICCNTG D+SIG++L+ LC  Y  +W L  E   ++K IV+KHL ++I+ L G N+N
Sbjct: 440 PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVN 499

Query: 467 PSRSTLKNVNAFLL 480
           PSR+TL +VN+FL+
Sbjct: 500 PSRATLNSVNSFLM 513

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  504 bits (1297), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 253/505 (50%), Positives = 350/505 (69%), Gaps = 26/505 (5%)

Query: 1   MEDESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLW 60
           M+     D+L QI K+I+++  SLRNRLQS+  D++F+ +E++  FPNYP++PNERCGLW
Sbjct: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60

Query: 61  YCNPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDAL 120
           Y +P +Y QT YFKSTDGHTNQWDFSTRRLNFH+L  +A++ GI I+DSTRRGKK+PDAL
Sbjct: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120

Query: 121 SKTIPIWCAVLNNLML-DYKGKEDSIP---SLFCPPGTVSKLEFDGIHSKVPDLVEKLKK 176
           SKTIPIWCAVLN +ML + KG  D +     LF PP TV K E+D I  K+P LVEKL K
Sbjct: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180

Query: 177 LNIISGEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGE-VLGNVWQSEQNSIPVILCT 235
           L II+  EL + F GK+LRP W+YPGS +L +SRD+FTGE      W++ +N IP++LCT
Sbjct: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCT 240

Query: 236 ASYQCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQR 295
            SYQ QDG DK +GFTYVQGAADDHELW+ GL PE+FW +I +LG+P  S+ EL ++V+ 
Sbjct: 241 ISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRH 300

Query: 296 IGRTEKLTAQSNKQSDRESSSSFIK-VDEITKNLYLGTVAEGIALTENIEKELKSKYSLC 354
           +    K+   + K  +    + F   VD IT  + LG +   I +T+++  E K  +SL 
Sbjct: 301 MIEM-KIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLV 359

Query: 355 IICSQSVTAKADCNCER----IKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPIL 410
           +I S++VT  +D   E+    +K+Y + + SKKSS+ LR  + +I  ++++++T+  PIL
Sbjct: 360 VILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPIL 419

Query: 411 ICCNTGKDISIGIMLTALCQHYDLQ------WHLEEQET---------VNKTIVKKHLAR 455
           ICCNTG DISIGI+LT LC++Y L       W   E+ET         ++KTI++K+L  
Sbjct: 420 ICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTT 479

Query: 456 IITKLSGININPSRSTLKNVNAFLL 480
           +I+ L G N+NPSR+TL +VN +L+
Sbjct: 480 LISHLEGRNVNPSRATLNSVNDYLM 504

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 245/486 (50%), Positives = 339/486 (69%), Gaps = 17/486 (3%)

Query: 7   LDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGK 66
           L++L QI K+IR++  S+RNRLQS+  D+KF+ +EVLP FP++P++PNERCGLWY  P  
Sbjct: 6   LESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPED 65

Query: 67  YEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPI 126
           ++QT YFKSTDGHTNQWDFSTRRLNFH+   +  +GGIIIVDSTRRGKK+PDALSKTIPI
Sbjct: 66  FKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPI 125

Query: 127 WCAVLNNLMLDYKGKEDSI---PSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGE 183
           WCAVLN +ML  +   D I     LF PP T+SK E+D I  ++PDLV KL KL+I+ G 
Sbjct: 126 WCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGN 185

Query: 184 ELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQ--NSIPVILCTASYQCQ 241
           EL+ + QGK+LRPFWVYPGS LL +SRD+FTGE+ G+ W   Q  N IP+ILCT SY+ Q
Sbjct: 186 ELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQ 245

Query: 242 DGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEK 301
           DG DK HGFTYVQGAADDHELW+ GL P +FW +I F  + + +E ++  FV+ + + + 
Sbjct: 246 DGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQD 305

Query: 302 LTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSV 361
               + +QSD   + +F  +D +T  L LG + + + + + + ++L  +++L II S++V
Sbjct: 306 ---DAGEQSD--INDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360

Query: 362 TAKADCNCE---RIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQL--PILICCNTG 416
                 N        ++ + + SKKSS+ LR  + EI GL++  + + L  PILICCNTG
Sbjct: 361 ELDPVDNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNKPILICCNTG 420

Query: 417 KDISIGIMLTALCQHYDLQWHLEEQET--VNKTIVKKHLARIITKLSGININPSRSTLKN 474
            D+SIGI+L  LC++Y  +W L E E   ++K +++K L R+I+ L G  IN SR+TL +
Sbjct: 421 TDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNS 480

