Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_4621na 1ON57257229320.0
SAKL0D01232gna 1ON57455318900.0
Kwal_0.16singletonON56454718540.0
ABL116Cna 1ON54450418310.0
KLTH0G10736gsingletonON56852517880.0
KLTH0B08140gna 2ON56852517620.0
Kwal_23.4458na 2ON56554217230.0
KLLA0E14675gsingletonON57353217160.0
KLLA0E24993gsingletonON56853216590.0
SAKL0G15136g5.112ON56955014440.0
SAKL0G14762gsingletonON56554714170.0
KNAG0K01030singletonON58153313880.0
NCAS0D016005.112ON57653113540.0
NDAI0C031505.112ON57456713441e-180
ZYRO0G01474gsingletonON57253613441e-180
Smik_4.30na 3ON57152213071e-174
Suva_4.38na 3ON57152213041e-174
YDL210W (UGA4)na 3ON57152913021e-174
ZYRO0B15048gsingletonON58252113031e-174
TDEL0G013705.112ON56955412991e-173
Skud_4.46na 3ON57152212921e-172
KNAG0E008205.112ON57155112781e-170
SAKL0E14806gna 4ON57855512571e-167
KLLA0E12959gna 4ON57953312481e-165
KLTH0E01144gna 4ON57253512471e-165
Kwal_55.19721na 4ON57755412171e-161
Ecym_22126.205ON5455563773e-38
SAKL0A04730g6.205ON5415533572e-35
TDEL0G014106.205ON5535423544e-35
NCAS0D037506.205ON5695293528e-35
TPHA0E029206.205ON5865273511e-34
AFL081W6.205ON5424823482e-34
Kpol_1033.416.205ON5865343467e-34
KLTH0H04444g6.205ON5325313323e-32
CAGL0H03399g6.205ON5565243298e-32
KNAG0D051406.205ON5434933281e-31
KLLA0C15521g6.205ON5475503262e-31
Smik_7.2066.205ON5634973253e-31
Skud_7.2056.205ON5625583243e-31
NDAI0I011406.205ON6005433245e-31
TBLA0A019606.205ON5945663236e-31
YGL077C (HNM1)6.205ON5635293155e-30
ZYRO0G08602g6.205ON5694993069e-29
Suva_7.1936.205ON5635663023e-28
KAFR0K003606.205ON5385032961e-27
Kwal_56.240096.205ON3423082474e-22
ZYRO0F00242gsingletonON5354732294e-19
ZYRO0G18700g1.173ON5915232053e-16
TBLA0C057401.173ON6595331832e-13
Ecym_81051.173ON5835181804e-13
CAGL0M08272g1.173ON6215391724e-12
Kwal_55.19602na 5ON5585271662e-11
KLTH0F04576g1.173ON5495191591e-10
Kwal_33.138061.173ON5495001572e-10
KAFR0G003901.173ON6075591536e-10
Kthe_YGOB_SAKL0H11484gna 5ON5564041492e-09
Suva_14.415na 5ON5325131492e-09
Skud_14.392na 5ON5315131457e-09
KLLA0A06666g1.173ON5604931431e-08
YNR056C (BIO5)na 5ON5615131431e-08
Smik_14.390na 5ON5545091394e-08
AEL125C1.173ON5754791384e-08
SAKL0C05126g1.173ON5685021368e-08
TPHA0E033501.173ON6474781323e-07
Kpol_2002.701.173ON6225221323e-07
KLLA0B00385gna 5ON5645421295e-07
KNAG0C009801.173ON7145201233e-06
SAKL0H11484gna 5ON5603061233e-06
NDAI0A008901.173ON6415411233e-06
TDEL0G04830singletonON5434051171e-05
YKL174C (TPO5)1.173ON6185001046e-04
Skud_11.511.173ON616482990.002
Smik_11.551.173ON619501970.004
Suva_11.491.173ON619481970.004
SAKL0D00836gna 6ON601114840.12
KLTH0B02046g5.158ON589149840.15
Skud_7.5255.158ON603148830.19
Kwal_33.154075.158ON58787820.26
Kwal_33.14276na 6ON596146810.30
TBLA0B077605.158ON65896810.31
YDR177W (UBC1)8.375ON215123790.35
CAGL0B03773g5.158ON605134800.40
Suva_7.4855.158ON603548790.53
Skud_4.4418.375ON215122760.64
Suva_2.716singletonON603140780.67
Suva_2.3438.375ON215122760.71
Smik_4.4258.375ON215122760.71
Skud_51.1singletonON348161770.90
Skud_7.4singletonON349161760.94
TPHA0A002405.158ON603112742.2
TBLA0E015704.49ON19458722.4
Ecym_47895.158ON588130723.8
Kwal_27.126811.244ON59386724.1
KLTH0E15642g1.244ON59676724.1
SAKL0D04664g1.244ON593122714.5
Smik_6.473na 7ON606121714.6
Kpol_543.78singletonON60569714.7
Kpol_543.791.244ON605130706.3
Ecym_10871.83ON570140707.0
CAGL0L03267g1.244ON597106697.6
KNAG0C02140singletonON598137699.3
ZYRO0D03762g1.244ON60073699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4621
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {O...  1134   0.0  
SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON...   732   0.0  
Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL21...   718   0.0  
ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,...   709   0.0  
KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {...   693   0.0  
KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {...   683   0.0  
Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W...   668   0.0  
KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} simi...   665   0.0  
KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]...   643   0.0  
SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]...   560   0.0  
SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]...   550   0.0  
KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8....   539   0.0  
NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112    526   0.0  
NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {O...   522   e-180
ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {...   522   e-180
Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)   508   e-174
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)   506   e-174
YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease...   506   e-174
ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]...   506   e-174
TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112    504   e-173
Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)   502   e-172
KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112    496   e-170
SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} simi...   488   e-167
KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]...   485   e-165
KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {...   484   e-165
Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...   473   e-161
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...   149   3e-38
SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} simila...   142   2e-35
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...   140   4e-35
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...   140   8e-35
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...   139   1e-34
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...   138   2e-34
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...   137   7e-34
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...   132   3e-32
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...   131   8e-32
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...   130   1e-31
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...   130   2e-31
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...   129   3e-31
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...   129   3e-31
NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205    129   5e-31
TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {O...   129   6e-31
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...   125   5e-30
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...   122   9e-29
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...   120   3e-28
KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.20...   118   1e-27
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...   100   4e-22
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    93   4e-19
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    84   3e-16
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    75   2e-13
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    74   4e-13
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    71   4e-12
Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C ...    69   2e-11
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    66   1e-10
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    65   2e-10
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    64   6e-10
Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346...    62   2e-09
Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {...    62   2e-09
Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {...    60   7e-09
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    60   1e-08
YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON} ...    60   1e-08
Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {...    58   4e-08
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    58   4e-08
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    57   8e-08
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    55   3e-07
Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa] ...    55   3e-07
KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON...    54   5e-07
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    52   3e-06
SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {...    52   3e-06
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    52   3e-06
TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {O...    50   1e-05
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    45   6e-04
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    43   0.002
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    42   0.004
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    42   0.004
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...    37   0.12 
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...    37   0.15 
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...    37   0.19 
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...    36   0.26 
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...    36   0.30 
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...    36   0.31 
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    35   0.35 
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...    35   0.40 
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...    35   0.53 
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    34   0.64 
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...    35   0.67 
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    34   0.71 
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    34   0.71 
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)      34   0.90 
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)      34   0.94 
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...    33   2.2  
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    32   2.4  
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...    32   3.8  
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...    32   4.1  
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...    32   4.1  
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...    32   4.5  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...    32   4.6  
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...    32   4.7  
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...    32   6.3  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...    32   7.0  
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...    31   7.6  
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...    31   9.3  
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...    31   9.4  

>Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL116C
          Length = 572

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/572 (98%), Positives = 565/572 (98%)

Query: 1   MVSYLEGQQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVE 60
           MVSYLEGQQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVE
Sbjct: 1   MVSYLEGQQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVE 60

Query: 61  LLAEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFI 120
           LLAEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFI
Sbjct: 61  LLAEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFI 120

Query: 121 LSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLA 180
           LSIGAAMSELASAIPTSGGL       APPKFKAILSFLIGNSNSLALVAGLCSVEYGLA
Sbjct: 121 LSIGAAMSELASAIPTSGGLYYYTYYYAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLA 180

Query: 181 QEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA 240
           QEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA
Sbjct: 181 QEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA 240

Query: 241 FLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHM 300
           FLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHM
Sbjct: 241 FLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHM 300

Query: 301 SEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNV 360
           SEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNV
Sbjct: 301 SEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNV 360

Query: 361 LGKQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRA 420
           LGKQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRA
Sbjct: 361 LGKQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRA 420

Query: 421 TWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMG 480
           TWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMG
Sbjct: 421 TWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMG 480

Query: 481 KFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHK 540
           KFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHK
Sbjct: 481 KFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHK 540

Query: 541 TFEGPKSNLTDSDLNTPDGSIEHISSQTFEKQ 572
           TFEGPKSNLTDSDLNTPDGSIEHISSQTFEKQ
Sbjct: 541 TFEGPKSNLTDSDLNTPDGSIEHISSQTFEKQ 572

>SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 574

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/553 (66%), Positives = 436/553 (78%), Gaps = 2/553 (0%)

Query: 3   SYLEGQQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELL 62
           SY+E  Q  K     L P ++ N +  VQQI+S++T  SK   +VNYINAK A+DD ELL
Sbjct: 6   SYVEKNQI-KTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELL 64

Query: 63  AEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILS 122
           AEIGYKQEL+RHFSTIQVFGIAFSIMGLLPSIASIL +A  GG +S VWGWLI G FILS
Sbjct: 65  AEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILS 124

Query: 123 IGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQE 182
           +GA M+ELASAIPTSGGL       APPKFK +LSFLIGNSNSLAL+A LCS++YGLAQE
Sbjct: 125 VGAGMAELASAIPTSGGLYYYTYYYAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQE 184

Query: 183 VLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAF- 241
           +LSIV I KDGDFE++++KT+ VY   I+AT +LTS+AT AVS LQT SIV N+ L+ F 
Sbjct: 185 ILSIVVISKDGDFEITNAKTYGVYAGCIIATTLLTSVATVAVSKLQTFSIVSNVLLIIFF 244

Query: 242 LIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMS 301
           LIVLPIGV+ +D +TFNG  FIF NF+N   W D  +F + G  P VWVIGAFDS IHMS
Sbjct: 245 LIVLPIGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMS 304

Query: 302 EEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVL 361
           EEAKNA+KAVP+ ILTSI+VCW++GF I + I ACMG +I+ +LDT +GQPLAQ+L+N L
Sbjct: 305 EEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNAL 364

Query: 362 GKQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRAT 421
           GK+WA+ FM+LIA CQ++MGAS LTAISRQIWAFARDDGLPFS+WIKKVN  LSSP+RAT
Sbjct: 365 GKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRAT 424

Query: 422 WVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGK 481
           W G   A+ IGLL L G  AS+ALFSMY+ ANY AWM PNLLRM  GK IF+PG FYMG 
Sbjct: 425 WFGGAGALCIGLLCLIGSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGN 484

Query: 482 FWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKT 541
           FWSP+INW SIIF++  I++MM P++  NIT  +MNYT +F GFVWFGSI Y+  YKH+T
Sbjct: 485 FWSPVINWTSIIFEIFIIIMMMFPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRT 544

Query: 542 FEGPKSNLTDSDL 554
           F GPKSNLTD + 
Sbjct: 545 FHGPKSNLTDDEF 557

>Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL210W
           (UGA4) - GABA-specific transport protein [contig 75]
           FULL
          Length = 564

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/547 (65%), Positives = 425/547 (77%), Gaps = 3/547 (0%)

Query: 25  NTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIA 84
           N    + +  S++T  SK   +VNYINAKTA+DD ELLAEIGYKQELSRHFST+QVFGIA
Sbjct: 18  NAVGEIHEYRSLRTITSKRAGEVNYINAKTAHDDTELLAEIGYKQELSRHFSTLQVFGIA 77

Query: 85  FSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXX 144
           FSIMGLLPSIAS+L +A PGGMVSFVWGWLI G F+L IG +MSELASAIPTSGGL    
Sbjct: 78  FSIMGLLPSIASVLLMAFPGGMVSFVWGWLISGFFVLLIGCSMSELASAIPTSGGLYYYT 137

Query: 145 XXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFA 204
              AP +FK++LSFLIGNSN+LAL AGLCSV YG AQEVL+IV I KDG+FEL++   + 
Sbjct: 138 YYYAPKRFKSLLSFLIGNSNTLALTAGLCSVTYGFAQEVLAIVVISKDGNFELTNGMIYG 197

Query: 205 VYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAF-LIVLPIGVANNDSMTFNGPGFI 263
           VY A I+AT+++TS+AT AVS LQTVSIV NL+L+AF LIVLPIGV+    + FN   FI
Sbjct: 198 VYAAGIVATMMVTSVATVAVSRLQTVSIVSNLALIAFFLIVLPIGVSKTKWLDFNDGSFI 257

Query: 264 FANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCW 323
           F N+ N ++WPD  QF + G  P VW IGAFDS IHMSEEAKNA+KAVP  IL SI+VCW
Sbjct: 258 FGNWTNETTWPDGWQFMMTGFQPAVWTIGAFDSCIHMSEEAKNATKAVPAGILGSISVCW 317

Query: 324 LLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGAS 383
           ++GF I + IAACMGPDI+ +LD+A+G PLAQ+L+N LGK+W +AFM+LIA CQ+VMG S
Sbjct: 318 VVGFFICIAIAACMGPDIDAILDSAYGSPLAQILYNALGKKWTMAFMTLIAFCQFVMGCS 377

Query: 384 ILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASS 443
           ILTAISRQIWAFARDDGL FS  IK VNK LSSP+RATW GA  A++IGLL L G  AS+
Sbjct: 378 ILTAISRQIWAFARDDGLMFSKHIKVVNKKLSSPLRATWFGAAGALVIGLLCLIGGTASN 437

Query: 444 ALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMM 503
           ALFSMY+ ANYL+WMMPNLLRM  GK++F PG FYMG FWSPI+NW SI F+L  IV+MM
Sbjct: 438 ALFSMYIAANYLSWMMPNLLRMTTGKDVFKPGAFYMGDFWSPIVNWTSIAFELFIIVMMM 497

Query: 504 LPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS--I 561
            PT    IT  +MNYT +  G VW GS+ YF+ YKHK F GPKSNL+D++ +   G   I
Sbjct: 498 FPTEKTGITPDTMNYTIVICGAVWLGSLAYFLTYKHKYFHGPKSNLSDAEFDKAVGQDVI 557

Query: 562 EHISSQT 568
           + I S +
Sbjct: 558 DQILSHS 564

>ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,
           544 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDL210W (UGA4); 1-intron
          Length = 544

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/504 (68%), Positives = 410/504 (81%), Gaps = 2/504 (0%)

Query: 47  VNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGM 106
           +NYI+AK  +DDVELLAEIGYKQEL RHFST+Q+FGIAFSIMGLLPSIAS+L +ALPGG 
Sbjct: 40  MNYIDAKNVHDDVELLAEIGYKQELKRHFSTLQIFGIAFSIMGLLPSIASVLPVALPGGS 99

Query: 107 VSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSL 166
           VS VWGW IFG FIL++GAAM+ELASA PTSGGL       APP+ KA LSFLIGN NSL
Sbjct: 100 VSMVWGWFIFGAFILAVGAAMAELASAFPTSGGLYYYTYYYAPPRLKACLSFLIGNGNSL 159

Query: 167 ALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSV 226
           AL+AGLCS+EYGLA+++LSI+AI  +     S    + +YC  +LATV+L S+AT +VS+
Sbjct: 160 ALIAGLCSIEYGLAEQILSIIAISSNSYLVSSRWLLYGIYCMGLLATVLLASIATFSVSL 219

Query: 227 LQTVSIVINLSLVA-FLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSL 285
           LQT SIV+NL+LVA F+IVLP+GVA+N    FN   F+F NF+N++ WPD  QFFLCGSL
Sbjct: 220 LQTASIVMNLALVALFIIVLPVGVAHNGR-GFNSAKFMFTNFENHTGWPDWFQFFLCGSL 278

Query: 286 PIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLL 345
           PIVWVIGAFDST+HMSEEAKNA+++VP+ IL+SI+ CW LGF IVV IAACMGPDI+ +L
Sbjct: 279 PIVWVIGAFDSTVHMSEEAKNATRSVPIGILSSISTCWALGFAIVVVIAACMGPDIDAIL 338

Query: 346 DTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSF 405
           +  F  PLAQ+L+N LGK WA++ M  I VCQY+MGASILTA SRQIWAFARDDGLPFS 
Sbjct: 339 NGEFNHPLAQILYNALGKGWALSVMVFIVVCQYLMGASILTASSRQIWAFARDDGLPFSS 398

Query: 406 WIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRM 465
           WIK VN  LSSP+RATW  AF A++IGLLTLAGP ASSALFSM V ANYLAWM PNLLRM
Sbjct: 399 WIKVVNTKLSSPLRATWASAFVALVIGLLTLAGPTASSALFSMAVAANYLAWMTPNLLRM 458

Query: 466 LFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGF 525
           LFGK I+ PG FYMGKFWSP+INW +I+FQ+  I++MM P++   +  S+MNYT + TGF
Sbjct: 459 LFGKEIYRPGSFYMGKFWSPVINWTAILFQVFIILVMMFPSDTAGLRASTMNYTAIITGF 518

Query: 526 VWFGSIIYFVLYKHKTFEGPKSNL 549
           VW GSI YF+ YKH+TF GPKSNL
Sbjct: 519 VWIGSIFYFLAYKHRTFIGPKSNL 542

>KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/525 (63%), Positives = 412/525 (78%), Gaps = 1/525 (0%)

Query: 30  VQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMG 89
           + Q  S++T  SK   +VN+I+AK A  D ELLAEIGYKQEL+RHFSTIQVFG+AFSIMG
Sbjct: 24  LHQFGSLRTITSKRAGEVNFIDAKGANGDSELLAEIGYKQELNRHFSTIQVFGVAFSIMG 83

Query: 90  LLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAP 149
           LLPSIAS+L I +PGGMVS +WGWLI G+FIL++G  M+ELASAIPTSGGL       +P
Sbjct: 84  LLPSIASVLAIGMPGGMVSLMWGWLIAGIFILAVGCGMAELASAIPTSGGLYYYTYYYSP 143

Query: 150 PKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAA 209
            K+KA LSF+IGN+NSLALVAGLCS+ YGLAQE+LSIV + KDGDF ++S KT+ V+ A 
Sbjct: 144 EKYKAFLSFVIGNTNSLALVAGLCSITYGLAQEILSIVVVAKDGDFNITSGKTYGVFVAG 203

Query: 210 ILATVILTSMATAAVSVLQTVSIVINLSL-VAFLIVLPIGVANNDSMTFNGPGFIFANFQ 268
           I AT  +TS+AT AVS LQTVSI+ N+ L V F IVLPIGVAN   + FN   FIF  +Q
Sbjct: 204 IAATTAVTSLATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTKGLNFNDGSFIFGKWQ 263

Query: 269 NNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFC 328
           N +SWPD  QF + G  P +W IGAFDS IHMSEEAKNA+KAVPV I++SI VCW+LGF 
Sbjct: 264 NETSWPDGWQFMMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPVGIISSIGVCWILGFI 323

Query: 329 IVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAI 388
           + + IAACMGP+I+ +L++++G PL Q+LFN LGK+W IAFM+LIA CQ++MG SILTAI
Sbjct: 324 VCIVIAACMGPNIDAILESSYGSPLPQILFNALGKKWTIAFMTLIAACQFLMGCSILTAI 383

Query: 389 SRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSM 448
           SRQIWAFARDDGL FS +IK VNK LSSP+RATW GA  A++IGLL L G  AS+ALFS+
Sbjct: 384 SRQIWAFARDDGLMFSRYIKVVNKKLSSPLRATWFGALCALVIGLLCLIGSTASNALFSL 443

Query: 449 YVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNP 508
            +G NY+AWM PNLLRM  GK++F PG F+MGK WSPI+NW++IIFQ   ++++M P + 
Sbjct: 444 AIGGNYVAWMTPNLLRMTVGKDLFRPGAFFMGKLWSPIVNWIAIIFQTFILIMIMFPADS 503

Query: 509 INITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
            +IT  +MNYT +  G VW GSI+YF++YK K F GPKSNL+D +
Sbjct: 504 KDITPDTMNYTVVICGGVWIGSIVYFLVYKKKAFHGPKSNLSDEE 548

>KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/525 (62%), Positives = 407/525 (77%), Gaps = 1/525 (0%)

Query: 30  VQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMG 89
           + QI S++T  SK   +VN+I+AK A+ D ELLAEIGYKQEL+RHFST+QVFG+AFSIMG
Sbjct: 24  IHQIGSLRTITSKRAGEVNFIDAKRAHGDAELLAEIGYKQELNRHFSTVQVFGVAFSIMG 83

Query: 90  LLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAP 149
           LLPSIAS+L I +PGGMVS VWGW I G+FIL++G  MSELASAIPTSGGL       AP
Sbjct: 84  LLPSIASVLAIGMPGGMVSLVWGWFIAGIFILAVGCGMSELASAIPTSGGLYYYTYYYAP 143

Query: 150 PKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAA 209
            K+KA  SF+IG SNSLALV+GLCS+ YGLA+E+LSIV + KDGDF +++ KT+ V+ A 
Sbjct: 144 QKYKAFFSFVIGYSNSLALVSGLCSITYGLAEEILSIVVVSKDGDFTITNGKTYGVFVAG 203

Query: 210 ILATVILTSMATAAVSVLQTVSIVINLSL-VAFLIVLPIGVANNDSMTFNGPGFIFANFQ 268
           I AT ++TS+AT AVS LQTVSI+ N+ L V F IVLPIGVAN   + FN   FIF  + 
Sbjct: 204 IAATTVVTSIATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTKGLDFNDGSFIFGKWL 263

Query: 269 NNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFC 328
           N ++WPD  QF L G  P +W IGAFDS IHMSEEAKNA+KAVP+ I++SI+VCW+LGF 
Sbjct: 264 NETTWPDGWQFMLAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPLGIISSISVCWILGFL 323

Query: 329 IVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAI 388
           I + +AACMGPDI+ +L ++FG PL Q+L+N LGK+W IA M+LIA CQ++MG SILTAI
Sbjct: 324 ICIVMAACMGPDIDAILGSSFGSPLPQILYNALGKKWTIAIMTLIAACQFLMGCSILTAI 383

Query: 389 SRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSM 448
           SRQIWAFARDDGL FS +IK VNK LSSP+RATW GA  A++IGLL L G  AS+ALFS+
Sbjct: 384 SRQIWAFARDDGLMFSKYIKVVNKKLSSPLRATWFGAVCALVIGLLCLIGGTASNALFSL 443

Query: 449 YVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNP 508
            +G NYLAWM PNLLRM  GK++F PG FYMGK WSPI+NW +I+FQ+  ++++M P   
Sbjct: 444 GIGGNYLAWMAPNLLRMTTGKDLFRPGAFYMGKTWSPIVNWTAIVFQIFILIMIMFPAES 503

Query: 509 INITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
             IT  +MNYT +  G VW GS+IYF +YK K F GPKSNL+D +
Sbjct: 504 KGITPDAMNYTVVICGGVWIGSMIYFFVYKKKAFNGPKSNLSDDE 548

>Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W
           (UGA4) - 1:1 [contig 2] FULL
          Length = 565

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/542 (61%), Positives = 416/542 (76%), Gaps = 3/542 (0%)

Query: 29  RVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIM 88
            ++QI S++T  SK   +VN+I+AK A DD ELLAEIGYKQEL+RHFST+QVFG+AFSIM
Sbjct: 20  EIRQIGSLRTITSKRAGEVNFIDAKGARDDKELLAEIGYKQELNRHFSTVQVFGVAFSIM 79

Query: 89  GLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXA 148
           GLLPSIAS+L+I   GG V+ VWGWLI G FI++IG +M+ELASAIPTSGGL       A
Sbjct: 80  GLLPSIASVLSIGFAGGAVALVWGWLIAGFFIMTIGLSMAELASAIPTSGGLYYYTYYYA 139

Query: 149 PPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCA 208
           P +FK+ LSF+IGNSNSLAL AGLCS+ YGLA E+LSIV + KDG+FE+++ KT+ VY  
Sbjct: 140 PQRFKSFLSFVIGNSNSLALTAGLCSITYGLALEILSIVVVSKDGNFEITNGKTYGVYVG 199

Query: 209 AILATVILTSMATAAVSVLQTVSIVINLSLVAF-LIVLPIGVANNDSMTFNGPGFIFANF 267
            I AT ++TS+AT AVS +QT+SI+ N++L+AF LIVLPIGV+N   + FN   FIF  F
Sbjct: 200 GIAATAVVTSVATVAVSKMQTLSIISNVALIAFFLIVLPIGVSNTKGLEFNDGSFIFGKF 259

Query: 268 QNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGF 327
            N +SWPD  QF + G  P +W IGAFDS IHMSEEAKNA+KAVP+ I++SI VCW+LGF
Sbjct: 260 MNETSWPDGWQFLMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPIGIISSIFVCWVLGF 319

Query: 328 CIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTA 387
            I + IAACMGPDI+ +L ++FG PLAQ+L+N LGK+W I FMSLIA CQ+ MG SILTA
Sbjct: 320 FICIAIAACMGPDIDAILGSSFGSPLAQILYNALGKKWTITFMSLIAFCQFAMGCSILTA 379

Query: 388 ISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFS 447
           ISRQIWAFARDDGL F  + K VNK LSSPIRATW GA  A++IGLL L G  A++ALFS
Sbjct: 380 ISRQIWAFARDDGLMFPKYFKVVNKKLSSPIRATWFGAACALVIGLLCLIGGTAANALFS 439

Query: 448 MYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTN 507
           + +G NYLAWM PNLLRM  GK++F PG F+MG+FWSPI+NW SI+FQ+  I ++M P  
Sbjct: 440 LGIGGNYLAWMTPNLLRMTVGKDLFRPGQFHMGEFWSPIVNWTSIVFQIFIIFMIMFPAE 499

Query: 508 PINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS--IEHIS 565
            + IT  +MNYT +  G VWFGS+IY+ +YK+K F GPKSNLTD + +   G   I+ I 
Sbjct: 500 KVGITPDTMNYTVVICGGVWFGSMIYYAVYKYKVFHGPKSNLTDEEFSEVVGQDVIDQIL 559

Query: 566 SQ 567
           S 
Sbjct: 560 SH 561

>KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 573

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/532 (60%), Positives = 403/532 (75%), Gaps = 1/532 (0%)

Query: 29  RVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIM 88
           RV  ++S++T  S+ V  VNYINAKTA+DD ELLAEIGYKQEL RHFS  QVFG+AFSIM
Sbjct: 24  RVDVVTSLRTITSRRVGDVNYINAKTAHDDTELLAEIGYKQELQRHFSKTQVFGVAFSIM 83

Query: 89  GLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXA 148
           GLLPSIASIL +ALPGG VS VWGW I G F+L+ G AMSELASAIPTSGGL       A
Sbjct: 84  GLLPSIASILGVALPGGSVSLVWGWAISGAFVLANGLAMSELASAIPTSGGLYYYTHYYA 143

Query: 149 PPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCA 208
           PPK K  LSF++GN NSLAL++ LCS+ YGLA E+LSIV +  +G+F ++++ T+ VY A
Sbjct: 144 PPKVKNFLSFIVGNCNSLALISCLCSINYGLAGEILSIVVVGSNGNFNITNANTYGVYAA 203

Query: 209 AILATVILTSMATAAVSVLQTVSIVINLSLVA-FLIVLPIGVANNDSMTFNGPGFIFANF 267
            I+AT ++TS+AT AVS LQT SIV NL L+  F +VLP+GVA +  M FN   +IF +F
Sbjct: 204 CIIATAVVTSVATTAVSRLQTFSIVSNLLLICIFFVVLPVGVARSKDMEFNDAAYIFGDF 263

Query: 268 QNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGF 327
           +N S W +  QF L G  P++WVIG FDS +HMSEEAKNA+ +VP  I+ SI+VCW LGF
Sbjct: 264 ENLSDWNNGWQFMLAGFQPLIWVIGGFDSCLHMSEEAKNATASVPFGIIGSISVCWFLGF 323

Query: 328 CIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTA 387
            I + IAAC   D+  L++T F QPLAQ+LF+ LGK+W IA M+LIA CQ++M AS LTA
Sbjct: 324 FICIVIAACSSQDVAALVNTKFHQPLAQVLFDALGKKWTIAIMTLIAFCQFLMAASSLTA 383

Query: 388 ISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFS 447
           ISRQIWAFARDDGLPFS WIK VN  LSSP+RATWVGA  A+ IG L L GPVASSALFS
Sbjct: 384 ISRQIWAFARDDGLPFSSWIKVVNVKLSSPLRATWVGAGVALAIGCLCLIGPVASSALFS 443

Query: 448 MYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTN 507
           +Y+ ANY +WM+PNLLRM +GK++F PG F+MGK+ SP++NW+SIIF+L  I+L+  PT 
Sbjct: 444 LYISANYFSWMLPNLLRMTYGKDVFTPGAFFMGKYLSPVVNWISIIFELFMILLVFFPTE 503

Query: 508 PINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDG 559
              IT  +MNY+ +F G VWF + IY+ +YKHK ++GPKSNLTD +     G
Sbjct: 504 QHGITPDTMNYSVVFIGAVWFLATIYYFIYKHKFYKGPKSNLTDEEYEENVG 555

>KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/532 (60%), Positives = 405/532 (76%), Gaps = 1/532 (0%)

Query: 29  RVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIM 88
           +V  ++S++T  S+ V  VNYINAK A+DD ELLAEIGYKQEL RHFS IQVFG+AFSIM
Sbjct: 24  KVDVVTSLRTITSRRVGDVNYINAKAAHDDTELLAEIGYKQELQRHFSKIQVFGVAFSIM 83

Query: 89  GLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXA 148
           GLLPSIAS+L++ALPGG VS VWGW I G F+L+ G AMSELASAIPTSGGL       A
Sbjct: 84  GLLPSIASVLSLALPGGSVSLVWGWGIAGAFVLTNGLAMSELASAIPTSGGLYYYTYYYA 143

Query: 149 PPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCA 208
           PPK K +LSF++GNSNSLAL+AGLCS+ YGLA E+LSIV +  DG+F ++++ T+ VY A
Sbjct: 144 PPKVKNLLSFVVGNSNSLALIAGLCSINYGLAGEILSIVVVGSDGNFNITNASTYGVYAA 203

Query: 209 AILATVILTSMATAAVSVLQTVSIVINLSLVA-FLIVLPIGVANNDSMTFNGPGFIFANF 267
            I+AT ++TS+AT AVS LQT SIV NL L+  F + LP+GVA ++ M FN   +IF NF
Sbjct: 204 CIVATAVVTSVATVAVSKLQTFSIVSNLLLICIFFVALPVGVARSNHMEFNDAKYIFGNF 263

Query: 268 QNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGF 327
           QN S W D  QF   G  P++WVIG FDS IHMSEEAKNA+ +VP  I+ SI+VCW+LGF
Sbjct: 264 QNLSDWNDGWQFMSAGFQPLIWVIGGFDSCIHMSEEAKNATASVPFGIIGSISVCWVLGF 323

Query: 328 CIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTA 387
            I + IAAC   D+  +++T F QPLAQ+LF+ LGK+W IA M LIA CQ++M ASILTA
Sbjct: 324 FICIVIAACSSQDVAAIVETKFHQPLAQILFDALGKRWTIAIMVLIAFCQFLMAASILTA 383

Query: 388 ISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFS 447
           ISRQIWAFARDDGLPFS WIK VN  LSSP+RATWVGA AA+ IG L L GPVASSALFS
Sbjct: 384 ISRQIWAFARDDGLPFSSWIKVVNIKLSSPLRATWVGAGAALAIGCLCLIGPVASSALFS 443

Query: 448 MYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTN 507
           + V ANY +WM+PNLLRM +GK++F PG F+MGK+ SP++NW+SI+F++  I+L+  P +
Sbjct: 444 LAVSANYFSWMVPNLLRMTYGKDVFTPGAFFMGKYLSPVVNWISIVFEIFMILLVFFPAD 503

Query: 508 PINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDG 559
              IT  +MNY+ +F G VW    IY+++YK+K + GPKSNLTD +     G
Sbjct: 504 QHGITPDTMNYSVVFIGAVWVLPTIYYLVYKYKFYSGPKSNLTDEEYEEKVG 555

>SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 569

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/550 (54%), Positives = 396/550 (72%), Gaps = 5/550 (0%)

Query: 16  ILLQPALTNN--TSVRVQQISSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELS 72
           +++ P ++ +  T+  +Q + S+++ RS+T   +VNYINA TA DD +LLAEIGYKQEL 
Sbjct: 8   LIISPIVSRDKGTTSDLQNLHSVRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELK 67

Query: 73  RHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELAS 132
           R FST+QVFGIAFSIMGLLPSIAS++   L GG V+ VWGW I G FIL IG +M+E AS
Sbjct: 68  RQFSTLQVFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAENAS 127

Query: 133 AIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKD 192
           AIPT+GGL       AP  +K ++SF+IG SNSLALV+G+CS++YGLA+E+L+ V I KD
Sbjct: 128 AIPTAGGLYYWTHYYAPEGYKNVISFVIGCSNSLALVSGVCSIDYGLAEEILAAVVISKD 187

Query: 193 GDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVAN 251
           GDFE++S KT+ V+ AA+ A ++ T +A++A+S LQT SIV N  ++  L I LPIG   
Sbjct: 188 GDFEVTSGKTYGVFVAAVFAMILCTCLASSAISRLQTTSIVANCFIIILLFIALPIGTKR 247

Query: 252 NDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAV 311
           N    FN   +IF  F+N S W +  QF L G +  VW IGAFDS +H SEEAK+A KAV
Sbjct: 248 NMG-GFNDASYIFGKFENFSDWNNGWQFCLQGFMTCVWTIGAFDSCVHQSEEAKDAKKAV 306

Query: 312 PVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMS 371
           P+ I+ SITVCW+LG+ I++ + AC+ PD+  +LD  +G  LAQ+++  LGK WAIAFMS
Sbjct: 307 PIGIIGSITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMS 366

Query: 372 LIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMI 431
           LIA CQ++MGASILTA+SRQIWAFARDDGLP S +IK VN+ LS PI A W G  A++++
Sbjct: 367 LIAACQFLMGASILTAVSRQIWAFARDDGLPLSKYIKMVNERLSVPIVAVWAGGLASVVL 426

Query: 432 GLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVS 491
           GLL L    A+SALFS+ V  NYL+W  P LLR+ FG++IF PG FY+GKFWSPI+NW S
Sbjct: 427 GLLCLIDSAAASALFSLAVAGNYLSWGTPTLLRLTFGRDIFRPGPFYLGKFWSPIVNWTS 486

Query: 492 IIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTD 551
           ++FQ   IV++M P +   IT S+MNY  +    +W  + +Y+++YK K + GPKSNLTD
Sbjct: 487 VLFQAFIIVVVMFPASQHGITKSTMNYACVIGPGIWILAWVYYMVYKKKYYHGPKSNLTD 546

Query: 552 SDLNTPDGSI 561
            +     GSI
Sbjct: 547 EEYVDAVGSI 556

>SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 565

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/547 (55%), Positives = 395/547 (72%), Gaps = 5/547 (0%)

Query: 26  TSVRVQQISSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIA 84
            S+ +Q+I+++++ RS+T   +VNYINA TA DD +LLAEIGYKQEL R FST+QVFGIA
Sbjct: 8   NSLSIQEIAALRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQFSTLQVFGIA 67

Query: 85  FSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXX 144
           FSIMGLLPSIAS++   L GG V+ VWGW I G FIL IG +M+E ASAIPT+GGL    
Sbjct: 68  FSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAESASAIPTAGGLFYWT 127

Query: 145 XXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFA 204
              AP  +K ++SF+IG SNSLALV+GLCS++YGLAQE+L+ V I KDGDFE++S KT+ 
Sbjct: 128 HYYAPEGYKNVISFIIGCSNSLALVSGLCSIDYGLAQEILAAVVISKDGDFEVTSGKTYG 187

Query: 205 VYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFNGPGFI 263
           V+ AA++ TV+ T +A++A+S LQT SIV N  ++  L I LPIG   N    FN   +I
Sbjct: 188 VFAAAVVVTVLCTCLASSAISRLQTASIVANCFIIILLFIALPIGTKRNMG-GFNDASYI 246

Query: 264 FANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCW 323
           F  F+N S W D   F L G +P++W IGAFDS +H SEEAK+A KAVP+ I+ SITVCW
Sbjct: 247 FGKFENFSDWNDGWSFCLQGFMPVIWTIGAFDSCVHQSEEAKDAKKAVPIGIIGSITVCW 306

Query: 324 LLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGAS 383
           +LG+ I++ + AC+ PD+  +LD  +G  LAQ+++  LGK WAIAFMSLIAVCQ++MGAS
Sbjct: 307 ILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIAVCQFLMGAS 366

Query: 384 ILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASS 443
           +LTA+SRQ+WAFARDDGLP S +IK V+ + S PI A WV   A +++GLL L    A+S
Sbjct: 367 VLTALSRQVWAFARDDGLPLSKYIKMVHTNWSVPIVAVWVAGCAGLVLGLLCLIDAAAAS 426

Query: 444 ALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMM 503
           ALFS+ V  NYL+W  P LLR+ FGK+IF PG FY+GKFWSPIINW S+IFQ   I+L+M
Sbjct: 427 ALFSLAVAGNYLSWGTPTLLRLTFGKDIFRPGPFYLGKFWSPIINWTSVIFQAFIIILVM 486

Query: 504 LPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS--I 561
            P +   +  S+MNY  +    +W  + IY+++YK K + GPKSNLTD +     GS  I
Sbjct: 487 FPASQHGVDKSTMNYACVIGPGIWILAWIYYMIYKKKYYHGPKSNLTDEEYVEAVGSNVI 546

Query: 562 EHISSQT 568
           + I S T
Sbjct: 547 DEILSNT 553

>KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8.468
           YDL210W
          Length = 581

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/533 (51%), Positives = 370/533 (69%), Gaps = 3/533 (0%)

Query: 31  QQISSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMG 89
           +  S+I++ RS+T   +VN+I+A     D +LLAEIGYKQEL+R FSTIQVFGIAFSIMG
Sbjct: 30  RPFSNIRSVRSQTGAGEVNFIDAGATVSDHQLLAEIGYKQELNRQFSTIQVFGIAFSIMG 89

Query: 90  LLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAP 149
           LLPSIAS++   L GG  + VWGW I G FIL++G AM+E ASAIPT+GGL       AP
Sbjct: 90  LLPSIASVMGGGLAGGPTTLVWGWFIAGCFILTVGIAMAENASAIPTAGGLYYWTYYYAP 149

Query: 150 PKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAA 209
             +K ++SF+IG SNSLAL AG+CS++YG A+EVL+ V I KDG+FE++  KT+ V+ AA
Sbjct: 150 KGYKEVISFVIGCSNSLALAAGVCSIDYGFAEEVLAAVVIAKDGNFEITPGKTYGVFAAA 209

Query: 210 ILATVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFNGPGFIFANFQ 268
           ++A  I T MA+ A++ LQT+SIV NL ++  L I LPIG   N    FN   FIF  F+
Sbjct: 210 VVAMGICTCMASKAIARLQTISIVSNLFIIVLLFIALPIGTKINMG-GFNDGSFIFGKFK 268

Query: 269 NNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFC 328
           N S W +  QFFL G +P+VW IGAFDS +H SEEAK+A K+VP+ I+ SI+VCW+LG+ 
Sbjct: 269 NLSDWNNGWQFFLAGFMPVVWTIGAFDSCVHQSEEAKDAKKSVPIGIIGSISVCWVLGWL 328

Query: 329 IVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAI 388
           I++ + ACM PDI G++D  +G  +AQ++++ LGK+WA+AFMSLIA CQ++MG+S++TAI
Sbjct: 329 ILICLMACMSPDIEGIVDNKYGFAMAQIIYDSLGKKWAVAFMSLIAFCQFLMGSSVVTAI 388

Query: 389 SRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSM 448
           SRQIWAFARDDGLP S +IK V+K    P  A       ++++GLL L    A+SALFS+
Sbjct: 389 SRQIWAFARDDGLPLSDYIKMVDKKYKVPFNAIIFACCGSLILGLLCLIDAAATSALFSL 448

Query: 449 YVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNP 508
            V  N LAW  P LLR+  G+++F PG FY+G  WS +  W+SIIF+   I+++M P+  
Sbjct: 449 AVAGNNLAWSTPTLLRLTSGRDLFRPGPFYLGPVWSKVNGWISIIFEAFIIIVVMFPSEK 508

Query: 509 INITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGSI 561
             IT S+MNYT +    +WF S +Y+ +YK  T    K     S+L  P   +
Sbjct: 509 HGITKSTMNYTCVIGPGIWFLSWVYYSVYKKSTTTVLKQTYLRSNLRKPSAQM 561

>NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112
          Length = 576

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/531 (48%), Positives = 365/531 (68%), Gaps = 4/531 (0%)

Query: 26  TSVRVQQISS-IKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGI 83
           ++V ++ ++S I++ RSKT   +VNYIN+ T+  D +LLAEIGYKQEL R FST QVFGI
Sbjct: 28  SAVDIRNVNSHIRSIRSKTGAGEVNYINSATSVTDNQLLAEIGYKQELKRQFSTFQVFGI 87

Query: 84  AFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXX 143
           AFSIMGLLPSIAS++   + GG  +FVWGW I  +F + IG +M+E ASAIPT+GGL   
Sbjct: 88  AFSIMGLLPSIASVMGTGISGGPTTFVWGWFIASIFTIFIGISMAENASAIPTAGGLYYW 147

Query: 144 XXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTF 203
               AP  FK ++SF+IG SNSLAL AGLCS++YGLA+E+++ V +  DGDF+++S K +
Sbjct: 148 TYYYAPEGFKKVISFVIGCSNSLALAAGLCSIDYGLAEEIMAAVVLTFDGDFDVTSGKLY 207

Query: 204 AVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFNGPGF 262
            ++ AA++   I T +++ A++ +Q+ SI  NL ++  L I LPIG   N    FN   F
Sbjct: 208 GIFAAAVVVMGICTCISSGAIARMQSFSIASNLFIIVLLFIALPIGTKRNRG-EFNDAKF 266

Query: 263 IFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVC 322
           IF  F+N S W    QF + G +P VW IG+FDS +H SEEAK+A K+VP+ I+ SI  C
Sbjct: 267 IFGKFENFSDWNSGWQFCMAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIIASIAAC 326

Query: 323 WLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGA 382
           W+LG+ I++ + AC+ P++  ++DT +G P+AQL+++ LGK+WAI FMSL+A CQ++MG 
Sbjct: 327 WILGWLIIIVLMACIDPNLENVVDTKYGFPMAQLIYDSLGKRWAITFMSLMAFCQFLMGC 386

Query: 383 SILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVAS 442
           SI TAISRQIWAF+RDDGLP S +IK V+K  S P  A        +++GLL L    A+
Sbjct: 387 SICTAISRQIWAFSRDDGLPLSKYIKIVDKRYSVPFNAIIAACVTCLVLGLLCLIDSTAA 446

Query: 443 SALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLM 502
           +ALFS+ V  NYLAW +P LLR   G+++F PG FY+GK  S I+ W  I ++   I+++
Sbjct: 447 NALFSLAVAGNYLAWSIPTLLRFTTGRDLFRPGPFYLGKPLSAIVGWTGICYEFFIIIMV 506

Query: 503 MLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
           M PT    I  ++MNY  +    +WF S IY++ YK K F GPK+NL++ D
Sbjct: 507 MFPTQKNGINKTNMNYACVIGPGIWFLSWIYYIAYKKKYFRGPKTNLSEDD 557

>NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {ON}
           Anc_5.112
          Length = 574

 Score =  522 bits (1344), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 274/567 (48%), Positives = 391/567 (68%), Gaps = 15/567 (2%)