Query: 475 VNAFLL 480
           VN +L+
Sbjct: 481 VNNYLM 486

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 244/492 (49%), Positives = 338/492 (68%), Gaps = 19/492 (3%)

Query: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62
           D + L +L QI KE++RD  SLRNR+QS+  D++F+   V   FP++PL+PNERCGLWYC
Sbjct: 13  DRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYC 72

Query: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122
           NP  + QT YFKSTDGH NQWDFSTRRLNFH+L  + EAGG++IVDSTRRGKK+PDALSK
Sbjct: 73  NPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSK 132

Query: 123 TIPIWCAVLNNLMLDYKGKEDSIPS-LFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIIS 181
           T+P+WCAVLN+LML+  GK+ ++   LF PP TV + E D +  K+PDLVEKLK LN+  
Sbjct: 133 TVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFD 192

Query: 182 GEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQ--SEQNSIPVILCTASYQ 239
           G +   M  GK+LRPFWV+PGS LL +  DIFTGE + N W+   ++N +P+ILCT SYQ
Sbjct: 193 GTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQ 252

Query: 240 CQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRT 299
            QDG DK +GFTYVQGAADDHELW++GL   IFW NI+   +    + EL + V ++   
Sbjct: 253 AQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKM--- 309

Query: 300 EKLTAQSNKQSDRESSSSFIK----VDEITKNLYLGTVAEGIALTENIEKELKSKYSLCI 355
             +T Q+N       + S  K    +D++T  L LG + + + L+     +L+  YS  I
Sbjct: 310 --VTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVI 367

Query: 356 ICSQSVTAKADC--NCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQ--LPILI 411
           + S++V    D   + E +K++ + + SKKSS++LR  L +IS  I   I  Q   P+LI
Sbjct: 368 VLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIKPLLI 427

Query: 412 CCNTGKDISIGIMLTALCQHYDLQWHLEEQE---TVNKTIVKKHLARIITKLSGININPS 468
           CCNTGKD+SIG++L  LCQ+YD  W L  ++   +V+K ++++HL ++I  L+G N+NPS
Sbjct: 428 CCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPS 487

Query: 469 RSTLKNVNAFLL 480
           R+TL ++N+FL+
Sbjct: 488 RATLNSINSFLM 499

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/494 (50%), Positives = 340/494 (68%), Gaps = 17/494 (3%)

Query: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62
           DE    +L +I +++R++  S+RNRLQS+  D+KF+ + V+P+FP +PLVPNERCG+WYC
Sbjct: 2   DEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYC 61

Query: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122
            P  Y+QT YFKSTDGH NQWDFSTRRLNFH+L  + +  GIIIVDSTRRGKK+PDALSK
Sbjct: 62  KPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSK 121

Query: 123 TIPIWCAVLNNLMLDYKGKEDSI-PSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIIS 181
           T+PIWCAVLN +ML    +   I  +L+ PP TV K E+D I  K+P+LV KL+KLNII 
Sbjct: 122 TVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIID 181

Query: 182 GEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGN-VWQS--EQNSIPVILCTASY 238
            ++L  +F GK+LRP WV+PGS LL+ S D FTGE+  +  W++  +QN IP+ILCT SY
Sbjct: 182 SKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSY 241

Query: 239 QCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGR 298
           Q QDG DK +GFTYVQGAADDHELW+ GL+ ++FW ++EFL D + S+ +L D++  +  
Sbjct: 242 QAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDL-V 300

Query: 299 TEKLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICS 358
            +KL +Q   Q        F KVD+IT  + LG V +G+ + E +++ELKS+Y   +I S
Sbjct: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360

Query: 359 QSVTAKADCNCER-------IKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQL---- 407
            SVT   D            I VY + +  KKSS+ LR  L +I   ++    ++     
Sbjct: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420

Query: 408 PILICCNTGKDISIGIMLTALCQHYDLQWHL-EEQETVNKTIVKKHLARIITKLSGININ 466
           P+L+CCNTG D+SIG++L+ LC  Y  +W L +E   VNK I++KHL ++I+ L G N+N
Sbjct: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480

Query: 467 PSRSTLKNVNAFLL 480
           PSR+TL +VN+FL+
Sbjct: 481 PSRATLNSVNSFLM 494

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  489 bits (1258), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 251/489 (51%), Positives = 333/489 (68%), Gaps = 19/489 (3%)

Query: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68
           +L QI K++R++  S+RNRLQS+  D++F+ + VLP+FP +P+VPNERCGLWYC P  +E
Sbjct: 24  SLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEPSSFE 83

Query: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128
           QT YFKSTDGH NQWDFSTRRLNFH+L  + E  GIIIVDSTRRGKK+PDALSKT+PIWC
Sbjct: 84  QTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTVPIWC 143

Query: 129 AVLNNLMLDYKGKEDSIPS-LFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYN 187
           AVLN +ML    +   I   L+ PP TV K E+D I  K+P+LV+KL+KLN I  + L  
Sbjct: 144 AVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAIDSKTLNK 203

Query: 188 MFQGKVLRPFWVYPGSPLLDTSRDIFTGEV-LGNVWQS--EQNSIPVILCTASYQCQDGE 244
           +F+GK+LRP WV+PGS LL+ S D FTGE+    +W+S  +QN IP+ILCT SYQ QDG 
Sbjct: 204 LFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCTVSYQAQDGM 263

Query: 245 DKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFV-QRIGRTEKLT 303
           DK +GFTYVQGAADDHELW+ GL+ ++FW +I++LGD + S+ +L  ++   IG+  KL 
Sbjct: 264 DKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGK--KLE 321

Query: 304 AQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSV-- 361
            Q + Q        F  +D+IT  + LG V +G+ + E +EKELK  Y   II S SV  
Sbjct: 322 YQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSNSVAI 381

Query: 362 TAKADCNCER-----IKVYPINNNSKKSSRDLRVALI----EISGLIKQHITDQLPILIC 412
            A AD   E      I VY + +  KKSS+ LR        E+  +         PIL+C
Sbjct: 382 AAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKGMKPILVC 441

Query: 413 CNTGKDISIGIMLTALCQHYDLQWHL-EEQETVNKTIVKKHLARIITKLSGININPSRST 471
           CNTG D+SIG++L+ LC  Y+ +W L  E   VNK I++KHL ++I+ L G N+NPSR+T
Sbjct: 442 CNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRNVNPSRAT 501

Query: 472 LKNVNAFLL 480
           L +VN+FL+
Sbjct: 502 LNSVNSFLM 510

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  487 bits (1254), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 241/494 (48%), Positives = 337/494 (68%), Gaps = 17/494 (3%)

Query: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62
           D+  L +L QI K++RR+  S+RNRLQS+  D+KF+   V+ +FP++P+VPNERCGLWYC
Sbjct: 2   DKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWYC 61

Query: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122
            P  +++T YFKSTDGH NQWDFSTRRLNFH+L  + +  GIII+DSTRRGKK+PD+LSK
Sbjct: 62  EPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLSK 121

Query: 123 TIPIWCAVLNNLMLDYKGKEDSIPS-LFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIIS 181
           T+PIWCAVLN +ML  + ++  I   L+ PP TV K E+D I  K+P+LV KLKKLN++ 
Sbjct: 122 TVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVVD 181

Query: 182 GEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVL-GNVWQS--EQNSIPVILCTASY 238
            E+L ++F GK+LRP WV+PGS LL+ S D FTGE+     W++  +QN IP+ILCT SY
Sbjct: 182 SEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVSY 241

Query: 239 QCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGR 298
           Q QDG DK +GFTYVQGAADDHELW+ GL+ E+FW ++++LGD DKS+ +L D++  +  
Sbjct: 242 QAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV- 300

Query: 299 TEKLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICS 358
            +KL  Q + +        F  +D IT  + LG V +G+ ++  +++ELK +Y   I+ S
Sbjct: 301 AKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFS 360

Query: 359 QSVTAKADCNCER-------IKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQ----L 407
            SV    D + E        I V+ + +  KKSS+ LR     I   ++    ++     
Sbjct: 361 DSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTK 420

Query: 408 PILICCNTGKDISIGIMLTALCQHYDLQWHLE-EQETVNKTIVKKHLARIITKLSGININ 466
           PILICCNTG D+SIG++L+ LC  Y   W L  E   VNK I+++HL ++I+ L G N+N
Sbjct: 421 PILICCNTGTDMSIGVILSILCTKYTEDWKLTPELPEVNKIIIRRHLTKLISHLRGRNVN 480

Query: 467 PSRSTLKNVNAFLL 480
           PSR+TL +VN+FL+
Sbjct: 481 PSRATLNSVNSFLM 494

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  483 bits (1242), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 240/494 (48%), Positives = 337/494 (68%), Gaps = 28/494 (5%)

Query: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68
           ++ QI K+IR++  SL+NR+ S+  DSKF+  +V+P FP YPLVPNERCGLWYC    + 
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128
            T YFKSTDGH NQWDFSTRRLNFH++  + E  GIII+DSTRRGKK+PDALSKT+PIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 129 AVLNNLMLDY-KGKED-SIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELY 186
           AVLN ++L + + +ED S   LF PP TVSK E++ I +K+P+LVEKL KL++I G++LY
Sbjct: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184