Query: 9   QPSKVDV--ILLQP-ALTNNTSVRVQQISS-IKTSRSKT-VDQVNYINAKTAYDDVELLA 63
           + SK D+  I L+P A T   S+ +  ++S +++  SKT   +VNYINA  + +D +LLA
Sbjct: 8   ESSKKDIKIINLEPRASTEEGSIELHNMASNLRSIISKTGAGEVNYINASKSVNDNQLLA 67

Query: 64  EIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSI 123
           EIGYKQEL R FST+QVFGIAFSIMGLLPSIAS++   + GG VSFVWGW I   FIL +
Sbjct: 68  EIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGTGISGGSVSFVWGWFIASFFILLV 127

Query: 124 GAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEV 183
           G +M+E ASAIPT+GGL       AP  +K + SF+IG SNSLALVAGLCS++YGLA+E+
Sbjct: 128 GISMAENASAIPTAGGLYYWTYYYAPKGYKEVFSFIIGCSNSLALVAGLCSIDYGLAEEI 187

Query: 184 LSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFL- 242
           ++ V +  DGDF ++  + +AV+ A+++   + TSMA+  ++ LQ +SIV NL ++  L 
Sbjct: 188 MAAVVVTYDGDFNITDGRLYAVFLASVIVMALCTSMASGVIARLQNISIVSNLFIIVLLF 247

Query: 243 IVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSE 302
           I LP+G  +    TFN   FIF  F+N S W    QF L G +P VW IG+FDS +H SE
Sbjct: 248 IALPVGTKHKRG-TFNDASFIFGGFENFSDWNGGWQFCLTGFMPAVWTIGSFDSCVHQSE 306

Query: 303 EAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG 362
           EAK+A K+VPV I+ SI+ CW+LG+ I++ + AC+ P +  +LDT +G P+AQL+++ LG
Sbjct: 307 EAKDAKKSVPVGIIGSISACWILGWLIIICLMACIDPQLENVLDTQYGFPMAQLIYDSLG 366

Query: 363 KQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATW 422
           K+W IAF+SL+A CQ++MG SI TAISRQIWAF+RDDGLPFS +IK+V+ S+  P  A  
Sbjct: 367 KKWTIAFLSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPFSKYIKQVHNSV--PFFAIL 424

Query: 423 VGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKF 482
               +++++GLL L    A++ALFS+ V  NYLAW  P LLR+  G++IF PG FY+GK 
Sbjct: 425 AACVSSLVLGLLCLIDATAANALFSLAVAGNYLAWCTPTLLRLTSGRDIFRPGPFYLGKV 484

Query: 483 WSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTF 542
            SPI++W+ +++++  I++ M P+    I  ++MNY  +    +WF + IY++LYK K +
Sbjct: 485 LSPIVSWIGVLYEVFIIIMEMFPSQQHGINKTNMNYACVIGPGIWFLAWIYYLLYKKKYY 544

Query: 543 EGPKSNLTDSD------LNTPDGSIEH 563
            GPK+NL+D +      ++  DG +E 
Sbjct: 545 HGPKTNLSDEEYSDMVGIDVIDGILEQ 571

>ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 572

 Score =  522 bits (1344), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 259/536 (48%), Positives = 362/536 (67%), Gaps = 3/536 (0%)

Query: 20  PALTNNTSVRVQQISSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTI 78
           P+L             I++ RS+T   +VNYINA T+ DD +LLAEIGYK EL R FST+
Sbjct: 13  PSLGKGDVQVYTSAGRIRSIRSRTGAGEVNYINAATSNDDNQLLAEIGYKPELERKFSTL 72

Query: 79  QVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSG 138
           QVFGIAFSIMGLLPSIAS L   L GG VS VWGW I G+FI  +G  M+E +SAIPT+G
Sbjct: 73  QVFGIAFSIMGLLPSIASELDDGLAGGPVSTVWGWFIAGIFIFLVGVTMAENSSAIPTAG 132

Query: 139 GLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELS 198
           GL       AP  +KA +SF+IG  NSLAL AG+CS++YG A+EVL+ V + KDG+++++
Sbjct: 133 GLYFWTYHYAPEGYKAAISFVIGIGNSLALAAGVCSIDYGFAEEVLAAVVVSKDGNWDIT 192

Query: 199 SSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSL-VAFLIVLPIGVANNDSMTF 257
             K + VY   ++ T+++T +A+  ++ +Q++SI  NL + V FLI LPIG   N    F
Sbjct: 193 QGKLYGVYAGCVILTIMVTCVASGWLAKMQSISIYSNLFIIVLFLIALPIGTKVNRG-GF 251

Query: 258 NGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILT 317
           N   FIF  F+N S W +  QFFL G  PIVW I +FDS +H +EEAK+ASKAVP+ I+ 
Sbjct: 252 NDGSFIFGKFENLSDWSNGWQFFLAGFTPIVWTISSFDSCVHQAEEAKDASKAVPIGIMG 311

Query: 318 SITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ 377
           SI VCW+LG+ I + + AC+  D+N ++++ +   +AQ++F+ LGK W IAF++L+A CQ
Sbjct: 312 SIFVCWILGWVINIVLMACIDKDMNRVMNSPYQLGMAQIIFDSLGKNWTIAFLALMAFCQ 371

Query: 378 YVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLA 437
           ++MGAS +TA SRQIWAFARDDG+P S  +KKV+     P  A+      ++++GLL L 
Sbjct: 372 FLMGASSMTAASRQIWAFARDDGMPLSNILKKVDSKFHVPFYASICSGLMSLVLGLLILI 431

Query: 438 GPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLL 497
              A+ ALFS+ +  NYLAW+ PN LR+ +G+++F PG FY+GKFWSP++NW +++F   
Sbjct: 432 DDAAAEALFSLAIAGNYLAWVTPNFLRLTWGRDVFRPGPFYLGKFWSPVVNWTTVVFMAF 491

Query: 498 CIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
            I+++M PT    I   +MNY  +     W  S+IY+ +YK K + GPKSNL D +
Sbjct: 492 IIIMVMFPTQKNGINKENMNYACVIGPGTWLLSLIYYWVYKKKEYHGPKSNLDDEE 547

>Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  508 bits (1307), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 260/522 (49%), Positives = 366/522 (70%), Gaps = 3/522 (0%)

Query: 34  SSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMGLLP 92
           S++++ RSKT   +VNYI+A  + +D +LLAEIGYKQEL R FSTIQVFGIAFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYIDAAKSVNDNQLLAEIGYKQELKRQFSTIQVFGIAFSIMGLLP 91

Query: 93  SIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKF 152
           SIAS++   L GG  + VWGW I   FIL +G  M+E AS+IPT+GGL       AP  +
Sbjct: 92  SIASVMGGGLGGGPATLVWGWFIAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGY 151

Query: 153 KAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILA 212
           K I+SF+IG SNSLAL AG+CS++YGLA+E+ + + + KDG+F+++S K + ++  A++ 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAITLTKDGNFDVTSGKLYGIFAGAVVV 211

Query: 213 TVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFNGPGFIFANFQNNS 271
             I T +A+ A++ LQT+SI  NL ++  L I LPIG  +N    FN   FIF  ++N S
Sbjct: 212 MGICTCIASGAIARLQTLSIFANLFIIVLLFIALPIGTKHNIG-GFNNGDFIFGKYENLS 270

Query: 272 SWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVV 331
            W    QF L G +P VW IG+FDS +H SEEAK+A K+VP+ I++SITVCW+LG+ I++
Sbjct: 271 DWNKGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSITVCWILGWLIII 330

Query: 332 TIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAISRQ 391
            + AC+ PDI+ +LD+ +G  LAQ++++ LGK+WAIAFMSLIA CQ++MGASI TA+SRQ
Sbjct: 331 CLMACINPDIDSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 IWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVG 451
           +WAF+RD+GLP S +IK+V+   S P  A       ++++GLL L    A+ ALFS+ V 
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFFAILAACAGSLILGLLCLIDDAATDALFSLAVA 450

Query: 452 ANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINI 511
            N LAW  P +LR+  G+++F PG FY+GK WSPI+ W+ + FQ+  I+L+M P     I
Sbjct: 451 GNNLAWSTPTVLRLTSGRDLFRPGPFYLGKIWSPIVAWIGVAFQVFIIILVMFPAQQHGI 510

Query: 512 TGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
           T S+MNY  +    +WF + +Y+ +YK K + GP +NL+D D
Sbjct: 511 TKSTMNYACVIGPGIWFLAGVYYKVYKKKYYHGPATNLSDDD 552

>Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  506 bits (1304), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 258/522 (49%), Positives = 362/522 (69%), Gaps = 3/522 (0%)

Query: 34  SSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMGLLP 92
           S++++ RSKT   +VNYINA  + +D +LLAEIGYKQEL R FST+QVFGIAFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYINASKSVNDHQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 91

Query: 93  SIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKF 152
           SIAS++   L GG  S +WGW + G F+L +G +M+E ASAIPT+GGL       AP  +
Sbjct: 92  SIASVMGGGLDGGPASLLWGWFVAGFFLLLVGMSMAEHASAIPTAGGLYYWTYYYAPEGY 151

Query: 153 KAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILA 212
           K I+SF+IG SNSLAL AG+CS+ YGLA+E+ + V + KDG+F+++    + ++  A++ 
Sbjct: 152 KEIISFIIGCSNSLALTAGVCSINYGLAEEIAAAVTLTKDGNFDVTRGMLYGIFAGAVVL 211

Query: 213 TVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFNGPGFIFANFQNNS 271
             + T +A+  ++ LQT+SI  N+ ++  L I LPIG   N    FN   FIF  F+N S
Sbjct: 212 MGLCTCIASGGIARLQTLSIASNVFIIILLFIALPIGTKRNMG-GFNNGDFIFGKFENFS 270

Query: 272 SWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVV 331
            W +  QF L G +P VW I +FDS +H SEEAK+A K+VP+ I+ SI VCW+LG+ I++
Sbjct: 271 DWNNGWQFCLAGFMPAVWTINSFDSCVHQSEEAKDAKKSVPIGIILSILVCWILGWFIII 330

Query: 332 TIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAISRQ 391
            + AC+ PD+  +LD+ +G  LAQ++++ LGK+WAIAFMSLIA CQ++MGASI TA+SRQ
Sbjct: 331 CLLACINPDLASVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 IWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVG 451
           +WAF+RD+GLP S +IKKV+   S P  A       ++++GLL L    A++ALFS+ V 
Sbjct: 391 VWAFSRDNGLPLSKYIKKVDSKYSVPFYAILAACVCSLVLGLLCLIDQAATNALFSLAVA 450

Query: 452 ANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINI 511
            N LAW  P +LR+  GK++F PG FY+GKFWSPI+ WV + FQ+  IV++M P     I
Sbjct: 451 GNNLAWSTPTVLRLTSGKDLFRPGPFYLGKFWSPIVAWVGVAFQVFIIVMVMFPAQQKGI 510

Query: 512 TGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
           T ++MNYT +    +W  + IY+ +YK K + GP +NL+D D
Sbjct: 511 TKATMNYTCVIGPGIWILAGIYYKVYKKKYYHGPATNLSDED 552

>YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease
           that serves as a gamma-aminobutyrate (GABA) transport
           protein involved in the utilization of GABA as a
           nitrogen source; catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA); localized to the
           vacuolar membrane
          Length = 571

 Score =  506 bits (1302), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/529 (48%), Positives = 365/529 (68%), Gaps = 3/529 (0%)

Query: 34  SSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMGLLP 92
           S++++ RSKT   +VNYI+A  + +D +LLAEIGYKQEL R FST+QVFGIAFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYIDAAKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 91

Query: 93  SIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKF 152
           SIAS++   L GG  + VWGW +   FIL +G  M+E AS+IPT+GGL       AP  +
Sbjct: 92  SIASVMGGGLGGGPATLVWGWFVAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGY 151

Query: 153 KAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILA 212
           K I+SF+IG SNSLAL AG+CS++YGLA+E+ + V + KDG+FE++S K + ++  A++ 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAVTLTKDGNFEVTSGKLYGIFAGAVVV 211

Query: 213 TVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFNGPGFIFANFQNNS 271
             I T +A+ A++ LQT+SI  NL ++  L I LPIG  +     FN   FIF  ++N S
Sbjct: 212 MCICTCVASGAIARLQTLSIFANLFIIVLLFIALPIGTKHRMG-GFNDGDFIFGKYENLS 270

Query: 272 SWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVV 331
            W +  QF L G +P VW IG+FDS +H SEEAK+A K+VP+ I++SI VCW+LG+ I++
Sbjct: 271 DWNNGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAVCWILGWLIII 330

Query: 332 TIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAISRQ 391
            + AC+ PDI+ +LD+ +G  LAQ++++ LGK+WAIAFMSLIA CQ++MGASI TA+SRQ
Sbjct: 331 CLMACINPDIDSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 IWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVG 451
           +WAF+RD+GLP S +IK+V+   S P  A       ++++GLL L    A+ ALFS+ V 
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFFAILAACVGSLILGLLCLIDDAATDALFSLAVA 450

Query: 452 ANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINI 511
            N LAW  P + R+  G+++F PG FY+GK WSPI+ W  + FQL  I+L+M P+    I
Sbjct: 451 GNNLAWSTPTVFRLTSGRDLFRPGPFYLGKIWSPIVAWTGVAFQLFIIILVMFPSQQHGI 510

Query: 512 TGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS 560
           T S+MNY  +    +W  + IY+ +YK K + GP +NL+D D     G+
Sbjct: 511 TKSTMNYACVIGPGIWILAGIYYKVYKKKYYHGPATNLSDDDYTEAVGA 559

>ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 582

 Score =  506 bits (1303), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 266/521 (51%), Positives = 363/521 (69%), Gaps = 3/521 (0%)

Query: 34  SSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMGLLPS 93
           S I++ RS    +VNYIN+ T+  D  LLAEIGYKQEL R FSTIQVFG+AFSIMGLLPS
Sbjct: 40  SHIRSVRSPVAGEVNYINSATSNTDKGLLAEIGYKQELERKFSTIQVFGVAFSIMGLLPS 99

Query: 94  IASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFK 153
           I ++L+  L GG VS +WGWLI G FIL +G AM+E ASAIPT+GGL       AP  +K
Sbjct: 100 IGTLLSDGLAGGPVSTIWGWLIAGFFILVLGLAMAENASAIPTAGGLYYWTYYYAPKGYK 159

Query: 154 AILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILAT 213
           A++SF+IG SNSLAL A  CS+ YG A+EVL+ V + KDG+F++++ K + ++  A +  
Sbjct: 160 AVMSFIIGCSNSLALTAACCSITYGFAEEVLAAVVLTKDGNFDVTNGKLYGIFAGAAIMM 219

Query: 214 VILTSMATAAVSVLQTVSIVINLS-LVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSS 272
            + TS+A+  V+ LQT+SI+ NL  +V F I +PIG   N    FN   FIFAN+QN+S 
Sbjct: 220 GVCTSVASGFVAKLQTLSIICNLFIIVLFFIAVPIGAKVNRG-KFNHGHFIFANYQNSSD 278

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVT 332
           W +  QF L G +P +W IG FDS +H SEEAK+A K+V + I+ SI+VCW+LG+ I++ 
Sbjct: 279 WNNGWQFCLAGFMPAIWTIGGFDSCVHQSEEAKDAKKSVALGIVGSISVCWILGWFILIV 338

Query: 333 IAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAISRQI 392
           + ACM PD++  ++T +   +AQ++++ LGK WAIAFMSLIA CQ++MGAS +TA+SRQI
Sbjct: 339 LLACMDPDVSKTMNTKYVLSIAQIIYDCLGKNWAIAFMSLIAFCQFLMGASTITAVSRQI 398

Query: 393 WAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGA 452
           WAF+RD+GLPFS +IKKVNK+ S P  A        +++GLL L    A++ALFS+ V  
Sbjct: 399 WAFSRDNGLPFSKYIKKVNKTYSIPFVAIIAACCGTLVLGLLCLQDE-AANALFSLSVAG 457

Query: 453 NYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINIT 512
           N L+W  P  LR+ FGK++F PG FY+GKF S +  W+S+ + L  I+L+M PT+  N+T
Sbjct: 458 NNLSWGTPTFLRLTFGKDLFRPGPFYLGKFLSTVNGWISVFWGLFVIILVMFPTSQHNVT 517

Query: 513 GSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
             SMNY  +    VW  S IY++ YK K + GP SNLT+ +
Sbjct: 518 PQSMNYACVIGPGVWILSFIYYITYKKKYYHGPASNLTEEE 558

>TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112
          Length = 569

 Score =  504 bits (1299), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 276/554 (49%), Positives = 376/554 (67%), Gaps = 8/554 (1%)

Query: 23  TNNTSVRVQQISS--IKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQ 79
           +  ++  + Q+SS  ++  RSKT   +VNYIN+ T+ +D +LLAEIGYKQEL R FST+Q
Sbjct: 18  SEGSAFELHQLSSSDVRYVRSKTGAGEVNYINSATSVNDGQLLAEIGYKQELKRQFSTLQ 77

Query: 80  VFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGG 139
           VFG+AFSIMGLLPSIAS++   L GG V+ VWGW I   FIL +G  M+E ASAIPT+GG
Sbjct: 78  VFGVAFSIMGLLPSIASVMGGGLTGGPVTLVWGWFIAAFFILLVGITMAENASAIPTAGG 137

Query: 140 LXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSS 199
           L       AP  +K I+SF+IG SNSLAL AG+CS+ YG A EVL+ V I +DGDFE+++
Sbjct: 138 LYYWTYYYAPKGYKEIVSFVIGCSNSLALSAGVCSISYGFALEVLAAVVISRDGDFEVTT 197

Query: 200 SKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFN 258
            KT+ ++ A ++A  ++T +++  V+ LQT+SIV N+ ++  L I LPIG   N    FN
Sbjct: 198 GKTYGIFAAVVVAQGVVTCLSSGLVARLQTLSIVSNVFIMILLFIALPIGAKVNRG-GFN 256

Query: 259 GPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTS 318
              FIF  +QN S W    QF L G +P VW IG+FDS +H SEEAK+A K+VP+ I+ S
Sbjct: 257 NGEFIFGTYQNFSDWNSGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIIGS 316

Query: 319 ITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQY 378
           I  CW+LG+ I++ + ACM  DI+ +LDT +   LAQ++++ LGK WAIAFM+LIA CQ+
Sbjct: 317 IAACWILGWLIIICLMACMDSDISKVLDTDYEIILAQIVYDCLGKNWAIAFMALIAFCQF 376

Query: 379 VMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAG 438
           +MGASI+TA SRQIWAFARDDGLP S +IKKV+K  S P  A  + A  A ++  L    
Sbjct: 377 LMGASIVTAASRQIWAFARDDGLPLSKYIKKVDKKYSVPFVAI-IAACVASLLLGLLCLD 435

Query: 439 PVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLC 498
             A++ALFS+ V  N LAW  P  LR+ +G+++F PG FY+GK WSPII W+ +++Q   
Sbjct: 436 AAAAAALFSLAVAGNNLAWSTPTFLRLTWGRDLFRPGPFYLGKLWSPIIAWIGVVYQAFI 495

Query: 499 IVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPD 558
           I+L+M P+    +T  +MNY  +    +W  S IY+++Y+ K F GPKSNL+D D N   
Sbjct: 496 IILVMFPSARHGLTPQTMNYACVIGPGLWILSWIYYMVYRKKYFHGPKSNLSDEDYNEAV 555

Query: 559 GS--IEHISSQTFE 570
           G   IE I S+  E
Sbjct: 556 GEDLIEEILSRKGE 569

>Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  502 bits (1292), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 263/522 (50%), Positives = 368/522 (70%), Gaps = 3/522 (0%)

Query: 34  SSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMGLLP 92
           S++++ RSKT   +VNYINA  + +D +LLAEIGYKQEL R FST+QVFGIAFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYINAAKSVNDNQLLAEIGYKQELKRQFSTVQVFGIAFSIMGLLP 91

Query: 93  SIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKF 152
           SIAS++   L GG  + +WGW +   FIL +G  M+E ASAIPT+GGL       AP  +
Sbjct: 92  SIASVMGGGLGGGPATLLWGWFVAAFFILLVGITMAEHASAIPTAGGLYYWTYHYAPEGY 151

Query: 153 KAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILA 212
           K I+SF+IG SNSLAL AG+CS++YGLA+E+ + V + +DG+F+ +S K + ++  A++ 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAVTLTRDGNFDATSGKLYGIFAGAVVL 211

Query: 213 TVILTSMATAAVSVLQTVSIVINLSLVAFL-IVLPIGVANNDSMTFNGPGFIFANFQNNS 271
             I T +A+ A++ LQTVSIV NL ++  L I LPIG  +N    FN   FIF  F+N S
Sbjct: 212 MGICTCIASGAIARLQTVSIVANLFIIVLLFIALPIGTKHNMG-GFNNGEFIFGKFENMS 270

Query: 272 SWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVV 331
            W +  QF L G +P VW IG+FDS +H SEEAK+A K+VP+ I++SI VCW+LG  I++
Sbjct: 271 DWNNGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAVCWVLGLLIII 330

Query: 332 TIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASILTAISRQ 391
            + AC+ PDI+ +L++ +G  LAQ++++ LGK+WAIAFMSLIA CQ++MGASI TA+SRQ
Sbjct: 331 CLLACINPDIDSVLNSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 IWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVG 451
           +WAF+RD+GLP S +IK+V+   S P  A       ++++GLL L    A+SALFS+ V 
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFYAILAACVGSLILGLLCLIDEAATSALFSLAVA 450

Query: 452 ANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINI 511
            N LAW  P +LR+  G+++F PG FY+GKFWSPII W+ + FQ+  I+L+M P+    I
Sbjct: 451 GNNLAWSTPTVLRLTSGRDLFRPGPFYLGKFWSPIIAWIGVAFQVFIIILVMFPSQQHGI 510

Query: 512 TGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
           T S+MNY  +    +WF + +Y+ +YK K + GP +NL+D D
Sbjct: 511 TKSTMNYACVIGPGIWFLAGVYYKVYKKKYYHGPATNLSDDD 552

>KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112
          Length = 571

 Score =  496 bits (1278), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 258/551 (46%), Positives = 371/551 (67%), Gaps = 6/551 (1%)

Query: 14  DVILLQPALT---NNTSVRVQQISSIKTSRSKT-VDQVNYINAKTAYDDVELLAEIGYKQ 69
           + ++++PA++    ++       S ++T RS T   +VNYIN+  +  D +LLAEIGYK 
Sbjct: 9   NFVVIEPAVSISEGHSDDLYNLASRVRTVRSHTGAGEVNYINSVQSVSDNQLLAEIGYKP 68