Query: 187 NMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGN-VWQS---EQNSIPVILCTASYQCQD 242
             F+G +LRP W++PGS +L +  D FTGE++ N  W+    E+  IP++LCT SYQ QD
Sbjct: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQD 244

Query: 243 GEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKL 302
           G D   GFTYVQGAADDHELW++GL+P++FW NIE L + + SE  LED+V+ I     L
Sbjct: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEI-----L 299

Query: 303 TAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVT 362
            ++S K ++ E    F  +D+IT+ LYLG + +G+ + +N+ +     YSL II S S+ 
Sbjct: 300 LSESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIK 359

Query: 363 AKADCNCER-----------IKVYPINNNSKKSSRDLRVALIEISGLIKQHITD----QL 407
             +D   E+           IK++ + + SKKSS++LR  L EI  L+   ++     + 
Sbjct: 360 LASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419

Query: 408 PILICCNTGKDISIGIMLTALCQHYDLQWHLEEQET-VNKTIVKKHLARIITKLSGININ 466
           PIL+CCN G D+SI ++L  L + Y  +W    + T +NK  ++KHL ++I+ L G N+N
Sbjct: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVN 479

Query: 467 PSRSTLKNVNAFLL 480
           PSR+TL +VN FL+
Sbjct: 480 PSRATLNSVNDFLM 493

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  476 bits (1226), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 247/491 (50%), Positives = 337/491 (68%), Gaps = 25/491 (5%)

Query: 7   LDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGK 66
           +D+L  IKK+I+ +  SL+NRLQS+  D+ F+ NEV+P FPNYP++PNERCGLWYC+P  
Sbjct: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60

Query: 67  YEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPI 126
           +EQT YFKSTDGH NQWDFSTRRLNFH+L  +A++ GIIIVDSTRRGKK+PDALSKTIPI
Sbjct: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120

Query: 127 WCAVLNNLMLDYKGKE--DSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEE 184
           WCAVLN L+L++   E  D    LF PP TVS  E+  I  K+ +LV KLK L ++  +E
Sbjct: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180

Query: 185 LYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNS--IPVILCTASYQCQD 242
           LYNM  GK++RPFWVYPGS LL T  D FTGE  G  W   +N   IP+ILCT SYQ QD
Sbjct: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240

Query: 243 GEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKL 302
           G DK  GF YVQGAADDHELW+ GL P+ FW+NI++L D  K++  L++FV      + L
Sbjct: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFV------DTL 294

Query: 303 TAQSNKQSDRESSSSFIKVDE----ITKNLYLGTVAEGIALTENIEKELKSKYSLCIICS 358
           T + N +  +++SSS I + E    +T  + LG + +   +   +  EL  K+SL II S
Sbjct: 295 TLEENHE--KKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILS 352

Query: 359 QS--VTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITD-----QLPILI 411
           ++  +T   +   + IK++ + + SKKSS+ LR+ L EI   I  +  D     + PILI
Sbjct: 353 ETIEITKLEEATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILI 412

Query: 412 CCNTGKDISIGIMLTALCQHYDLQWHLEEQE--TVNKTIVKKHLARIITKLSGININPSR 469
           CCN+G D+S+ ++LT L + Y   W LE  +   ++KT+++KHLA++I+ L G N+NPSR
Sbjct: 413 CCNSGNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSR 472

Query: 470 STLKNVNAFLL 480
           +TL ++N++L+
Sbjct: 473 ATLNSINSYLM 483

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  461 bits (1187), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/416 (54%), Positives = 299/416 (71%), Gaps = 13/416 (3%)

Query: 68  EQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIW 127
           E TCYFKSTDGH N WDFS RRLNFH+L  +AE  G IIVDSTRRGKK+PDALSKTIPIW
Sbjct: 3   ETTCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIW 62

Query: 128 CAVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYN 187
           CAVLN L+L++   E S   LFCPPGTVS+LE++ I +K+P+LV+KLK+++ ISG EL +
Sbjct: 63  CAVLNTLILEHT--EGSGEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCS 120

Query: 188 MFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNSIPVILCTASYQCQDGEDKH 247
           +  G++LRPFWVYPG+ +L T+RD+FTGE L   WQ     IP+ILCTAS QCQDG DK 
Sbjct: 121 LLGGRLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQPPPGVIPLILCTASRQCQDGVDKS 180