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSE 129
           EL R FST+QVFGIAFSIMGLLPSIAS++   L GG VS VWGW    + IL +G  M+E
Sbjct: 69  ELKRQFSTLQVFGIAFSIMGLLPSIASVMAGGLAGGPVSLVWGWFSSCIGILIVGITMAE 128

Query: 130 LASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAI 189
            ASAIPT+GG+       AP K+KA+LSF++G SNSLALVA  CS+ YG A+EV++ V +
Sbjct: 129 NASAIPTAGGMYYWTYYYAPKKYKAVLSFVVGCSNSLALVASCCSINYGFAEEVMAAVFL 188

Query: 190 WKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA-FLIVLPIG 248
             DG   ++S K + ++  A +   + T +A+ A++ LQTVSIV N+ ++  F+I +PIG
Sbjct: 189 TYDGAVTVTSGKLYGIFAGATVVMAMCTCVASGAIARLQTVSIVSNIFIIILFVIAVPIG 248

Query: 249 VANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNAS 308
              N    FN   +IF +F+N S W +   FFL G +P  W I +FDS +H SEEAK+A 
Sbjct: 249 TKANIGH-FNDGKYIFGHFENLSDWNNGFLFFLAGFMPAAWTISSFDSCVHQSEEAKDAK 307

Query: 309 KAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIA 368
           K+VP+ I+ SIT CW+LGF I++ + ACM  D++ L+++  G  +AQ++F+ LGK+WAIA
Sbjct: 308 KSVPIGIIGSITACWILGFLIIICLCACMDTDLDRLVNSDTGFAMAQIIFDSLGKRWAIA 367

Query: 369 FMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAA 428
           FM+LIA CQ++MGASI+TAISRQIWAFARDDGLPFS  IK V+K    P  +    A  +
Sbjct: 368 FMALIAFCQFLMGASIVTAISRQIWAFARDDGLPFSNLIKYVDKRYQVPFNSVIAAAITS 427

Query: 429 IMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIIN 488
           +++GLL L    A++ALFS+ V   Y+A+++P +LR+  G+++F PG FY+GKFWSPI+ 
Sbjct: 428 LLLGLLCLINSQATAALFSLSVAGGYIAYLIPTVLRLTVGRDVFRPGPFYLGKFWSPIVA 487

Query: 489 WVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSN 548
           W S++F++  I+L M P    +I  S+MNY+ +        + IY+ ++KH+ + GPKSN
Sbjct: 488 WSSVVFEIWIILLEMFPAQQHHIDKSTMNYSCVIGPGTCLLAWIYYRVWKHREYIGPKSN 547

Query: 549 LTDSDLNTPDG 559
           L+D D     G
Sbjct: 548 LSDEDYKEALG 558

>SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 578

 Score =  488 bits (1257), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 243/555 (43%), Positives = 363/555 (65%), Gaps = 6/555 (1%)

Query: 21  ALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQV 80
           A  +N  + V  ++ +++  S     + YI+AK A  D ++LAEIGYK+EL R FST+Q+
Sbjct: 18  ARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELKREFSTLQI 77

Query: 81  FGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGL 140
           FG+AFSIMGLLPSIAS +   L  G V   WGW + G  IL++G A++EL+S+IPT+G +
Sbjct: 78  FGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSSSIPTAGAV 137

Query: 141 XXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSS 200
                  AP +++  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  + DF ++  
Sbjct: 138 YVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-SNPDFVVTDP 196

Query: 201 KTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA-FLIVLPIGVANNDSM--TF 257
            T+ V+ A ++A  +LTS+A+   S LQT+SIV N  L+  F I LPIGV+ +D +  +F
Sbjct: 197 ITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIILFFIALPIGVSRSDKLNHSF 256

Query: 258 NGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILT 317
           N   FIF   +N + W     + + G  P +W IGA+DS +HM+EEA++A +AVP+ I+ 
Sbjct: 257 NNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVRAVPIGIVG 316

Query: 318 SITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ 377
           SI  CW+LG+ I + + ACM PD+N ++++ +GQ + Q+ ++ LGK+W +AF+S + +CQ
Sbjct: 317 SIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAFLSFMIICQ 376

Query: 378 YVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLA 437
           ++MGAS + A SRQ WAFARDD LPFS + KKVN S++ PIRA W  +  ++ +G L LA
Sbjct: 377 FLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWGSSILSLALGCLCLA 436

Query: 438 GPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLL 497
           G VA+ ALFS+ +   Y+A + P  LR+ +GK  F PG FYMG FWSPIINW+S+ FQL 
Sbjct: 437 GEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINWISVAFQLF 496

Query: 498 CIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDL--N 555
            I+++M P    NI   +MNYT +     W  S+IY+  ++ K +EGPKSNL+D +    
Sbjct: 497 TIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNLSDEEFAER 556

Query: 556 TPDGSIEHISSQTFE 570
             D  ++ I S   E
Sbjct: 557 VGDDVLDAILSSNVE 571

>KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 579

 Score =  485 bits (1248), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 233/533 (43%), Positives = 353/533 (66%), Gaps = 2/533 (0%)

Query: 23  TNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFG 82
            +N  +    +S ++   S     + YI+A +A  D ++LAEIGYK+EL R +ST+Q+FG
Sbjct: 23  NSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFG 82

Query: 83  IAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXX 142
           +AFSIMGLLPSIAS +   L  G V   WGW + G  ILS+G A+ EL+S+IPT+G +  
Sbjct: 83  VAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYV 142

Query: 143 XXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKT 202
                AP K++  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  + DFE++   T
Sbjct: 143 ACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-GNPDFEVTDPIT 201

Query: 203 FAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA-FLIVLPIGVANNDSMTFNGPG 261
           + V+CA I+A  +LTSM +   + LQT SI+ N+ L+  F IVLPIGV+ +D ++FN   
Sbjct: 202 YGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIILFFIVLPIGVSRSDKVSFNKAS 261

Query: 262 FIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITV 321
           +IF + QN + W     + + G  P +W IGA+DS +HM+EEAK+A +AVP+ I+ SI+ 
Sbjct: 262 YIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISS 321

Query: 322 CWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMG 381
           CW+LG+ I + I ACM PD+N ++++ +GQ + Q+  + LGK+W + F+SLI +CQ++MG
Sbjct: 322 CWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMG 381

Query: 382 ASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVA 441
           AS + A SRQ WAFARDDG+PFS + KKV++    P+R+ W  +F +I +G L LAG  A
Sbjct: 382 ASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTA 441

Query: 442 SSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVL 501
           + ALFS+ +   Y+A + P  LR+ +G+  F PG FY+G FWS    W+++ FQL  +++
Sbjct: 442 ADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLM 501

Query: 502 MMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDL 554
           +M P +   IT  +MNYT +     W  S+IY+ +++ K +EGPKSNLTD + 
Sbjct: 502 VMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEF 554

>KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W Permease that serves as a gamma- aminobutyrate
           (GABA) transport protein involved in the utilization of
           GABA as a nitrogen source; catalyzes the transport of
           putrescine and delta-aminolevulinic acid (ALA);
           localized to the vacuolar membrane
          Length = 572

 Score =  484 bits (1247), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 239/535 (44%), Positives = 353/535 (65%), Gaps = 5/535 (0%)

Query: 24  NNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGI 83
           ++  V V Q+  + T  S     + +++A++A  D ++LAE+GYK+EL R FS+IQ+FG+
Sbjct: 16  SHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGYKEELKREFSSIQIFGV 75

Query: 84  AFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXX 143
           AFSIMGLLPSIAS L   L  G V   WGW I G  IL+IG A+ EL+SA+PT+G +   
Sbjct: 76  AFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLILTIGIALGELSSAMPTAGAVYVS 135

Query: 144 XXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTF 203
               AP + +  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  + DF  +   T+
Sbjct: 136 CYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAVLV-SNPDFNATDPITY 194

Query: 204 AVYCAAILATVILTSMATAAVSVLQTVSIVINLSL-VAFLIVLPIGVANNDSM--TFNGP 260
            V+ A I+   ILTS+ +   S LQT+SI+ N  L V F I +PIGV+ +D++  +FNG 
Sbjct: 195 GVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPIGVSRSDTLNRSFNGG 254

Query: 261 GFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSIT 320
            FIF    N S+W     + + G +P +W IGA+DS +HM+EEA++A +AVP  I+ SIT
Sbjct: 255 DFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSIT 314

Query: 321 VCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM 380
           VCW+LG+ + + I ACM PDI+ +LD+ FGQ + Q++++ LGK+W + F+S+  +CQ++M
Sbjct: 315 VCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLM 374

Query: 381 GASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPV 440
           GAS + A SRQ WAFARDDG PFS + KKV+     P+RA W  +  ++ +G L L G  
Sbjct: 375 GASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWGSSALSLALGCLCLVGET 434

Query: 441 ASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIV 500
           AS ALFS+ V   Y+A + P  LR+ +GK  F PG FY+G FWSPIINW+S+ FQ   I+
Sbjct: 435 ASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVII 494

Query: 501 LMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLN 555
           +MM P++   +T ++MNYT +     W  S+IY+ +++ K ++GPKSNLTD +  
Sbjct: 495 MMMFPSDS-TVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQ 548

>Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON}
           YDL210W (UGA4) - GABA-specific transport protein [contig
           159] FULL
          Length = 577

 Score =  473 bits (1217), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 238/554 (42%), Positives = 360/554 (64%), Gaps = 7/554 (1%)

Query: 24  NNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGI 83
           +N  V V Q+  ++T  S     + +++A++A  D ++LAE+GYK+EL R FS+IQ+FG+
Sbjct: 21  SNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLAELGYKEELKREFSSIQIFGV 80

Query: 84  AFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXX 143
           AFSIMGLLPSIAS L   L  G V   WGW I G  +L+IG A++EL+S+IPT+G +   
Sbjct: 81  AFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTIGIALAELSSSIPTAGAVYVS 140

Query: 144 XXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTF 203
               AP + +  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  +  F +++  T+
Sbjct: 141 CYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVLV-SNPSFNVTNPITY 199

Query: 204 AVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVA-FLIVLPIGVANNDSM--TFNGP 260
            V+ A I+A  ILTSM T   S +QT+SIV N+ L+  F I +PIGV+ +D +   FN  
Sbjct: 200 GVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFIAVPIGVSRSDKLGRHFNDG 259

Query: 261 GFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSIT 320
            FIF    N SSW     + + G +P +W IGA+DS +HM+EEA++A +AVP  I+ SI+
Sbjct: 260 HFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMAEEARDAVRAVPFGIVGSIS 319

Query: 321 VCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM 380
           VCW++G+ I + + ACM P+I+ +L++ FGQ + Q++++ LGK+W + F+S+  +CQ++M
Sbjct: 320 VCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDALGKRWTLGFLSIFIICQFLM 379

Query: 381 GASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPV 440
           GAS + A SRQ WAFARDDG+PFS + KKV+ +   P+RA W  +  ++ +G L L G  
Sbjct: 380 GASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAVWGSSALSLALGCLCLVGEA 439

Query: 441 ASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIV 500
           AS ALFS+ V   Y+A + P  LR+ +GK  F PG FY+G  WSPIINW+++  Q   I+
Sbjct: 440 ASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGDVWSPIINWIAVFAQAFMII 499

Query: 501 LMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS 560
           +MM P++   +  S+MNYT +     W  S+IY+ +++ K ++GPKSNLTD +     G 
Sbjct: 500 MMMFPSDA-TVDPSTMNYTVVIGPGFWVLSLIYYFVWQRKFYQGPKSNLTDEEFQEYVGE 558

Query: 561 --IEHISSQTFEKQ 572
             I+ I S     Q
Sbjct: 559 DVIDAIISNNVATQ 572

>Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar to
           Ashbya gossypii AFL081W
          Length = 545

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 141/556 (25%), Positives = 257/556 (46%), Gaps = 29/556 (5%)

Query: 26  TSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQ--ELSRHFSTIQVFGI 83
           + ++VQ+ S          +Q+    +K   D+VE+ +  G  +  EL + FS   V G+
Sbjct: 4   SEIQVQEGSDCMQKGDAVSNQI----SKVECDNVEVYSIPGVNKPAELRKSFSLWSVLGV 59

Query: 84  AFSIMGLLPSIA-SILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXX 142
            F +      ++ S++T    GG +  ++G +I  +  + +G ++ EL+SA P +GG   
Sbjct: 60  GFGLTNSWFGLSVSMVTGISSGGPMMIIYGIVIIALISVCVGVSLGELSSAYPHAGGQFW 119

Query: 143 XXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKT 202
                AP K+K + ++L G+      V    S      + +L + A+      E+     
Sbjct: 120 WSLQLAPNKYKRLAAYLCGSFAWAGSVFASASSTLSTTRLLLGMYAL-VHPSLEIKDWHV 178

Query: 203 FAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGF 262
           F  Y  A+   ++L +     + ++ + ++ +  SL +F I + I V  +    FN   F
Sbjct: 179 FVCY-QALHMFLLLFNCHGRPLPLISSTALYV--SLFSF-ITITITVLASSHGNFNDAKF 234

Query: 263 IFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVC 322
           +FANF+N + W      F+ G +   W     D   HM+ E +     +P  IL ++ + 
Sbjct: 235 VFANFRNETGWESNTIAFIVGLINPAWSFSCLDCATHMAFEVEKPETVIPTAILGTVAIG 294

Query: 323 WLLG--FCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLIAVCQYV 379
           +L    +CI +  +     D++G+L +  G P+  + +   G K  AI   SL+ +  + 
Sbjct: 295 FLTSIVYCIAMFFSI---RDLDGILSSTTGAPILDIYYQASGSKACAIVLGSLVLLTSFT 351

Query: 380 MGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGP 439
              S  T  +R  W+FARD+G P+S    KVN  L  P+ A  +      ++G+L LA  
Sbjct: 352 CVTSCHTWQARLCWSFARDNGFPYSRIWAKVNTELGVPLNAHLLSCAVISLLGVLYLASS 411

Query: 440 VASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCI 499
            A +AL +  +    L++ +P +  +L  +NI   G F++GKF     N+V + + L  +
Sbjct: 412 TAFNALVTGCISFLLLSYTVPVICLLLKQRNI-KRGPFWLGKF-GTFSNYVLLAWTLFSL 469

Query: 500 VLMMLPTNPIN-ITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTF--EGPKSNLTDSD--- 553
           V   LP  P+  IT  +MNY  +        SI+Y+    HK F     K  + +SD   
Sbjct: 470 VFFSLP--PMKPITKGNMNYVSIVILSYLLYSILYWKFSGHKKFYIYQEKIPVEESDERA 527

Query: 554 -LNTPDGSIEHISSQT 568
            ++ P+  ++ I + +
Sbjct: 528 EIDDPNSKLQKIPTHS 543

>SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo-inositol
          Length = 541

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 135/553 (24%), Positives = 255/553 (46%), Gaps = 26/553 (4%)

Query: 22  LTNNTSVRVQQISSIKTSRS--KTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQ 79
           ++   S   Q++SS    +   K  DQ+ + N         L  E G   EL + FS   
Sbjct: 1   MSEALSSSYQEVSSQNGIQHLLKEEDQLQHTNT---VKSCTLEGERG--AELRKSFSLWS 55

Query: 80  VFGIAFSIMGLLPSI-ASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSG 138
           + G+ F +      I AS++T    GG +  V+G +I  +  + IG ++ EL+SA P +G
Sbjct: 56  ILGVGFGLTNSWFGISASMVTGISSGGPMMIVYGIIIIALVSVCIGISLGELSSAYPHAG 115

Query: 139 GLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELS 198
           G        APPK++   +++ G+      V    S    +A E++ + A+    DFE+ 
Sbjct: 116 GQFWWSLKLAPPKYRRFAAYMCGSFAWAGSVFTSASTTLSVATELVGMYAL-THPDFEV- 173

Query: 199 SSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFN 258
             K + ++    L  + L     +  S+    S  + +SL +F I + I V       +N
Sbjct: 174 --KRWHIFVCFELLHLFLMIFNCSGKSLPLISSSALYISLFSF-ITITITVLACSHGQYN 230

Query: 259 GPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTS 318
              F+FA F N + W +    F+ G +   W     D   HM+ E +   + +P+ I+ +
Sbjct: 231 DAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPISIMGT 290

Query: 319 ITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVL-GKQWAIAFMSLIAVCQ 377
           + + ++  FC V+ +   +  +++ ++ +  G P+  + +  L  K  AI    LI    
Sbjct: 291 VAIGFITSFCYVIAMFFSL-HNLDEIMSSNTGAPILDIYYQALQSKAGAIVLGCLILFTS 349

Query: 378 YVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLA 437
           +    +  T  +R  W+FARD+GLP+S +  KVN  L  P+ A  +     +++G+L LA
Sbjct: 350 FGCVIACHTWQARLCWSFARDNGLPYSRYWSKVNPELGVPLNAHLMSCAWIVLLGVLYLA 409

Query: 438 GPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLL 497
              A ++L +  +    L++++P ++ +L+ K     G F++GK      N+V + + + 
Sbjct: 410 SSTAFNSLITGCIAFLLLSYVVP-VICLLWRKRQIQHGPFWLGKI-GLFSNYVLLGWTVF 467

Query: 498 CIVLMMLPTNPINITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTF------EGPKSNLT 550
            +V    P   + +T  +MNY + +  G++ + S++Y+      TF      E    N++
Sbjct: 468 ALVFFCFPA-VMPVTKDNMNYASVVIVGYLLY-SLLYWRFRGRYTFYVVEEDEYTGENVS 525

Query: 551 DSDLNTPDGSIEH 563
            +     D +IE 
Sbjct: 526 VNSETIHDTTIEE 538

>TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.205
           YGL077C
          Length = 553

 Score =  140 bits (354), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 135/542 (24%), Positives = 245/542 (45%), Gaps = 19/542 (3%)

Query: 37  KTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIA- 95
           +TS S+   + ++  A   Y    ++ E G +  L + FS   + G+ F +      I+ 
Sbjct: 14  RTSLSEVHTRESHKGA-LEYGKDTMMTERGGEVHLRKSFSLWSILGVGFGLTNSWFGISV 72

Query: 96  SILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAI 155
           S++T    GG +  V+G +I  +  + +GA++ EL+SA P +GG        APPK K  
Sbjct: 73  SMVTGIFSGGPMMIVYGIIIVALISICVGASLGELSSAYPHAGGQFWWSLKLAPPKHKRF 132

Query: 156 LSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVI 215
            ++L G+      V    S     A EV+ + A+    DF   + K + V+    +  + 
Sbjct: 133 AAYLCGSFAYAGSVFTSASTTLSAATEVVGMYAL-AHPDF---TPKRWHVFVCFEIMHLF 188

Query: 216 LTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPD 275
           LT       S+    +  + +SL++F  +  + V    S  FN   F+FA F N + W +
Sbjct: 189 LTLFNCYGKSLPLISASALYISLLSFFTI-TVTVLACSSGKFNDAKFVFATFYNETGWKN 247

Query: 276 CIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAA 335
               F+ G +   W     D   HM+ E +   + +P+ I+ ++ + +   FC V+++  
Sbjct: 248 SGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFATSFCYVISMFF 307

Query: 336 CMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMS-LIAVCQYVMGASILTAISRQIWA 394
            +  D++ L+ +A G P+  +    LG      F+  ++    +    +  T  +R  W+
Sbjct: 308 SI-RDLDSLMQSATGAPILDIYNQALGNTSGAIFLGCMVLFTSFGCIIACHTWQARLGWS 366

Query: 395 FARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANY 454
           FARD GLPFS  + +VN  +  P+ A  +      +IGLL LA   A ++L +  +    
Sbjct: 367 FARDKGLPFSGLLSQVNPQVGVPLNAHLMSCALISLIGLLYLASSTAFNSLCTGCIAFLL 426

Query: 455 LAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGS 514
           L++ +P ++ +L  K     G F+ GK      N V + + + CIV    P   + +T  
Sbjct: 427 LSYSIP-VICLLRKKRQIKHGPFWFGKL-GYFFNIVLLGWAVFCIVFFSFPP-ALPVTKD 483

Query: 515 SMNY-TFLFTGFVWFGSIIYFVLYKHKTFEG-----PKSNLTDSDLNTPDGSIEHISSQT 568
           +MNY + +  GF  + +++Y+     K F        +    D D N+   S + I  + 
Sbjct: 484 NMNYVSVVIVGFTAY-ALLYWKFKGCKEFSAIAEEEEELLNNDVDPNSVRDSEQSIEPEI 542

Query: 569 FE 570
            E
Sbjct: 543 IE 544

>NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {ON}
           Anc_6.205
          Length = 569

 Score =  140 bits (352), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 136/529 (25%), Positives = 239/529 (45%), Gaps = 16/529 (3%)

Query: 19  QPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTI 78
           Q AL    S   Q I S  +   +     N ++ KT   D +     G +  L + FS  
Sbjct: 4   QDALDVIASTYNQDIDSNTSLHQRDTFDKNKLSTKTQELDGDANNNNG-EVHLRKSFSVW 62

Query: 79  QVFGIAFSIMGLLPSI-ASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTS 137
            + G+ F +      I AS++T    GG +  V+G +I  +  + IG ++SEL+SA P +
Sbjct: 63  SILGVGFGLTNSWFGISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLSELSSAYPHA 122

Query: 138 GGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFEL 197
           GG        APPK K   ++L G+      V    S    +A EV+ + A+    DF++
Sbjct: 123 GGQFFWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYAL-THPDFKV 181

Query: 198 SSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTF 257
                F  +    L  ++      + +  +   S+ I  SLV+F  +  + V       F
Sbjct: 182 QRWHIFVCFELLHLLLMLFNCYGKS-LPFISASSLYI--SLVSFFTI-TVTVLACSHGNF 237

Query: 258 NGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILT 317
           N P F+FA F N + W +    F+ G +   W     D   HM+ E +   + +P+ I+ 
Sbjct: 238 NDPKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMG 297

Query: 318 SITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLIAVC 376
           +I + +   FC V+ +   +  D++ +L +  G P+  +   VLG K  AI    L+   
Sbjct: 298 TIAIGFATSFCYVIAMFFSL-RDLDKILTSTTGAPILDIYNQVLGNKSGAIFLGCLVLFT 356

Query: 377 QYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTL 436
            +    +  T  +R  W+FARD+GLP+S    +VN  +  P+ A  +      +IG+L L
Sbjct: 357 SFGCVIACHTWQARLCWSFARDNGLPWSHLWAQVNPQMGVPLNAHLMSCAWISLIGILYL 416

Query: 437 AGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQL 496
           A   A ++L +  +    L++++P ++ +L  K     G F++GKF     N + + +  
Sbjct: 417 ASSTAFNSLITGCIAFLLLSYIIP-VICLLMKKRQIRHGPFWLGKF-GLFSNIILLAWTA 474

Query: 497 LCIVLMMLPTNPI-NITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTFE 543
             I+    P  P+  +T  +MNY   +  G+  + +++Y+     K F 
Sbjct: 475 FAIIFFSFP--PVLPVTKDNMNYVAVVIVGYTSY-ALLYWRFKGRKEFH 520

>TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.205
           YGL077C
          Length = 586

 Score =  139 bits (351), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 132/527 (25%), Positives = 242/527 (45%), Gaps = 20/527 (3%)

Query: 23  TNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQ-ELSRHFSTIQVF 81
           ++ TS +V  ++S   SR+ +  +++   AK   DD +L   +G  +  L + FS   + 
Sbjct: 13  SDTTSNKVIHVNSHAISRNTSNIELSTNGAK--LDDQQLNHHVGDGEVHLRKSFSAWSIL 70

Query: 82  GIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGL 140
           G+ F +      I++ L   +  GG +  V+G +I  +  + +G ++ EL+SA P +GG 
Sbjct: 71  GVGFGLTNSWFGISTSLVTGISSGGPLMVVYGIIIIALISVCVGVSLGELSSAYPHAGGQ 130

Query: 141 XXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSS 200
                  APPK +   ++L G+      V    S    +A EV+ + A+ K  +F+    
Sbjct: 131 FWWSLKLAPPKHRKFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYAL-KHPEFKPQRW 189

Query: 201 KTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGP 260
             F   C  +L   ++          L + S +       F I + +   +  S  FN  
Sbjct: 190 HVFI--CFELLHLFLMLFNCYGKSLPLISSSSLYISLTSFFTITVTVLACS--SGKFNDS 245

Query: 261 GFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSIT 320
            F+FA+F N + W +    F+ G +   W     D   HM+ E +   K +P+ I+ +I 
Sbjct: 246 KFVFASFYNETGWKNNGIAFITGLINPAWSFSCLDCATHMAFEVEKPEKIIPLAIMGTIA 305

Query: 321 VCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMS-LIAVCQYV 379
           + ++  FC V+ +   +  D++ LL++  G P+  +    LG      F+  LI    + 
Sbjct: 306 IGFVTSFCYVIAMFFSI-RDLDKLLNSTTGAPILDIFNQALGNSSGAIFLGCLILFTSFG 364

Query: 380 MGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGP 439
              +  T  +R  W+F+R+ GLP+S    +VN ++  P+ A  +      +IG+L +A  
Sbjct: 365 CVIACHTWQARLCWSFSRNKGLPYSHLWSQVNPNVGVPLNAHLMSCALISIIGVLYIASS 424

Query: 440 VASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCI 499
            A ++L +  +    L++++P ++ +L  +     G F++GKF     N V + + +  I
Sbjct: 425 TAFNSLITACIAFLLLSYIIP-VICLLLKRRQIKHGPFWLGKF-GLFSNIVLLCWTIFAI 482

Query: 500 VLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPK 546
           V    P   + +T  +MNY       V  G  IY +LY H  F+G K
Sbjct: 483 VFFSFPPQ-LPVTKDNMNY----VSVVIVGYSIYAILYWH--FKGSK 522

>AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL077C (HNM1)
          Length = 542

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 121/482 (25%), Positives = 227/482 (47%), Gaps = 25/482 (5%)

Query: 63  AEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIA-SILTIALPGGMVSFVWGWLIFGVFIL 121
            ++   Q L + FS   V G+ F +      I+ S++T    GG +  V+G +I  +  +
Sbjct: 34  CQVDEGQLLRKSFSLWSVLGVGFGLTNSWFGISVSMITGIGSGGPMMIVYGIVIIALVSV 93

Query: 122 SIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQ 181
            +G +++EL+SA P +GG        APPK + + ++L G+      V    S     A 
Sbjct: 94  CVGVSLAELSSAYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLSAAT 153

Query: 182 EVLSIVAIWKDGDFELSSSKTFAVY----CAAILATVILTSMATAAVSVLQTVSIVINLS 237
           E++ + A+ +  +F +     F  Y    C  +L      S+   + S L        +S
Sbjct: 154 ELVGMYALVRP-EFVVRKWHVFVCYQILHCFLMLFNCYGRSLPLVSSSALY-------VS 205

Query: 238 LVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDST 297
           L +F + + I V       FN P F+FA F+N + W +    F+ G +   W     D  
Sbjct: 206 LFSF-VTITITVVACSRGHFNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCA 264

Query: 298 IHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLL 357
            HM+ E +   + +P+ IL ++ + +L  FC V+ +   +  D++ ++ +  G P+  + 
Sbjct: 265 THMAFEVEQPERVIPIAILGTVAIGFLTSFCYVIAMFFSL-RDLSEIMTSNTGVPILDIY 323

Query: 358 FNVLG-KQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSS 416
           +  LG +  A+   SL+ +       S  T  +R  W+FARD GLP+S    +VN+S+  
Sbjct: 324 YQALGSRAGALVLGSLVLLTSVGCIISSHTWQARLCWSFARDGGLPYSHLWARVNRSVGV 383

Query: 417 PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGV 476
           P+ A  +      ++G+L +A   A ++L +  +    L++++P ++ +L  K     G 
Sbjct: 384 PLNAHLMSCVCISLLGILYMASSTAFNSLITGCIAFLLLSYIVP-VICLLLKKRQIKHGP 442

Query: 477 FYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPIN-ITGSSMNYTFLFTGFVWFGSIIYFV 535
           F++G F     N+V + + +  ++   LP  P+  +T  +MNY       V  G I+Y +
Sbjct: 443 FWLGPF-GAFCNYVLLAWTVFVLIFFSLP--PLKPVTKDNMNY----VSVVVVGYILYVL 495

Query: 536 LY 537
           ++
Sbjct: 496 IF 497

>Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa]
           {ON} complement(106505..108265) [1761 nt, 587 aa]
          Length = 586

 Score =  137 bits (346), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 134/534 (25%), Positives = 243/534 (45%), Gaps = 34/534 (6%)

Query: 19  QPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQE--LSRHFS 76
           Q +  N+ + RVQ++         TV++    N  +  D  E+    G   E  L + FS
Sbjct: 20  QHSKLNSFNERVQEL---------TVNE----NDHSISDKKEIQQGGGNGDEVHLRKSFS 66

Query: 77  TIQVFGIAFSIMGLLPSI-ASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIP 135
              + G+ F +      I AS++T    GG +  V+G +I  +  + +G ++ EL+SA P
Sbjct: 67  LWSILGVGFGLTNSWFGISASLVTGISSGGPMMVVYGIIIIALISVCVGVSLGELSSAYP 126

Query: 136 TSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDF 195
            +GG        AP K K   ++L G+      V    S    +A E++ + ++      
Sbjct: 127 HAGGQFWWSLKLAPQKHKRFAAYLCGSFAYAGSVFTSASTTLSVATELVGMYSLTHP--- 183

Query: 196 ELSSSKTFAVYCAAILAT-VILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDS 254
           E    +     C  +L   ++L +    ++ ++ T S+ I+L+    + V  +G ++ + 
Sbjct: 184 EFIPQRWHVFVCFELLHLFLMLFNCYGKSLPLISTTSLYISLASFLTITVTVLGCSHGN- 242

Query: 255 MTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVD 314
             FN P F+FA F N + W + +  F+ G +   W     D   HM+ E +   + +P+ 
Sbjct: 243 --FNDPKFVFATFYNQTGWKNSVIAFITGLINPAWSFSCLDCATHMAFEVEKPERVIPIA 300

Query: 315 ILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLI 373
           I+ +I + ++  FC V+ +   +  D++ L  +  G P+  +    LG K  AI    LI
Sbjct: 301 IMGTIAIGFVTSFCYVIAMFFSI-RDLDALFASHTGAPILDIYNQALGNKGGAIVLGCLI 359

Query: 374 AVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGL 433
               +    +  T  +R  W+F+RD GLP+S    +VN  L  P+ A  +      +IG+
Sbjct: 360 LFTSFGCVIACHTWQARLCWSFSRDKGLPYSHLWAQVNPQLGVPLNAHLMSCAWISLIGI 419

Query: 434 LTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSII 493
           L +A   A ++L +  +    L++++P ++ +L  K     G F++GKF     N V + 
Sbjct: 420 LYIASTTAFNSLITGCIAFLLLSYIIP-VICLLKKKRQIKHGPFWLGKF-GLFSNIVLLG 477

Query: 494 FQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKS 547
           + L  IV    P   + +T  +MNY       V  G  +Y ++Y    F+G K 
Sbjct: 478 WTLFAIVFFSFPPQ-LPVTKDNMNY----VSVVIVGYTLYVLIY--WKFKGSKE 524

>KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo- inositol
          Length = 532

 Score =  132 bits (332), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 125/531 (23%), Positives = 241/531 (45%), Gaps = 17/531 (3%)

Query: 31  QQISSIKTSRS-KTVDQVNYINAKTAYDDVELLAEIGYKQ---ELSRHFSTIQVFGIAFS 86
           Q  S+    RS  + D V  +  +      E +++ G +     L + FS   + G+ F 
Sbjct: 3   QAASTAYEERSLNSGDNVRELRKEDDILVTESVSKNGEEHGEVHLRKQFSLWSILGVGFG 62

Query: 87  IMGLLPSIA-SILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXX 145
           +      I+ S++T  + GG +  V+G +I  +  + I  ++ EL+SA P +GG      
Sbjct: 63  LTNSWFGISTSMITGIMSGGPMMVVYGIIIIALISICIAVSLGELSSAYPHAGGQFWWSL 122

Query: 146 XXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAV 205
             APPK K   +++ G+      V    S    +A E++ + A+    +FE+    TF  
Sbjct: 123 KLAPPKHKRFAAYMCGSLAWAGSVFTSASTTLSVAAEIVGMYAL-THPEFEVKRWHTFVC 181

Query: 206 YCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFA 265
           +    L  ++      A    L  +S       +   I + I V       +N   F+FA
Sbjct: 182 FEVLHLFLMLFNCYGKA----LPLISSSSLYISLFSFITITITVLACSHGKYNDAKFVFA 237

Query: 266 NFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLL 325
            F N + W +    F+ G +   W     D   HM+ E +   + +P+ IL ++ + ++ 
Sbjct: 238 TFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPISILGTVAIGFVT 297

Query: 326 GFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLIAVCQYVMGASI 384
            FC V+ +   +  +++ ++++    P+  + +  LG K  AI    L+    +    + 
Sbjct: 298 SFCYVIAMFFSL-QNLDKVVNSNTQVPILDIYYQALGSKAGAIVLGCLLLFTSFGCVIAC 356

Query: 385 LTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSA 444
            T  +R  W+FARD+GLPFS +  +V+  L  P+ A  + +F  +++G L LA   A ++
Sbjct: 357 HTWQARLCWSFARDEGLPFSRYWARVSPELGVPLNAHLMSSFWIVLLGCLYLASSTAFNS 416

Query: 445 LFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMML 504
           L +  +    L++ +P +  +L  +NI   G F++GKF     N V + + L  IV    
Sbjct: 417 LITGCIMFLLLSYTIPVVCLLLKKRNI-KHGPFWLGKF-GCFSNVVLLGWMLFSIVFFCF 474

Query: 505 PTNPINITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDL 554
           P+  + +   +MNY + +  G++ F S++++      TF   +    + ++
Sbjct: 475 PSQ-MPVVKDNMNYASVVIVGYLLF-SLLFWQFRGRHTFHALEEEAGEDNM 523

>CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P19807 Saccharomyces
           cerevisiae YGL077c HNM1 choline permease
          Length = 556

 Score =  131 bits (329), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 132/524 (25%), Positives = 235/524 (44%), Gaps = 21/524 (4%)

Query: 27  SVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIAFS 86
           S R  + +SI + +   +D      AK     +E    I  +  L + FS   + G+ F 
Sbjct: 2   SPRDIERTSITSQQDSILD--GQFEAKNGKKIIEQEQSIDGEVHLRKSFSLWSILGVGFG 59

Query: 87  IMGLLPSI-ASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXX 145
           +      I AS++T    GG +  V+G +I  +  + IG ++ EL+SA P +GG      
Sbjct: 60  LTNSWFGISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLGELSSAYPHAGGQFWWSL 119

Query: 146 XXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAV 205
             AP K K   ++L G   S A    L +           +V ++     E +  +    
Sbjct: 120 KLAPTKHKRFAAYLCG---SFAYAGSLFTSASTTLSAATELVGMYVLTHPEFTPKRWHIF 176

Query: 206 YCAAILAT-VILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIF 264
            C  +L   ++L +    ++ ++   S+ I  SL +F  V+ + V    S  FN   F+F
Sbjct: 177 VCFELLHLFLMLFNCYGKSLPLISASSLYI--SLTSFF-VITVTVLACSSGKFNDAKFVF 233

Query: 265 ANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWL 324
           A F N + W + +  F+ G +   W     D   HM+ E +   + +P+ I+ +I + +L
Sbjct: 234 ATFYNETGWKNSVIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTIAIGFL 293

Query: 325 LGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLIAVCQYVMGAS 383
             FC V+ +   +  D++ LL +  G P+  +       K  AI    L+ +  +    +
Sbjct: 294 TSFCYVIAMFFSI-RDLDALLASNTGAPILNIYEQATNSKAGAIVLGCLVLITSFGCIIA 352

Query: 384 ILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASS 443
             T  +R  W+FARD+GLP+S +  +VN +   P+ A  + +    +IG+L LA   A +
Sbjct: 353 CHTWQARLGWSFARDNGLPYSKYWSQVNPNAGVPLNAHLMSSALIALIGVLYLASTTAFN 412

Query: 444 ALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMM 503
           +L +  +    L++++P ++ +L  K     G F++GKF     N V + + L  IV   
Sbjct: 413 SLITGCIAFLLLSYIIP-VICLLMRKRQIRQGPFWLGKF-GLFSNIVLLGWTLFAIVFFS 470

Query: 504 LPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKS 547
            P   + ++  +MNY       V  G  +Y + Y    F+G K 
Sbjct: 471 FPP-VLPVSKDNMNY----VSVVIVGYTVYAIAYWE--FKGKKE 507

>KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {ON}
           Anc_6.205 YGL077C
          Length = 543

 Score =  130 bits (328), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 124/493 (25%), Positives = 230/493 (46%), Gaps = 17/493 (3%)

Query: 68  KQELSRHFSTIQVFGIAFSIMGLLPSIA-SILTIALPGGMVSFVWGWLIFGVFILSIGAA 126
           +  L + FS   + G+ F +      I+ S++T  + GG +  V+G +I  +  + +G +
Sbjct: 51  EPHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIMSGGPMMIVYGIIIIALISVCVGGS 110

Query: 127 MSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSI 186
           + EL+SA P +GG        AP + +   +FL G+      V    S       EV+ +
Sbjct: 111 LGELSSAYPHAGGQFWWALKLAPARHRRFAAFLCGSFAYAGSVFTSASTTLSAGTEVVGM 170

Query: 187 VAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLP 246
            A+ K   F +   K + V+    L  + L        S+    S  + +SL++FL +  
Sbjct: 171 YAL-KHPGFVV---KRWHVFVCFELIHLFLMLFNCYGKSLPLISSSSLYISLISFLTI-T 225

Query: 247 IGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKN 306
           I V    S +FN   F+FA F N + W +    F+ G +   W     DS  HM+ E + 
Sbjct: 226 ITVLACSSGSFNDSKFVFATFYNETGWKNSGMAFIMGLINPAWSFSCLDSATHMAFEVER 285

Query: 307 ASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWA 366
             + +P  I+ ++ + ++  FC V+ +   +  DI+ +L +  G P+ ++    LG +  
Sbjct: 286 PERVIPTAIMGTVAIGFVTSFCYVIAMFFSI-RDISAVLKSTTGAPILEIYRQALGNEGG 344

Query: 367 IAFMS-LIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGA 425
             F+  L+    +    S  T  +R  W+F+RD+GLP+S W  +VN  +  P+ A  +  
Sbjct: 345 AIFLGCLVLFTSFGCIISCHTWQARLCWSFSRDNGLPYSKWWSQVNPDVGVPLNAHLMSC 404

Query: 426 FAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSP 485
               +IG+L LA   A ++L +  +    L++ +P ++ +L+ +     G F++GKF   
Sbjct: 405 AWISLIGVLYLASSTAFNSLITACIAFLLLSYSVP-IVCLLWRRRDIPQGPFWLGKF-GL 462

Query: 486 IINWVSIIFQLLCIVLMMLPTNPINITGSSMNY-TFLFTGFVWFGSIIYFVLYK----HK 540
             N V + + +  +V    P   + +  ++MNY   +  GFV + S++Y+        HK
Sbjct: 463 FANVVLLAWTVFAVVFFSFPP-VLPVDRNNMNYVCVVIVGFVTY-SLLYWRFKGSRDFHK 520

Query: 541 TFEGPKSNLTDSD 553
             + P   L D++
Sbjct: 521 VEDEPGEKLVDAE 533

>KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]
           {ON} similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 547

 Score =  130 bits (326), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 132/550 (24%), Positives = 247/550 (44%), Gaps = 28/550 (5%)

Query: 25  NTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFGIA 84
           N +     I ++    SK  +Q   I++K AYD      E      L + FS   + G+ 
Sbjct: 17  NDNSSDNGIKNVVHEESKLEEQS--ISSKDAYDAYGGTGE----GHLRKSFSLWSILGVG 70

Query: 85  FSIMGLLPSIA-SILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXX 143
           F +      I+ S++T    GG +  V+G +I  +  + I   + EL+SA P +GG    
Sbjct: 71  FGLTNSWFGISVSMVTGIYSGGPMMVVYGIIIIALISICIAVTLGELSSAFPHAGGQFWW 130

Query: 144 XXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTF 203
               APPK++ + ++L G+      +    S    +A E++ + A+    DFE+     F
Sbjct: 131 SLQLAPPKYRRLAAYLCGSFAWAGAIFSSASTTLSVASELVGMYAL-THPDFEVKRWHVF 189

Query: 204 AVYCAAILATVILT-SMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGF 262
              C  IL   ++  + +  A+ V+   S+ I  SL++F  +  + V       +N   F
Sbjct: 190 V--CFQILHLFLMMFNCSGKALPVISQSSLYI--SLISFFTI-TVTVLACSHGKYNDAKF 244

Query: 263 IFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVC 322
           +FA F N + W + +  F+ G +   W     D   HM+ E +N  + +P+ IL ++ + 
Sbjct: 245 VFATFYNETGWKNGVIAFIVGLINPAWSFSCLDCATHMAFEVENPERVIPISILCTVGIG 304

Query: 323 WLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQ-WAIAFMSLIAVCQYVMG 381
           +L  F  V+ +   +  D+  +  +  G P+ ++          A+    LI    +   
Sbjct: 305 FLTSFSYVIAMFFSL-QDLEAVASSNTGMPILEIFRQATKSTPGAVVLGCLILFTSFGCV 363

Query: 382 ASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVA 441
            +  T  +R  W+FARD+G+P+S +  K++  L  P+ A  +      ++G L +A   A
Sbjct: 364 IACHTWQARLCWSFARDNGIPYSKYWAKIDPELGVPLNAHLLSCALISLLGCLYMASTTA 423

Query: 442 SSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVL 501
            ++L +  +     ++ +P +  +   +NI   G F++GKF     N V + + L  +V 
Sbjct: 424 FNSLITGCIAFLLFSYSVPVVCLLARKRNI-KHGPFWLGKF-GAFSNIVLLGWNLFALVF 481

Query: 502 MMLPTNPINITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS 560
              P   + +T  +MNY + +  GF+ F    Y   ++   F+  K      D NT D +
Sbjct: 482 FCFPA-VMPVTKDNMNYASVVIVGFLLF----YLGFWQ---FKAKKVFYIREDENT-DSN 532

Query: 561 IEHISSQTFE 570
            E ++++ F 
Sbjct: 533 QESVTTEAFH 542

>Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  129 bits (325), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 123/497 (24%), Positives = 221/497 (44%), Gaps = 14/497 (2%)

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMS 128
            L + FS   + G+ F +      I++ +   +  GG +  V+G +I  +  + IG ++ 
Sbjct: 53  HLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLG 112

Query: 129 ELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVA 188
           EL+SA P +GG        APPK+K   +F+ G+      V    S    +A EV+ + A
Sbjct: 113 ELSSAYPHAGGQFWWSLKLAPPKYKRFAAFMCGSFAYAGSVFTSASTTLAVATEVVGMYA 172

Query: 189 IWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIG 248
           +      E +  +     C  +L   ++          + + S +    L  F I + + 
Sbjct: 173 LMHS---EFTPKRWHIFVCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTITITVL 229

Query: 249 VANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNAS 308
             ++    FN   F+FA F N + W +    F+ G +   W     D   HM+ E +   
Sbjct: 230 ACSHGK--FNDSKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPE 287

Query: 309 KAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAI 367
           + +P+ I+ +I + ++  FC V+ +   +  D++G+L +  G P+  +    LG K  AI
Sbjct: 288 RVIPIAIMGTIAIGFVTSFCYVIAMFFSI-KDLDGILSSTTGAPILDIYNQALGNKSGAI 346

Query: 368 AFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFA 427
               LI    +    +  T  +R  W+F+RD+GLP S    +VN     P+ A  +    
Sbjct: 347 FLGCLILFTSFGCVIACHTWQARLCWSFSRDNGLPLSRLWSQVNPHTGVPLNAHLMSCAW 406

Query: 428 AIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPII 487
             +IGLL LA   A  +L +  +    L++++P ++ +L  K     G F++GKF     
Sbjct: 407 ISLIGLLYLASSTAFQSLITGCIAFLLLSYIIP-VVCLLNKKRDIAHGPFWLGKF-GFFS 464