Query: 248 HGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEKLT---A 304
            G+ YVQGAADDHELWANGL P +FW N++ L D    E  L+  V+RI    K T   A
Sbjct: 181 QGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKSTHTEA 240

Query: 305 QSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAK 364
            +++   RE+       D +T++L LG+VA    +++   + L+ +YSL ++C  S+   
Sbjct: 241 VAHELPCRET-------DVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELS 292

Query: 365 ADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDISIGIM 424
           A     RI++YP+N+  KKSSR LR ALIEI  LI   + + LP+LICC++G DIS+GI+
Sbjct: 293 AAAPHPRIRIYPLNSGCKKSSRALRPALIEIIPLISTALCEALPVLICCSSGSDISVGIV 352

Query: 425 LTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480
           L ALC++YDL+W  E+Q+ + KTI+KKHL ++ +K+ G  INPSR+TL +VNAFL+
Sbjct: 353 LAALCKNYDLEWRHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>Skud_10.61 Chr10 complement(104460..105818) [1359 bp, 452 aa] {ON}
           YJL155C (REAL)
          Length = 452

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 17/88 (19%)

Query: 252 YVQGAADDHELWANGLNPEIFWKNIEFLGD--PDKSEFELE----DFVQRIGRTEKLTAQ 305
           +++  +DDHEL AN         N + +G   PD   FE E    DF+ RIG+ E+    
Sbjct: 129 FLESWSDDHELIAN---------NAKDIGSTSPDYKGFEPEVAEADFLNRIGQYERFYEP 179

Query: 306 SNKQSDRESSSSFIKVDEITKNLYLGTV 333
            + Q+DR+   +F+K+  I + + +  +
Sbjct: 180 LDAQNDRD--MTFVKLINIVEEVVINKI 205

>Smik_15.477 Chr15 (819649..823518) [3870 bp, 1289 aa] {ON} YOR296W
           (REAL)
          Length = 1289

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 16/90 (17%)

Query: 232 ILCTASYQCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELED 291
           I C      +    K +GF      + D +         I WKN E L        E+ +
Sbjct: 283 IFCGELRYLRKKIKKDNGFLTASDFSSDRDY--------ILWKNYELL--------EIAN 326

Query: 292 FVQRIGRTEKLTAQSNKQSDRESSSSFIKV 321
            + R G  EK+T+  N+   +++ S+F+++
Sbjct: 327 LMDRFGTGEKVTSHGNRLIPKDAKSAFVRL 356

>NCAS0A00850 Chr1 (165458..170164) [4707 bp, 1568 aa] {ON} Anc_2.1
           YNL242W
          Length = 1568

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 33/81 (40%)

Query: 344 EKELKSKYSLCIICSQSVTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHI 403
           E+EL   ++L  IC   V  +       I      N  +   + L ++ I I G   +  
Sbjct: 353 EQELSENFTLSFICLNKVALELSAETNLILRQASFNKQENKEQTLIISSIGIEGGTAKIT 412

Query: 404 TDQLPILICCNTGKDISIGIM 424
               PIL C  T KDI + I+
Sbjct: 413 HSNRPILKCSLTEKDIMVDIL 433

>ZYRO0D14344g Chr4 (1215124..1217427) [2304 bp, 767 aa] {ON} highly
           similar to uniprot|P29496 Saccharomyces cerevisiae
           YLR274W CDC46 Component of the hexameric MCM complex
           which is important for priming origins of DNA
           replication in G1 and becomes an active ATP-dependent
           helicase that promotes DNA melting and elongation when
           activated by Cdc7p-Dbf4p in S-phase
          Length = 767

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 43/110 (39%), Gaps = 31/110 (28%)

Query: 250 FTYVQGAADDHELWANGLNPEIFWKN-----------------------------IEFLG 280
           F  +    D +EL+AN + P I+  N                             I  LG
Sbjct: 351 FLQLSRRPDLYELFANSIAPSIYGSNDIKKAIVCLLLGGSKKLLPDGMRLRGDVNILLLG 410

Query: 281 DPDKSEFELEDFVQRIGRTEKLTAQSNKQSDRESSSSFIKVDEITKNLYL 330
           DP  ++ +L  FV+++      T  S K S     ++ ++ D IT++ YL
Sbjct: 411 DPGTAKSQLLKFVEKVSPISVYT--SGKGSSAAGLTASVQRDPITRDFYL 458

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,682,766
Number of extensions: 2426817
Number of successful extensions: 7329
Number of sequences better than 10.0: 31
Number of HSP's gapped: 7446
Number of HSP's successfully gapped: 31
Length of query: 480
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 367
Effective length of database: 40,524,141
Effective search space: 14872359747
Effective search space used: 14872359747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)