Query: 488 NWVSIIFQLLCIVLMMLPTNPINITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTFEG-P 545
           N V + + L  +V    P   + +T  +MNY   +  G+  + SI+Y+     K F    
Sbjct: 465 NIVLLGWTLFAVVFFSFPP-VLPVTKDNMNYVCVVIVGYTAY-SILYWKYKGKKEFHAVE 522

Query: 546 KSNLTDSDLNTPDGSIE 562
           +S +  +D      +IE
Sbjct: 523 ESEIDQTDFANHFDTIE 539

>Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON}
           YGL077C (REAL)
          Length = 562

 Score =  129 bits (324), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 132/558 (23%), Positives = 245/558 (43%), Gaps = 33/558 (5%)

Query: 18  LQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFST 77
           ++P  ++NT +           R   V++   I      D   ++A  G +  L + FS 
Sbjct: 13  MEPEQSSNTHIH---------KRDVRVEE--EIKPSDDMDGKGVVAADG-EVHLRKSFSL 60

Query: 78  IQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMSELASAIPT 136
             + G+ F +      I++ +   +  GG +  ++G +I  +  + IG ++ EL+SA P 
Sbjct: 61  WSILGVGFGLTNSWFGISTSMVAGISSGGPMMIIYGIIIVALISICIGTSLGELSSAYPH 120

Query: 137 SGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFE 196
           +GG        APPK+K   +++ G+      V    S    +A EV+ + A+      E
Sbjct: 121 AGGQFWWSLKLAPPKYKRFAAYMCGSFAFAGSVFTSASTTLSVATEVVGMYALMHP---E 177

Query: 197 LSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMT 256
            +  +     C  +L   ++          + + S +       F I + +   ++    
Sbjct: 178 FTPKRWHIFVCFELLHLFLMLFNCYGKSLPIISSSSLYISLFSFFTITITVLACSHGK-- 235

Query: 257 FNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDIL 316
           FN   F+FA F N + W +    F+ G +   W     D   HM+ E +   + +P+ I+
Sbjct: 236 FNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIM 295

Query: 317 TSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLIAV 375
            ++ + ++  FC V+ +   +  D++ +L +  G P+  +    LG K  AI    LI +
Sbjct: 296 GTVAIGFVTSFCYVIAMFFSI-KDLSAVLSSTTGAPILDIYNQALGNKSGAIFLGCLILL 354

Query: 376 CQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLT 435
             +    +  T  +R  W+FARD+GLP S +  +VN  +  P+ A  +      +IGLL 
Sbjct: 355 TSFGCVIACHTWQARLCWSFARDNGLPLSRYWAQVNPHIGVPLNAHLMSCAWISLIGLLY 414

Query: 436 LAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQ 495
           LA   A  +L +  +    L++++P ++ +L  K     G F++GKF     N V + + 
Sbjct: 415 LASSTAFQSLITGCIAFLLLSYIIP-VVCLLAKKRDIAHGPFWLGKF-GFFSNIVLLGWT 472

Query: 496 LLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKS--NLTDSD 553
           +  +V    P   + +T  +MNY  +    V  G   Y +LY H  F+G K    + +S+
Sbjct: 473 IFSVVFFSFPP-VLPVTKDNMNYVCV----VIVGYTAYSLLYWH--FKGKKEFHAVEESE 525

Query: 554 LNTPD--GSIEHISSQTF 569
               D   + E+  SQ F
Sbjct: 526 DEQADFANNFENEDSQEF 543

>NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205
          Length = 600

 Score =  129 bits (324), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 137/543 (25%), Positives = 249/543 (45%), Gaps = 26/543 (4%)

Query: 17  LLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAY-DDVELLAEI---------- 65
           + +P   +NTS+  +     K     T +Q + I + T   D+ +  ++I          
Sbjct: 1   MYEPDHLSNTSIHRRDEFDEKLKELPTTEQQHTIKSITPEGDENDTESQIINKNGNNNTT 60

Query: 66  --GYKQELSRHFSTIQVFGIAFSIMGLLPSIA-SILTIALPGGMVSFVWGWLIFGVFILS 122
             G +  L + FS   V G+ F +      I+ S++T    GG +  ++G +I  +  + 
Sbjct: 61  TNGSEVHLRKSFSLWSVLGVGFGLTNSWFGISTSMVTGISSGGPMMVIYGIIIIALISIC 120

Query: 123 IGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQE 182
           IG ++ EL+SA P +GG        APPK+K + +++ G+      V    S     A E
Sbjct: 121 IGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRLAAYMCGSFAYAGSVFTSASTTLSAATE 180

Query: 183 VLSIVAIWKDGDFELSSSKTFAVYCAAILATVILT-SMATAAVSVLQTVSIVINLSLVAF 241
           V+ + A+  + DF       F   C  IL   ++  +    ++ ++   S+ I+LS  +F
Sbjct: 181 VVGMYALTHE-DFVPKRWHVFV--CFEILHLFLMIFNCYGKSLPIISASSLYISLS--SF 235

Query: 242 LIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMS 301
           LI+  I V       FN   F+FA F N + W +    F+ G +   W     D   HM+
Sbjct: 236 LII-TITVLACSRGQFNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMA 294

Query: 302 EEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVL 361
            E +   + +P+ IL++I + ++  FC V+++   +  D++ +L +  G P+  +    L
Sbjct: 295 FEVEKPERVIPIAILSTIAIGFITSFCYVISMFFSL-RDLDSILKSTTGAPILDIYNQAL 353

Query: 362 G-KQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRA 420
           G K  AI    +I    +    +  T  +R  W+FARD+GLP+S    +VN  +  P+ A
Sbjct: 354 GNKAGAIILGCMILFTSFGCVIACHTWQARLGWSFARDNGLPYSKLWAQVNPQVGVPLNA 413

Query: 421 TWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMG 480
             +      +IG+L LA   A ++L +  +    L++++P +  +L  K     G F++G
Sbjct: 414 HLMSCAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIP-VSCLLLKKRQIRHGPFWLG 472

Query: 481 KFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHK 540
           KF     N V +++ +  IV    P   + +T  +MNY  +        S++Y+    +K
Sbjct: 473 KF-GLFSNIVLLLWTVFAIVFFSFPAM-MPVTKDNMNYVAVVIAGYTLYSVLYWNFKGYK 530

Query: 541 TFE 543
            F 
Sbjct: 531 EFH 533

>TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {ON}
           Anc_6.205 YGL077C
          Length = 594

 Score =  129 bits (323), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 142/566 (25%), Positives = 255/566 (45%), Gaps = 33/566 (5%)

Query: 8   QQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGY 67
           Q+ S+V  I+      N+ +    Q+ S+ +S+   +D+ N IN +  ++  E       
Sbjct: 9   QKNSEVYTIVE----ANDDTASFNQLGSVSSSKISDLDK-NSINNE--FNQTE------- 54

Query: 68  KQELSRHFSTIQVFGIAFSIMGLLPSI-ASILTIALPGGMVSFVWGWLIFGVFILSIGAA 126
           +  L + FS   + G+ F +      I AS++T    GG +  V+G +I  +  + +G +
Sbjct: 55  EVHLRKSFSLWSILGVGFGLTNSWFGISASMVTGIESGGPMMIVYGIIIISLISICVGVS 114

Query: 127 MSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSI 186
           + EL+SA P +GG        APPK +   +++ G+      V    S    +A E++ +
Sbjct: 115 LGELSSAYPHAGGQFFWSLKLAPPKHRRFAAYMCGSYAYAGSVFTSASTTLSVATELVGM 174

Query: 187 VAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLP 246
            A+      E    + + V+    L  + L        S+    S  + +SL++F  +  
Sbjct: 175 YALCH----ESFVPRRWHVFVCFELLHLFLLLFNCYGKSLPFISSSSLYISLLSFFTI-T 229

Query: 247 IGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKN 306
           I V       +N   F+FA F N + W +    F+ G +   W     D   HM+ E + 
Sbjct: 230 ITVLACAHGKYNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEK 289

Query: 307 ASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVL-GKQW 365
             + +P+ I+ +I + ++  FC V+ +   +  D+N L ++  G P+  +    L  K  
Sbjct: 290 PERVIPMAIMGTIAIGFITSFCYVIAMFFSLN-DLNALFNSHTGAPILDIYNQALHNKAG 348

Query: 366 AIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGA 425
           AI    L+    +    +  T  +R  W+FA D GLP+S W  +VN +L  P+ A  +  
Sbjct: 349 AIVLGCLVLFTSFGCVIACHTWQARLCWSFATDQGLPYSKWWAEVNPTLGVPLNAHLMSC 408

Query: 426 FAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSP 485
               +IGLL LA   A ++L +  +    L++++P ++ +L  K     G F++GKF   
Sbjct: 409 GWIAIIGLLYLASSTAFNSLITGCIAFLLLSYIIP-VICLLQKKRQIKHGPFWLGKF-GL 466

Query: 486 IINWVSIIFQLLCIVLMMLPTN-PINITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTFE 543
             N V + + L  IV    P N P+N   ++MNY   +  GF  +  +IY+     K F 
Sbjct: 467 FSNIVLLCWTLFSIVFFSFPPNLPVN--RNNMNYVCVVIVGFTCY-QLIYWKWKGAKEFH 523

Query: 544 GPKSNLTDSDLNTPDGSIEHISSQTF 569
             +    D D N    +  +I+  T+
Sbjct: 524 SAQ----DDDDNIEYENNSNINMDTY 545

>YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}
           HNM1Choline/ethanolamine transporter; involved in the
           uptake of nitrogen mustard and the uptake of glycine
           betaine during hypersaline stress; co-regulated with
           phospholipid biosynthetic genes and negatively regulated
           by choline and myo-inositol
          Length = 563

 Score =  125 bits (315), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 125/529 (23%), Positives = 231/529 (43%), Gaps = 25/529 (4%)

Query: 18  LQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFST 77
           +QP  ++N S+  + +        K +D ++   A  A  +V L           + FS 
Sbjct: 13  MQPDQSSNASMHKRDLRV--EEEIKPLDDMDSKGAVAADGEVHL----------RKSFSL 60

Query: 78  IQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMSELASAIPT 136
             + G+ F +      I++ +   +  GG +  V+G +I  +  + IG ++ EL+SA P 
Sbjct: 61  WSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLGELSSAYPH 120

Query: 137 SGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFE 196
           +GG        APPK+K   +++ G+      V    S    +A EV+ + A+      E
Sbjct: 121 AGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATEVVGMYALTHP---E 177

Query: 197 LSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMT 256
               +     C  +L   ++          + + S +    L  F I + +   ++    
Sbjct: 178 FIPKRWHIFVCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTITITVLACSHGK-- 235

Query: 257 FNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDIL 316
           FN   F+FA F N + W +    F+ G +   W     D   HM+ E +   + +P+ I+
Sbjct: 236 FNDAKFVFATFNNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIM 295

Query: 317 TSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLIAV 375
            ++ + ++  FC V+ +   +  D++ +L +  G P+  +    LG K  AI    LI  
Sbjct: 296 GTVAIGFVTSFCYVIAMFFSI-QDLDAVLSSTTGAPILDIYNQALGNKSGAIFLGCLILF 354

Query: 376 CQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLT 435
             +    +  T  +R  W+FARD+GLP S    +VN     P+ A  +      +IGLL 
Sbjct: 355 TSFGCVIACHTWQARLCWSFARDNGLPLSRLWSQVNPHTGVPLNAHLMSCAWITLIGLLY 414

Query: 436 LAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQ 495
           LA   A  +L +  +    L++++P +  +   +NI + G F++GKF     N V + + 
Sbjct: 415 LASSTAFQSLITGCIAFLLLSYIIPVICLLAKKRNIAH-GPFWLGKF-GFFSNIVLLGWT 472

Query: 496 LLCIVLMMLPTNPINITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTFE 543
           +  +V    P   + +T  +MNY   +  G+  + SI+Y+     K F 
Sbjct: 473 VFSVVFFSFPP-VLPVTKDNMNYVCVVIVGYTAY-SILYWKYKGKKEFH 519

>ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {ON}
           similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 569

 Score =  122 bits (306), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 126/499 (25%), Positives = 223/499 (44%), Gaps = 20/499 (4%)

Query: 51  NAKTAYDDVELLAEIGYKQE--LSRHFSTIQVFGIAFSIMGLLPSI-ASILTIALPGGMV 107
           N    YDD    +  G  +E  L + FS   + G+ F +      I AS++T    GG +
Sbjct: 34  NDMDKYDDE---SGSGGSEEVVLRKSFSLWSILGVGFGLTNSWFGISASLVTGLSSGGPL 90

Query: 108 SFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLA 167
             ++G ++  +  ++IG ++ EL SA P +GG        APPK K   +++ G+     
Sbjct: 91  LVIYGIILISLISITIGVSLGELTSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSFAYAG 150

Query: 168 LVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVL 227
            +    S    +A E++++  +  + DF   + K + V+   ++    L        S L
Sbjct: 151 AIFTSASTTLSVASELVAMYQLTHE-DF---TPKRWQVFVTYLILHFFLMQFNCYGKS-L 205

Query: 228 QTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPI 287
             ++       +   IV+ I V    S  FN   F+F++F N + W      F+ G +  
Sbjct: 206 PLIASSSLYISLLSFIVITITVLACSSGHFNSAKFVFSHFYNETGWSSGGIAFIVGLINP 265

Query: 288 VWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDT 347
            W     D   HM+ E +     +P  IL +I + ++  FC V+++   +  D+  +L+ 
Sbjct: 266 AWSFSCLDCATHMAFEVEKPETIIPTAILGTIAIGFITSFCYVISLFFSI-RDLPSVLNN 324

Query: 348 AFGQPLAQLLFNVLG-KQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFW 406
             G P+  +    L  K  AI    LI    +    +  T  SR  W+F+RD GLPF+  
Sbjct: 325 TGGFPVLVIYEQALNSKAGAIVLGCLILFTSFGCVIASHTWQSRLCWSFSRDGGLPFAGL 384

Query: 407 IKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRML 466
             KVN  +  P+ A  +      +IG L LA   A ++L +  +    L++ +P ++ +L
Sbjct: 385 WSKVNSRMGVPLNAHLMSCVWVAIIGFLYLASSTAFNSLITACIAFLLLSYSIP-VICLL 443

Query: 467 FGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTN-PINITGSSMNY-TFLFTG 524
             K     G F+ GKF     N   +++ + C+V    P + P+N    +MNY + +  G
Sbjct: 444 MKKRQIAHGPFWFGKF-GLFCNIALLLWTVFCLVFFSFPPDYPVN--KDNMNYVSVVIVG 500

Query: 525 FVWFGSIIYFVLYKHKTFE 543
           +  + S+IY+  +  K F 
Sbjct: 501 YFLY-SLIYWKFWASKDFH 518

>Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 135/566 (23%), Positives = 241/566 (42%), Gaps = 32/566 (5%)

Query: 7   GQQPSKVDVILLQPALTNNTSVRVQQISSIKT-SRSKTVDQVNYINAKTAYDDVELLAEI 65
           G Q   V    + P   +NT V  + +   +    S   D    + A     D E+    
Sbjct: 2   GIQNDNVSGDYMDPDQYSNTDVHKRDVRVAEEFEPSDDADGKGVVAA-----DGEV---- 52

Query: 66  GYKQELSRHFSTIQVFGIAFSIMGLLPSI-ASILTIALPGGMVSFVWGWLIFGVFILSIG 124
                L + FS   + G+ F +      I AS++     GG +  V+G +I  +  + IG
Sbjct: 53  ----HLRKSFSLWSILGVGFGLTNSWFGISASMVAGISSGGPMMIVYGIIIVALISVCIG 108

Query: 125 AAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVL 184
            ++ EL+SA P +GG        APPK+K   +++ G+      V    S    +A EV+
Sbjct: 109 TSLGELSSAYPHAGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATEVV 168

Query: 185 SIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIV 244
            + A+  + +F       F   C  +L   ++          L + S +    L  F I 
Sbjct: 169 GMYAL-MNPNFIPKRWHIFV--CFELLHLFLMLFNCYGKSLPLISSSSLYISLLSFFTIT 225

Query: 245 LPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEA 304
           + +   ++    FN   F+FA F N + W +    F+ G +   W     D   HM+ E 
Sbjct: 226 ITVLACSHGK--FNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEV 283

Query: 305 KNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLG-K 363
           +   + +P+ I+ ++ + ++   C V+ +   +  D++ +L +  G P+  +    LG K
Sbjct: 284 EKPERVIPIAIMGTVAIGFVTSLCYVIAMFFSI-KDLDAVLSSTTGAPILDIYNQALGNK 342

Query: 364 QWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWV 423
             AI    L+    +    +  T  +R  W+FARD+GLP S +  +VN     P+ A  +
Sbjct: 343 SGAIFLGCLVLFTSFGCVIACHTWQARLCWSFARDNGLPLSRFWSQVNPHTGVPLNAHLM 402

Query: 424 GAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFW 483
                 +IGLL LA   A  +L +  +    L++++P ++ +L  K     G F++GKF 
Sbjct: 403 SCAWISLIGLLYLASSTAFQSLITGCIAFLLLSYIIP-VICLLAKKRDIAHGPFWLGKF- 460

Query: 484 SPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNY-TFLFTGFVWFGSIIYFVLYKHKTF 542
               N V + + +  IV    P   + +T  +MNY   +  G+  + SI+Y+     K F
Sbjct: 461 GLFSNIVLLGWTVFSIVFFSFPP-VLPVTKDNMNYVCVVIVGYTAY-SILYWRYKGKKEF 518

Query: 543 EGPKSNLTDSD-----LNTPDGSIEH 563
              + +  + D       T + S +H
Sbjct: 519 HAVEESEHEQDDFANNFETIEDSRDH 544

>KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.205
           YGL077C
          Length = 538

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 130/503 (25%), Positives = 231/503 (45%), Gaps = 24/503 (4%)

Query: 51  NAKTAYDDVELLAEIGYKQE----LSRHFSTIQVFGIAFSIMGLLPSI-ASILTIALPGG 105
            + T   D E+L++   +Q+    L + FS   + G+ F +      I AS++T    GG
Sbjct: 21  RSNTPSKDPEILSDKLIEQDEDIHLRKSFSLWSILGVGFGLTNSWFGISASMITGITSGG 80

Query: 106 MVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNS 165
            +  V+G +I  +  + IG ++ EL+SA P +GG        A PK K   +++ G   S
Sbjct: 81  PMMIVYGIIIIALISICIGVSLGELSSAYPHAGGQFHWTLQLASPKHKRFAAYMCG---S 137

Query: 166 LALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSS----KTFAVYCAAILATVILTSMAT 221
            A    +    +  A   LS VA    G + L+      K + V+    L  + L     
Sbjct: 138 FAYAGSV----FTSASTTLS-VATLLVGMYSLTHENFIPKRWHVFVCFELVHLFLMLFNC 192

Query: 222 AAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFL 281
              S+    S  + +SL +F  +  I V    S  FN   F+FA F N + W      F+
Sbjct: 193 YGKSLPLISSSSLYISLFSFFTI-TITVLACSSGKFNDSKFVFATFYNETGWKSSAIAFI 251

Query: 282 CGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDI 341
            G +   W     D   HM+ E +   + +P+ I+ +I + +L  F  V+++   +  +I
Sbjct: 252 VGLINPAWSFSCLDCATHMAFEVEKPERVIPMAIMGTIAIGFLTSFAYVISMFFSI-RNI 310

Query: 342 NGLLDTAFGQPLAQLLFNVLG-KQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDG 400
             +L++  G P+ ++    LG K  A+    L+    +    +  T  +R  W+FARD G
Sbjct: 311 QDVLNSNSGAPILEIYNQALGNKAGAVILGCLVLFTSFGCVIACHTWQARLCWSFARDKG 370

Query: 401 LPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMP 460
           LP+S +  +VN +   P+ A  +      +IGLL LA   A ++L +  +    L++ +P
Sbjct: 371 LPYSRFWSQVNPTFGVPLHAHLMSCTLISIIGLLYLASSTAFNSLITACIAFLLLSYSIP 430

Query: 461 NLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNY-T 519
            ++ +L  K   N G F++GKF     N V + + +  +V    P+  I +  ++MNY +
Sbjct: 431 -VICLLLRKRDMNRGPFWLGKF-GLFSNIVLLAWTVFSLVFFSFPSQ-IPVNRNNMNYVS 487

Query: 520 FLFTGFVWFGSIIYFVLYKHKTF 542
            +  G+ +F    +FV  K++ +
Sbjct: 488 VVIAGYTFFSVSYWFVKGKNEFY 510

>Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {ON}
           YGL077C (HNM1) - Transporter (permease) for choline and
           nitrogen mustard; share homology with UGA4 [contig 168]
           PARTIAL
          Length = 342

 Score = 99.8 bits (247), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 147/308 (47%), Gaps = 13/308 (4%)

Query: 242 LIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMS 301
            I + I V       +N P F+FA F N + W +    F+ G +   W     D   HM+
Sbjct: 25  FITITITVLACSRGNYNDPKFVFATFFNETGWRNSGIAFIVGLINPAWSFSCLDCATHMA 84

Query: 302 EEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVL 361
            E +   + +P+ IL ++ + ++  FC V+ +   +  +++ ++ +  G P+  +    L
Sbjct: 85  FEVERPERVIPISILGTVAIGFVTSFCYVIAMFFSLH-NLDEIVGSNTGAPILDIYLQAL 143

Query: 362 G-KQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRA 420
           G K  A+    L+    +    +  T  +R  W+FARD+GLP+S    KV+  L  P+ A
Sbjct: 144 GNKAGAVVLGCLVLFTSFGCVIACHTWQARLCWSFARDEGLPYSRIWAKVSPELGVPLNA 203

Query: 421 TWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMG 480
             +  F  +++GLL LA   A ++L +  +     ++++P +  ++  +NI   G F++G
Sbjct: 204 HLMSCFWIVLLGLLYLASTTAFNSLITGCIMFLLFSYIVPVICLLIKKRNI-KHGPFWLG 262

Query: 481 KFWSPIINWVSIIFQLLCIVLMMLP-TNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKH 539
           KF     N V + + L  +V    P   P++    +MNY       V  G I++ +L+ H
Sbjct: 263 KF-GLFANIVLLGWSLFALVFFCFPFVMPVD--KDNMNY----ASVVIVGYILFSLLFWH 315

Query: 540 KTFEGPKS 547
             F+G  S
Sbjct: 316 --FKGRHS 321

>ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar to
           uniprot|Q0CZS0 Aspergillus terreus NIH2624 ATEG_00814
           Hypothetical protein
          Length = 535

 Score = 92.8 bits (229), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 115/473 (24%), Positives = 210/473 (44%), Gaps = 33/473 (6%)

Query: 94  IASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFK 153
           +AS+     PG M  F+       VF  +IGA+++ELAS++P SGG+          K+ 
Sbjct: 65  VASLNNGGPPGIMYEFI----AVSVFYWAIGASIAELASSVPASGGVYHWAAMTPGKKWG 120

Query: 154 AILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILAT 213
            I  +  G  + LA   G+ S    +A  ++    ++   D EL   + + VY   ++ T
Sbjct: 121 PICGWFAGWFDFLAWNFGIASNANMVASMIVYSYGLFHP-DTEL---QRWHVYICFLILT 176

Query: 214 VILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPG---FIFANFQNN 270
            +   +   A   L T++ + +  ++    V  +  A   S T  G     F+++ +QNN
Sbjct: 177 WLCCFVVMFADWALPTINRIGSFLILGGWFVTVVVCAVMPSTTGKGHASNDFVWSKWQNN 236

Query: 271 SSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIV 330
           + +      FL G L   + +G  D   H++EE  +A + +P  +   I    L+GF   
Sbjct: 237 TGYSSDGFAFLLGMLNGAFSVGTPDCITHLAEEIPDAGRNLPKVLFWQI----LVGFITA 292

Query: 331 VTIAACMGPDINGL---LDTAFGQPLAQLLF---NVLGKQWAIAFMSLIAVCQYVMGASI 384
           +T    M   IN L     +    PL ++     N  G    +  +  + +   ++G  I
Sbjct: 293 ITYMIAMFYAINNLPIIFSSNTFSPLGEIYLQATNSRGGAIGLLLIIYLPIICAIVGCYI 352

Query: 385 LTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSA 444
                R ++  ARD+  PFS ++  ++    SP  AT+        +G + +    A +A
Sbjct: 353 TAG--RTLYVLARDNATPFSKYLGAIHPRYKSPFWATFACGVLCTCLGAIYVGSATAFNA 410

Query: 445 LFSMYV----GANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIV 500
               +V     A +LA M+PNLL     ++    G F MGKF    +N +S ++ L+  V
Sbjct: 411 FVGSFVLLTTAAFFLA-MLPNLLTK---RSKLPLGSFNMGKF-GYAVNIISCLYILVFFV 465

Query: 501 LMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSD 553
           +   P + +  T  +MNYT +    +     I+++++  K ++GP  ++ + D
Sbjct: 466 IYCFPYS-LPATAENMNYTSVMVSGLTLMVAIWWMVHGRKNYKGPTFDMVEKD 517

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 120/523 (22%), Positives = 223/523 (42%), Gaps = 29/523 (5%)

Query: 41  SKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILT 99
           S   D ++ I  + A ++ E+     Y+QEL +   S   V G+ F +M  +  + + + 
Sbjct: 21  SDLFDNLHTIIHEEADNEPEIAEHFEYEQELDKSLLSRTSVIGLGFGLMSPVLGMCTSMG 80

Query: 100 IAL-PGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSF 158
           I L  GG  + ++G+ + GVF      ++ E+ S  P    L       AP   K I S+
Sbjct: 81  IGLLNGGPFTIMFGFQVCGVFSFLCACSLGEVVSKFPME--LHGASAILAPDYIKRISSW 138

Query: 159 LIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVI--- 215
           L G    L        V +  AQ ++S++A+    +F+L S K   +Y   I   V+   
Sbjct: 139 LTGWFLLLGNWFMSIGVTFAGAQLIISLIAM---ANFDLISEKYLVLYTVLIYYAVVTIV 195

Query: 216 -LTSMATAA-VSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SS 272
            + ++  A  V  +  V I   +  V F+ VL +    N    F    +   +F N  S 
Sbjct: 196 GVVNLKYAKYVETINKVCIYWIIYAVLFIDVLLLLFHRN---KFRSLPYALFHFDNELSG 252

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVT 332
           +   I  F+ G     + +  F     +++E K   K +P  + +++ +  ++G   +  
Sbjct: 253 YRSVIISFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSSAVLISTVIGIIFLFP 312

Query: 333 IAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAISRQ 391
           I   + PD   L       P+  +       Q+   F+ L+ +   +  G   +T  SR 
Sbjct: 313 IMVIL-PDSRDLFSNQKVLPIVNIFKKSTDSQFVSIFLVLLILGNLFFSGIGSITTSSRA 371

Query: 392 IWAFARDDGLP-FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMY 449
           +++F+RD  +P +  W     +S S  P  +  +    + ++GLL    P+ S+A F+ +
Sbjct: 372 VYSFSRDHAIPYYRLWTYVDPQSESRVPKYSILLSMSISYILGLL----PLFSNAAFNAF 427

Query: 450 VGANYL----AWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLP 505
           +G   L    A ++P LL ++  + +       +      I N  S+ + LL +  + LP
Sbjct: 428 IGCAVLCLCSATLIPLLLVLVTRRRVLKNAPVKIKYKLGWIANIGSVCWLLLSMFSVCLP 487

Query: 506 TNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSN 548
              I +T  +MNY  L   F +F   I +  +  K F+ P+ +
Sbjct: 488 PQ-IPVTAKTMNYALLVFLFCFFIICILYYKWGRKHFQLPQVD 529

>TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa]
           {ON} Anc_1.173 YKL174C
          Length = 659

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 115/533 (21%), Positives = 230/533 (43%), Gaps = 35/533 (6%)

Query: 56  YDDVEL-----LAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGMVS 108
           +DD E      +    Y Q+L +   S   V G+ F +M  +  + + + I L  GG  +
Sbjct: 34  HDDAETEGPQEVEHFNYHQDLDKSLLSRGSVMGLGFGLMSPVLGMCTSMAIGLMNGGPAT 93

Query: 109 FVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLAL 168
            +WG+LI G+ +     ++ E+ S  P    L       AP K K I S+  G    +  
Sbjct: 94  IMWGFLISGIMVWFCSLSLGEIVSKFPME--LHVSSAMLAPKKLKLICSWYTGWLTLIGN 151

Query: 169 VAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQ 228
                S+ +  AQ  +S++ +  + D     S+T  ++   I+  +++T +    + + +
Sbjct: 152 WTMSTSITFAGAQLTISLI-LMANNDL---ISETNLIFFTVIVFYLVVTIVGIVNLKLAR 207

Query: 229 TVSIVINLS---LVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGS 284
            + I+  +    ++  ++ + I +    S  +    F   +F N+ S + +C   F+ G 
Sbjct: 208 FIEIINKVCVYWIIYAILFIDILLLFFHSGKYRSLKFALFHFDNSLSGYANCFVSFIIGF 267

Query: 285 LPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGL 344
               + +  F     +++E K A + +P  +  S+ +  + GF  ++ I   + PD   L
Sbjct: 268 QQSNFTLQGFSMLPALADEVKEAERDIPRAMSASVLISTVSGFIFLLPIMLIL-PDNTNL 326

Query: 345 LDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAISRQIWAFARDDGLP- 402
                  P+  +        +   F+ L+ +   +  G   +T  SR +++F+RD  +P 
Sbjct: 327 FADHKILPIVSIFTQSTHSTFVSFFLVLMILGNLFFSGIGSITTSSRVVYSFSRDHAIPK 386

Query: 403 FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AW 457
             FW     +S+S  P  +  +    + ++G+L L     S+A F+ ++GA  L    A 
Sbjct: 387 HEFWTYVDPQSVSKVPKYSVLLSMAVSYLLGILAL----FSTAAFNAFIGAAVLCLCSAT 442

Query: 458 MMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMN 517
           ++P +L +   + I       +      I+N  SI++ LL +  + LP+  + +T  +MN
Sbjct: 443 VLPLVLVLFTRRRILRNAPIKIHYKLGWIVNITSIVWLLLSMGSVCLPSQ-VPVTVRTMN 501

Query: 518 YTFL-FTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGSIEHISSQTF 569
           Y  + +   +   +I+YF   K+  F  P   L D D       +E  +S  F
Sbjct: 502 YALIVYVACLIAITILYFRWGKYH-FTLP---LVDEDYKNLTSIMESATSSNF 550

>Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii AEL125C
          Length = 583

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 119/518 (22%), Positives = 226/518 (43%), Gaps = 37/518 (7%)

Query: 21  ALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHF-STIQ 79
           +L NNT++R  +I++I  +    +  +     K   DD  L+    Y+Q L +   S   
Sbjct: 6   SLPNNTAIR-DRINAIPENLISNLQTI----LKEDDDDTVLVEHFQYEQRLDKSLLSKYS 60

Query: 80  VFGIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSG 138
           V G+ F +M  +  +++ L+  L  GG ++ +  ++I G        ++ E+ S  P   
Sbjct: 61  VIGLGFGLMSPVLGMSTSLSTGLVNGGPLTILGAFIICGFMNWLTSLSIGEVVSKYPIE- 119

Query: 139 GLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELS 198
            L       AP  ++ + ++  G    L       S++Y  A+ ++S+V I   GD  +S
Sbjct: 120 -LHGSVAMLAPDNYRLVTAYFTGWLMLLGNCVMNASIQYAGARLIISLVTI--SGDSLIS 176

Query: 199 SSK----TFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDS 254
                  T  VY   I  T I+ S     + ++ TV I   L  VAF+ +L +       
Sbjct: 177 EDNLIIWTVLVYFLCITITGIINSNFARYLEIINTVCIYWILYAVAFIDILLLMFHYG-- 234

Query: 255 MTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLPIV-WVIGAFDSTIHMSEEAKNASKAVP 312
            +F    + F +F N  S +   +  F+ G      + +  F     +S+E +   K +P
Sbjct: 235 -SFRPFLYAFFHFDNKLSGYSSAVLSFMVGGFQQSNFTLQGFSLLPALSDETREPEKDIP 293

Query: 313 VDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSL 372
             +  S+ V  + G   ++ I   + P+   +++ +    +  L+F    +   +++  +
Sbjct: 294 KGMSQSVLVSTICGIIYLIPILLVI-PEPEEIMNDSRVMEIV-LIFTKSTRSKIVSYFQV 351

Query: 373 IAVCQYVM--GASILTAISRQIWAFARDDGLPFS-FWIKKVNKSLSS-PIRATWVGAFAA 428
           + +   ++  G   +T  SR +++ +RD GLP+S  W      S S  P  A ++    +
Sbjct: 352 LLILGNLLFSGIGSITTSSRAVYSMSRDHGLPYSDLWSYVSPDSQSQVPRYAVYLSMGIS 411

Query: 429 IMIGLLTLAGPVASSALFSMYVGANYL----AWMMPNLLRMLFGKN-IFNPGVFYMGKFW 483
            + GLL    P  S   ++ ++GA+ L    A  +  +  ML G+  I   GV    +  
Sbjct: 412 YIFGLL----PFISGNAYNSFIGASVLCLCSASSIAIICVMLTGRRGIKGAGVKIRYRLG 467

Query: 484 SPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFL 521
            P+  +V +   L+   + M  T P+ I  ++MNYTFL
Sbjct: 468 WPVDVFVLLWLGLVMFCMCMPVTVPVTI--NTMNYTFL 503

>CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa]
           {ON} highly similar to uniprot|P36029 Saccharomyces
           cerevisiae YKL174c
          Length = 621

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 121/539 (22%), Positives = 212/539 (39%), Gaps = 60/539 (11%)

Query: 48  NYINAKTAYDDVELLAEIGYKQELSRH-FSTIQVFGIAFSIMGLLPSIASILTIA-LPGG 105
           +Y+      D+ E +    YKQEL +   S   V G+ F +M  +  + + + I  L GG
Sbjct: 34  HYVQEDEVTDEPEEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGG 93

Query: 106 MVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNS 165
            +S + G+ I G+ I     ++ E+ S  P    L       APP+ K I S+  G    
Sbjct: 94  PLSIMLGFFISGILIWFSSLSLGEIVSKFPME--LHVGSAMIAPPRLKLICSWFTG---W 148

Query: 166 LALVAG---LCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATA 222
           L L+       S+ +  AQ  +S++ +  +   EL S          IL TVI+  M   
Sbjct: 149 LMLIGNWTMSTSITFAGAQLTISLILMANN---ELISETHL------ILFTVIVFYMVVT 199

Query: 223 AVSVLQTVSIVINLSLVAFLIVL---------------PIGVANNDSMTFNGPGFIFANF 267
            V        ++NL    F+ ++                I +       F    +   +F
Sbjct: 200 LVG-------LVNLKFARFIEIINKVCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHF 252

Query: 268 QNN-SSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLG 326
            N+ S +      FL G     + +  F     +++E K   K +P  + T++ +    G
Sbjct: 253 DNSMSGYSSAFLSFLIGFQQSNFTLQGFSMLPALADEVKKPEKDIPRGMSTAVLLSTFSG 312

Query: 327 FCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASIL 385
              ++ I   + PDI  +       P+  +            F+ L+ +   +  G   +
Sbjct: 313 LIFLLPIMLIL-PDIETIFSNHKVLPIVTIFTKSTHSMVVSVFLVLLILGNLFFSGIGSI 371

Query: 386 TAISRQIWAFARDDGLP-FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASS 443
           T  SR +++F+RD  +P +  W      S S  P  +  +    +  +GLL L     S+
Sbjct: 372 TTSSRAVYSFSRDHAIPRYDLWTFVPPDSQSRVPKYSILLSMGISYFLGLLAL----IST 427

Query: 444 ALFSMYVGANYL----AWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCI 499
           A F+ ++GA  L    A  +P +L +  G+         +   +   IN  S+++ LL +
Sbjct: 428 AAFNAFIGAAVLCLCSATFIPLVLVLCTGRRSIKHAPVKIRYKFGWFINIASVLWLLLVM 487

Query: 500 VLMMLPTN-PINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTP 557
           V +  PT  P+ + G  MNY  +       G  I +  +    F  P   L+D   N P
Sbjct: 488 VSVCFPTQLPVTVKG--MNYAIVVYVLCLIGITILYFKWGKYNFRLP---LSDDAKNNP 541

>Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C
           (BIO5) - transmembrane regulator of KAPA/DAPA transport
           [contig 159] FULL
          Length = 558

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 107/527 (20%), Positives = 211/527 (40%), Gaps = 87/527 (16%)

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMS 128
           +LS++F  + + GIAFS+      ++S L + +  GG +  ++G +I   F L  G +++
Sbjct: 21  KLSKNFGWLSLLGIAFSLTNSWLGVSSSLVVGISSGGPLLIIYGLIIGVFFTLMCGWSLA 80

Query: 129 ELASAIPTSGG---------------------------------LXXXXXXXAPPKFKAI 155
           E +S +P S G                                 +       + P+ K  
Sbjct: 81  EFSSLLPNSSGASFWVLKMLETVEKAKRNGLDPEVLEDASIGDTVDRGTCEISSPERKLE 140

Query: 156 LSFLIGN-------SNSLALVAGL----------CSVEYGLAQEVLSIVAIWKDGDFELS 198
           L     N         S AL  GL           SV   LA  +L + ++  + ++ L 
Sbjct: 141 LMCTANNGEATSTIQRSTALAVGLINYFGAIFTTSSVFSSLAISILGVHSLLNE-EYTLK 199

Query: 199 SSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGV---ANNDSM 255
               F VY   +   + LT ++  ++ +       + +SL+ +++   + +   ++N  +
Sbjct: 200 HWHVFVVYEVLV---IFLTLVSCWSLILPALSKFGLGMSLITYMLTFIVSLVCRSSNTEV 256

Query: 256 TFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNAS--KAVPV 313
            +  P  IF  F+N + W      F+ G +  +W     DS  HM +E    +  K VP 
Sbjct: 257 AWPKPSMIFGEFKNTTGWKSSQMAFIVGLINPLWAFAGIDSATHMVDEVGYTASMKLVPR 316

Query: 314 DILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLI 373
            I+ +I + ++  F   + +  C+  D   L D     P+ +L +   G +    F+   
Sbjct: 317 VIIGTILIGFVTSFTYAIGMFFCI-TDPAKLSDAVL--PILELYYQATGNKNLSVFLQCC 373

Query: 374 AVCQYVM-GASILTAISRQIWAFARDDGL-----PFSFWIKK----VNKSLSSPIRATWV 423
            +   +  G + +T  SR +W+  RD         +S  I K    VN +L +P+ A + 
Sbjct: 374 CIVSGITCGVASVTWQSRILWSLGRDFSTLELRQTYSKKILKFFGVVNPTLKTPLNAHFF 433

Query: 424 GAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGV------- 476
                 +IG + +    A +A+ +  +    L++ +P L+  + G+  F   +       
Sbjct: 434 SQLLVAIIGCIFMGSSTAFNAIITACITLLLLSYAIPCLILFMVGRRRFFKRIKKQLTES 493

Query: 477 ------FYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMN 517
                  + G     I N ++I++ L C+V +  P   + ++  +MN
Sbjct: 494 GISGVSSFAGSRIGAIPNVLTILWTLFCLVFLSFPYT-LPVSAGNMN 539

>KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 549

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 115/519 (22%), Positives = 227/519 (43%), Gaps = 28/519 (5%)

Query: 53  KTAYDDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGMVSFV 110
           + A ++ E +    Y+Q+L R F S   V G+ F +M  +  +++ ++I L  GG ++ V
Sbjct: 31  QDADEEEEEVQRFKYEQQLDRSFLSKSSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIV 90

Query: 111 WGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVA 170
            G+LI G+       ++ E+ S  P    L       A  KFK   S+  G    L    
Sbjct: 91  IGFLINGIATWLCSLSLGEIVSRFPIE--LHGGSAMLARQKFKLACSWFTGWLMLLGNWT 148

Query: 171 GLCSVEYGLAQEVLSIVAIWKD---GDFELSSSKTFAVYCAAILATVILTSMATAAVSVL 227
              S+ +  AQ ++S+V +  D   G+  +  +   A Y    +  +I    A      +
Sbjct: 149 MSTSITFAGAQLLVSLVTMTNDKLIGENYIVVTTVLAFYLIVTIVGLINLKFA----GFI 204

Query: 228 QTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLP 286
           +TV+ V    +V  +I + I +    S  +    +  A+F N+ S +      F+ G   
Sbjct: 205 ETVNKVCVYWIVYAVIFIDILLLLFHSGKYRSLKYALAHFDNSFSGYSSAALSFIIGFQQ 264

Query: 287 IVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLD 346
             + +  F     +++E K + + +P  + T++    + G   ++ I   + PD   +++
Sbjct: 265 SSFTLQGFSMLPALADEVKESERDIPKGMSTAVLTSTVTGVVFLLPIMLIL-PDTQTIIN 323

Query: 347 TAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM--GASILTAISRQIWAFARDDGLPFS 404
                P+A L+F        ++   +I +   ++  G   +T  SR +++ +RD  LP+S
Sbjct: 324 NPKVMPIA-LIFTQSTHSIFVSLFLVIMILGNLLFSGIGSVTTSSRAVYSMSRDMALPYS 382

Query: 405 FWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMMP 460
            +   V+   SS  R        ++ I  L     + S+A F+ ++GA  L    A  +P
Sbjct: 383 EFWSYVDP--SSKHRVPKNSILLSMGISYLLGLLALLSTAAFNAFMGAAVLCLCSATCIP 440

Query: 461 NLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTF 520
            +L ++  +         +       +N  SI++ +  +V++ +P   + +T SSMNY F
Sbjct: 441 LVLVLISRRRALRGSPIKVRYRLGWFVNIASILWLVFTMVVICIPPQ-VPVTFSSMNYAF 499

Query: 521 -LFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPD 558
            ++  F+   +++YF   ++  F+ P   L   D  T D
Sbjct: 500 VVYLLFLAAITVLYFRWGRYN-FKTP---LISEDSRTDD 534

>Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {ON}
           YKL174C - Hypothetical ORF [contig 110] PARTIAL
          Length = 549

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 105/500 (21%), Positives = 215/500 (43%), Gaps = 21/500 (4%)

Query: 57  DDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWL 114
           D+ E +    Y+Q+L R F S   + G+ F++M  +  +++ + I L  GG ++ + G+L
Sbjct: 35  DEQEEVQAFKYEQQLDRSFLSKGSIIGLGFALMSPVLGMSTTMNIGLLNGGPMTILLGFL 94

Query: 115 IFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCS 174
           I G+       ++ E+ S  P    L       AP  ++   S+  G    L       S
Sbjct: 95  INGLATWLCSLSLGEIVSRFPIE--LHGGSAMLAPYNYQLSCSWFTGWLMLLGNWTMSTS 152

Query: 175 VEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVI-LTSMATAAVSVLQTVSIV 233
           + +  AQ V+S+V +  D          F V    I+ T++ L ++  A  S ++ V+ V
Sbjct: 153 ITFAGAQLVISLVTMANDQLIGEKYIVLFTVLAFYIIVTIVGLINLRFA--SFIEAVNKV 210

Query: 234 INLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLPIVWVIG 292
               ++  +I + I +    S ++    +   +F N+ S +      F+ G     + + 
Sbjct: 211 CVYWIIYAVIFIDILLLLFHSGSYRSLKYALFHFDNSFSGYSSKALSFMIGFQQSSFTLQ 270

Query: 293 AFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQP 352
            F     +++E K   + +P  + T++    L G   ++ I   + PD   ++D     P
Sbjct: 271 GFSMLPALADEVKRPERDIPKGMFTAVLTSTLTGIVFLLPIMIIL-PDTKTIIDNPKLMP 329

Query: 353 LAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAISRQIWAFARDDGLPFSFWIKKVN 411
           +  +        +   F+ ++ +   +  G   +T  SR +++ +RD  LP+S +   V+
Sbjct: 330 IVLIFTQSTHSMFVSLFLVIMILGNLFFSGIGSITTSSRAVYSMSRDMALPYSEFWSYVD 389

Query: 412 KSLSS--PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMMPNLLRM 465
            +     P  +  +    + ++GLL L     S+A F+ ++GA  +    A  +P +L M
Sbjct: 390 PTSDHRVPKNSILLSMGISYLLGLLAL----VSTAAFNAFMGAAVMCLCSATCIPLVLVM 445

Query: 466 LFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGF 525
           +  +         +      ++N +SI++ L  +V++  P   + +T  SMNY FL    
Sbjct: 446 MSRRRALRGAPVKVRYRMGWLVNIISILWLLFTMVVICWPPK-LPVTLGSMNYAFLVYLL 504

Query: 526 VWFGSIIYFVLYKHKTFEGP 545
              G  + +  +    F+ P
Sbjct: 505 FLTGITVLYFRWGKYNFKTP 524

>KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {ON}
           Anc_1.173 YKL174C
          Length = 607

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 119/559 (21%), Positives = 233/559 (41%), Gaps = 65/559 (11%)

Query: 49  YINAKTAYDDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGM 106
           Y++      + + +    Y+QEL +   S   V G+ F +M  +  + + ++I L  GG 
Sbjct: 29  YLHEDEDSVNSDTVEHFKYEQELDKSLLSRSSVIGLGFGLMSPVLGMCTSMSIGLINGGP 88

Query: 107 VSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSL 166
           ++ + G+++ G+ I     ++ E+ S  P    +       AP KFK + S+  G    L
Sbjct: 89  LTIMLGFILSGISIWFCSLSLGEIISKFPME--MHVASAMLAPKKFKLLCSWYTG---WL 143

Query: 167 ALVAG---LCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAA 223
            L+       S+ +  AQ  +S+  +    D  L S + F  Y   +   V+        
Sbjct: 144 MLIGNWTMSTSITFAGAQLTISLFLM---KDQYLISEEHFIFYTVIVFYLVV-------- 192

Query: 224 VSVLQTVSIVINLSLVAFLIVL---------------PIGVANNDSMTFNGPGFIFANFQ 268
                TV  +INL    F+ ++                I +      T+    +   +F 
Sbjct: 193 -----TVVGLINLKFARFIEIINKVCVYWIIYAIIFIDILLLIFHKGTYRSLKYALFHFD 247

Query: 269 NNSS-WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGF 327
           N+ S + + +  F+ G     + +  F     +++E K   + +P  +  S+ +    G 
Sbjct: 248 NSRSGYSNVLISFIIGFQQSNFTLQGFSMLPALADEVKKPERDIPRGMSISVLISTFSGI 307

Query: 328 CIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILT 386
             ++ I   + PD++ +       P+  +            F+ L+ +   +  G   +T
Sbjct: 308 IFLLPIMIIL-PDLSTIFTDHKVLPIVNIFIQSTDSMIVSFFLVLLILGNLFFSGIGSIT 366

Query: 387 AISRQIWAFARDDGLP-FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSA 444
           A SR +++F+RD  +P +  WI    +S S  P  +  +    + ++G+L L     S+A
Sbjct: 367 ASSRTVYSFSRDQAIPYYDHWIFVKPESESKVPKNSVLLSMAISYVLGILAL----FSTA 422

Query: 445 LFSMYVGANYL----AWMMPNLLRMLFGKN--IFNPGVFYMGKF-WSPIINWVSIIFQLL 497
            F+ ++GA  L    A  +P L+ +LFG+   + N  +    K  W   IN +SI++ LL
Sbjct: 423 AFNAFIGAAVLCLCSATCIP-LILILFGRRRILKNAPIKIRYKLGWG--INIISILWLLL 479

Query: 498 CIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGP----KSNLTDSD 553
            +  + LP   I +T  +MNY  +   F        +V +  + F+ P    + +L DS 
Sbjct: 480 SMFSVCLPVQ-IPVTFQTMNYALMVYVFCLICVTFLYVKWGKRNFKLPLAEHQYDLLDST 538

Query: 554 LNTPDGSIEHISSQTFEKQ 572
            +    S +  S Q  +++
Sbjct: 539 TDATSDSYQLESQQAKKEE 557

>Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346)
           [1671 bp, 556 aa] {ON} ANNOTATED BY YGOB -
          Length = 556

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 89/404 (22%), Positives = 167/404 (41%), Gaps = 38/404 (9%)

Query: 152 FKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAIL 211
           F   L+  +G  N    V    SV   LA  +L + ++     +EL     F VY    L
Sbjct: 152 FLTSLALAVGLLNYFGAVFTTASVFSSLALSILGVYSL-LHASYELKHWHVFVVY---EL 207

Query: 212 ATVILTSMA--TAAVSVLQTVSIVINL--SLVAFLIVLPIGVANNDSMTFNGPGFIFANF 267
              +LT +   +  +  L    + I+L   L+ F+I L +  +N   +++     IF  F
Sbjct: 208 LNFLLTILGCWSKILPALSRFGLYISLFTYLITFVISL-VSRSNYSDISWPKSSDIFGQF 266

Query: 268 QNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEA--KNASKAVPVDILTSITVCWLL 325
           +N + W      F+ G +  +W     DS  HM +E   K ++  VP  IL++I + +L 
Sbjct: 267 RNTTGWSSSGMAFVVGLINPLWAFAGIDSATHMVDEVGYKASTTLVPQAILSTIIIGFLT 326

Query: 326 GFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM-GASI 384
            F   + +  C+  D   + ++    P+ ++ +   G +     M    +    + G + 
Sbjct: 327 SFTYAIGMFFCV-TDTEKVTESIL--PILEIYYQATGNRNLSVLMQCCCILTGALCGIAS 383

Query: 385 LTAISRQIWAFARD-----DGLPFSF----WIKKVNKSLSSPIRATWVGAFAAIMIGLLT 435
           +T  SR +W+  +D        P       +   VN  L +P+ A         +IG + 
Sbjct: 384 VTWQSRILWSLGKDFSQVTTTRPVCKKTMGFFGTVNSKLRAPLNAHLFSQLCVAIIGCIF 443

Query: 436 LAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIF-------------NPGVFYMGKF 482
           +    A +A+ S  +    L + +P L+ +L GK  F             N G   +   
Sbjct: 444 MGSSTAFNAIISACITLLLLTYAVPCLIVLLIGKREFYERAKSKLNVLGVNLGRVPVCSK 503

Query: 483 WSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFV 526
              I N ++I++ L C++ +  P + + ++ ++MNY  +  G V
Sbjct: 504 IGQIPNVLTILWALFCLIFLSFPYS-LPVSANNMNYVTVVYGAV 546

>Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {ON}
           YNR056C (REAL)
          Length = 532

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 104/513 (20%), Positives = 203/513 (39%), Gaps = 74/513 (14%)

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMS 128
           +  +HF+   + GIAFS+      I++ + + +  GG +  ++G +I   F L  G ++ 
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFTLMCGISLG 69

Query: 129 ELASAIPTSGG--------LXXXXXXXAPPKFKAI------------------------- 155
           + AS +P S G        L         P ++                           
Sbjct: 70  DFASILPNSCGGSFWVLKMLEREPATLKTPDYEDASDDDEEVFLETYCQTSNVEISSRLQ 129

Query: 156 --LSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILAT 213
              S ++G  N    +    SV   L+   + I  +    ++EL     F  Y   I AT
Sbjct: 130 KGTSMVVGLLNYFGAIFTTASVCSSLSMSCIGIHKLLHP-EYELKHWHVFVGY-QCINAT 187

Query: 214 VILTSMATAAVSVLQTVSIVINL-SLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSS 272
           + + ++ ++ +  +    +  +L S     I+  +  +NN   ++     IF NF N + 
Sbjct: 188 LTVFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTVDSWPKASNIFGNFDNQTG 247

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKA--VPVDILTSITVCWLLGFCIV 330
           W      F+ G +  +W     DS  HM +E   +     VP  I+T+I V ++  F   
Sbjct: 248 WHSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIVVGFITSFIYC 307

Query: 331 VTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAIS 389
           V +  C+  D   ++++    P+ ++ +   G +    F+  + +   YV G +  T  S
Sbjct: 308 VGLFFCI-TDKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGYVAGIASGTWQS 364

Query: 390 RQIWAFARDDGLPFSFWIKKVNKSL----------SSPIRATWVGAFAAIMIGLLTLAGP 439
           R + ++ +    PF       NKSL           SP+ A ++      +IG + +   
Sbjct: 365 RILQSYGKSYA-PFYKEGSLGNKSLKKLATLTPGFKSPLYAHFLSQICVTIIGCIFMGSS 423

Query: 440 VASSALFSMYVGANYLAWMMPNLLRML------FGKNIFN-------PGVFYMGKFWSPI 486
            A +A+ +  +    +++ +P+ + +       F   I N       P    M    S I
Sbjct: 424 TAFNAIITACITLLLMSYAVPSFIFVFVVNKENFTSRIENEVNGISRPKTRRM----SII 479

Query: 487 INWVSIIFQLLCIVLMMLPTNPINITGSSMNYT 519
            + + I++ L C++ +  P   + +T  +MNYT
Sbjct: 480 PHIICILWTLFCLIFLSFPYT-LPVTAGNMNYT 511

>Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {ON}
           YNR056C (REAL)
          Length = 531

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 105/513 (20%), Positives = 202/513 (39%), Gaps = 74/513 (14%)

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMS 128
           +  +HF+   + GIAFS+      I++ + + +  GG +  ++G +I   F L  G ++ 
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCGISLG 69

Query: 129 ELASAIPTSGG--------LXXXXXXXAPP---------------------------KFK 153
           + AS +P S G        L         P                           K +
Sbjct: 70  DFASMLPNSCGGSFWVLKMLEQKSATLKTPDYEDTSDDDEEVFLENYCQTANVEVSSKVQ 129

Query: 154 AILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILAT 213
            + S ++G  N    +    S+   L+   + I  +    D+EL     F  Y   I A 
Sbjct: 130 RVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHP-DYELKHWHIFVGY-QCINAI 187

Query: 214 VILTSMATAAVSVLQTVSIVINL-SLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSS 272
           + L ++ ++ +  +    +  +L S     I+  +  +NN    +     IF +F N + 
Sbjct: 188 LTLFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTIDAWPKASNIFGSFDNQTG 247

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKA--VPVDILTSITVCWLLGFCIV 330
           W      F+ G +  +W     DS  HM +E   +     VP  I+T+I V ++  F   
Sbjct: 248 WNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVGFITSFIYC 307

Query: 331 VTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAIS 389
           V +  C+  D   ++++    P+ ++ +   G +    F+  + +   +V G +  T  S
Sbjct: 308 VGLFFCI-TDKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFVAGIASGTWQS 364

Query: 390 RQIWAFARDDGLPFSFWIKKVNKSL----------SSPIRATWVGAFAAIMIGLLTLAGP 439
           R + +F +    PF       NKSL           SP+ A ++      +IG + +   
Sbjct: 365 RILQSFGKSYA-PFYKEDSLGNKSLKRLAMLTPGFKSPLYAHFLSQICVTVIGCIFMGSS 423

Query: 440 VASSALFSMYVGANYLAWMMPNLL------RMLFGKNIFN-------PGVFYMGKFWSPI 486
            A +A+ +  +    +++ +P+ +      +  F   I N       P    M K    I
Sbjct: 424 TAFNAIITACITLLLMSYAVPSFIFVFVVDKEKFIHRIGNDVSCISRPNRRRMSK----I 479

Query: 487 INWVSIIFQLLCIVLMMLPTNPINITGSSMNYT 519
            + + I++ L C+V +  P   + +T  +MNYT
Sbjct: 480 PHIICILWALFCLVFLSFPYT-LPVTAGNMNYT 511

>KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 560

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 100/493 (20%), Positives = 212/493 (43%), Gaps = 40/493 (8%)

Query: 57  DDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWL 114
           D+V+   E  Y Q+L ++  S   V G+ F +M  +  +++ ++I L  GG  S ++G+L
Sbjct: 70  DEVK---EFTYVQQLDKNLLSRTSVIGLGFGLMSPVLGMSTTMSIGLLNGGSPSIIFGYL 126

Query: 115 IFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCS 174
           I G+       ++SE+ S  P    L       AP + +  +S+  G            S
Sbjct: 127 ICGIMTWISSLSLSEIVSKYPIE--LHGAAAMLAPGRLRLRMSWYCGWLMLFGSWTMSTS 184

Query: 175 VEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVI 234
           + +  AQ ++S++ +  +    L  S+   ++   ++  +I+T +    +     +  + 
Sbjct: 185 ITFAGAQLIISLLTMTNE---SLIDSRWLTLW-TVLMFYLIVTVVGVINLKFSSFIETIN 240

Query: 235 NLSLVAFLIVLPIGVANNDSMTFNGPGF--IFANFQNNSSWPD--CIQFFLCGSLPIVWV 290
            + +   L  +            N   F  +F  F N+ S      + F + G     + 
Sbjct: 241 KVCVYWILYAILFTSTLLLLFQPNHRSFKDVFTKFDNSLSGYSSMALSFLIGGFQQSNFT 300

Query: 291 IGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFG 350
              F     +S+E +   K +P  +  S+ +  + G   ++ +   + PD++ +++    
Sbjct: 301 FQGFAMLSALSDETEKPEKDIPYSMTRSVIISLVSGLFFLIPMMLIL-PDVSEVMNHEGV 359

Query: 351 QPLAQLLFNVLGKQWAIAFMSLIAVCQYVM--GASILTAISRQIWAFARDDGLPFSFWIK 408
            P+  L+F    K   ++   ++ +   ++  G   +T  SR +++ +RD G+P+     
Sbjct: 360 MPIV-LIFTKSTKSLFVSIFLVLLILGNLLFSGIGSVTTSSRALYSLSRDRGIPYHHLWT 418

Query: 409 KVNKSLSS--PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMMPNL 462
            V+ +  S  P  +  +    + ++ LL L     S+A F+ +VG   L    A M+P L
Sbjct: 419 YVDPASESKVPKYSVMLSMGVSYVLALLAL----ISTAAFNAFVGCAVLCLCSASMLPIL 474

Query: 463 LRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLF 522
           L +   + +     F +      I N +++I+ L  +V++ LP   + +T  SMNY+   
Sbjct: 475 LSLYHRRKLVKGSAFRIKYRLGYITNCLTVIWLLFTMVIISLP-QKVPVTFRSMNYS--- 530

Query: 523 TGFVWFGSIIYFV 535
                  S++YF+
Sbjct: 531 -------SVVYFL 536

>YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON}
           BIO5Putative transmembrane protein involved in the
           biotin biosynthesis pathway; responsible for uptake of
           7-keto 8-aminopelargonic acid; BIO5 is in a cluster of 3
           genes (BIO3, BIO4, and BIO5) that mediate biotin
           synthesis
          Length = 561

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 102/513 (19%), Positives = 201/513 (39%), Gaps = 74/513 (14%)

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMS 128
           +  +HF+   + GIAFS+      I++ + + +  GG +  ++G +I   F L  G ++ 
Sbjct: 40  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCGISLG 99

Query: 129 ELASAIPTSGG--------LXXXXXXXAPP---------------------------KFK 153
           + A+ +P S G        L         P                           KF+
Sbjct: 100 DFAAILPNSSGGSFWVLKMLEQESVTLKTPEYEDPSDDDEEVFLENYCQTFNVEVSSKFQ 159

Query: 154 AILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILAT 213
            + S ++G  N    +    S+   L+   + I  +    D+EL     F  Y   I A 
Sbjct: 160 KVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHP-DYELKHWHVFVGY-ECINAV 217

Query: 214 VILTSMATAAVSVLQTVSIVINL-SLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSS 272
           + L ++ +  +  +    +  +L S     I+  +  ++N    +     IF +F N + 
Sbjct: 218 LTLFNIYSTPLPYISQFGLYTSLLSFAMTFIICIVSRSDNTVDPWPKASNIFGSFDNQTG 277

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKA--VPVDILTSITVCWLLGFCIV 330
           W      F+ G +  +W     DS  HM +E   +     VP  I+T+I V ++  F   
Sbjct: 278 WNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVGFVTSFIYC 337

Query: 331 VTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAIS 389
           V +  C+  D   ++++    P+ ++ +   G +    F+  + +   +V G +  T  S
Sbjct: 338 VGLFFCI-TDQTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFVSGIASGTWQS 394

Query: 390 RQIWAFARDDGLPFSFWIKKVNKSL----------SSPIRATWVGAFAAIMIGLLTLAGP 439
           R + +F +    PF       NKSL           SP+ A ++      +IG + +   
Sbjct: 395 RILQSFGKSYA-PFYKEGSLGNKSLKKLAVLTPGFKSPLYAHFLSQICVTIIGCIFMGSS 453

Query: 440 VASSALFSMYVGANYLAWMMPNLLRMLFGKN-------------IFNPGVFYMGKFWSPI 486
            A +A+ +  +    +++ +P+ + +   K              +  P    M    S I
Sbjct: 454 TAFNAIITACITLLLMSYAVPSFIFLFVIKKEKFIHRIESDVNCVSRPNRRRM----SMI 509

Query: 487 INWVSIIFQLLCIVLMMLPTNPINITGSSMNYT 519
            + + I++ L C+V +  P   + +T  +MNYT
Sbjct: 510 PHIICILWTLFCLVFLSFPYT-LPVTAGNMNYT 541

>Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {ON}
           YNR056C (REAL)
          Length = 554

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 99/509 (19%), Positives = 203/509 (39%), Gaps = 66/509 (12%)

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFILSIGAAMS 128
           +  +HF+   + GIAFS+      I++ + + +  GG +  ++G +I   F L  G ++ 
Sbjct: 33  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCGISLG 92

Query: 129 ELASAIPTSGG--------LXXXXXXXAPP---------------------------KFK 153
           + A+ +P S G        L         P                           KF+
Sbjct: 93  DFAAILPNSSGGSFWVLKMLEQESVALKTPEYEDTSDDDGEVFLENYCQTANVEVCSKFQ 152

Query: 154 AILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILAT 213
            + S ++G  N    +    S+   L+   + I  +    D+EL     F  Y   I A 
Sbjct: 153 KVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHP-DYELKHWHVFVGY-QCINAI 210

Query: 214 VILTSMATAAVSVLQTVSIVINL-SLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSS 272
           +   ++ ++ +  +    +  +L S     I+  +  +NN    +     IF +F N + 
Sbjct: 211 LTFFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTVEKWPKASNIFGSFDNQTG 270

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKA--VPVDILTSITVCWLLGFCIV 330
           W      F+ G +  +W     DS  HM +E   +     VP  I+T+I V ++  F   
Sbjct: 271 WNSSGMAFVVGLVNPLWAFVGIDSATHMIDEVGYSRSRFLVPKVIITTIIVGFVTSFIYC 330

Query: 331 VTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAIS 389
           V +  C+  D   ++++    P+ ++ +   G +    F+  + +   ++ G +  T  S
Sbjct: 331 VGLFFCI-TDKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFISGIASGTWQS 387

Query: 390 RQIWAFARDDGLPFSFWIKKVNKSL----------SSPIRATWVGAFAAIMIGLLTLAGP 439
           R + +F +    PF       NKSL           SP+ A ++      +IG + +   
Sbjct: 388 RILQSFGKSYA-PFYNEGSLGNKSLKRLSILTPKFKSPLYAHFLSQICVTIIGCIFMGSS 446

Query: 440 VASSALFSMYVGANYLAWMMPNLL--------RMLFG-KNIFNPGVFYMGKFWSPIINWV 490
            A +A+ +  +    +++ +P+ +        + ++  +N  N       +  S + + +
Sbjct: 447 TAFNAIITACITLLLMSYAVPSFIFVFVVNKEKFIYRIENDVNGISRPNRRRMSMVPHII 506

Query: 491 SIIFQLLCIVLMMLPTNPINITGSSMNYT 519
            I++ L C+V +  P   + +T  +MNYT
Sbjct: 507 CILWTLFCLVFLSFPYT-LPVTAGNMNYT 534

>AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL174C
          Length = 575

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 111/479 (23%), Positives = 208/479 (43%), Gaps = 31/479 (6%)

Query: 57  DDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWL 114
           D+   +    Y+Q+L R   S   V G+ F +M  +  +++ L I L  GG  + +  + 
Sbjct: 36  DEPVEVEHFQYEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFA 95

Query: 115 IFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCS 174
           + G+       A+ E+ S  P    L       AP +++ + ++  G    L       S
Sbjct: 96  LCGLMSWLTALAIGEVVSKYPIE--LHGSVALLAPERYRLVAAYYTGCLILLGNWVMNAS 153

Query: 175 VEYGLAQEVLSIVAIWKDGDFELSSSK-TFAVYCAAILATVILTSMATAAVSVLQTVSIV 233
           ++Y  AQ ++S++AI  D   E + +  T AVY  +I  T ++ +   + +  + TV I 
Sbjct: 154 IQYAGAQLIISLIAISGDLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTVCIY 213

Query: 234 INLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLPIV-WVI 291
             L  V F+ VL I         F      F+NF N  S +   +  FL G L    + +
Sbjct: 214 WILYAVVFIDVLLILFHKGSFRPFLSA---FSNFDNRLSGYESMLLSFLVGGLQQSNFTL 270

Query: 292 GAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQ 351
             F     +S+E +   K +P  +  ++ V  + G   +V +   M      + D+   +
Sbjct: 271 QGFSMLPALSDETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVMPSPEEVMSDSRVME 330

Query: 352 PLAQLLFNVLGKQWAIAFMSLIAVCQYVM--GASILTAISRQIWAFARDDGLPF-SFWIK 408
            +  LLF    +   ++++ ++ +   ++  G   +T  SR +++ +RD  +P+   W  
Sbjct: 331 IV--LLFTKSTRSNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPYYELWSY 388

Query: 409 KVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMMPNLL 463
               S S  P  A ++   A+ + G+L    P+ S   ++ ++GA+ +    A  +  + 
Sbjct: 389 VSPGSQSQVPKYAVYLSMGASYLFGIL----PLISGTAYNSFIGASVMCLCSASGLAVIC 444

Query: 464 RMLFGKNIFNPGVFYMGKFWSPIINW-VSIIFQLLCIVLMMLPTNPIN--ITGSSMNYT 519
            ML G+     GV          + W VSI+  L  +++M     P+   +T SSMNYT
Sbjct: 445 VMLNGRR----GVKGAAVKIRCRLGWPVSIVVLLWLLLVMFCMCMPVTLPVTFSSMNYT 499

>SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 568

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 104/502 (20%), Positives = 217/502 (43%), Gaps = 25/502 (4%)

Query: 57  DDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWL 114
           D  E++ +  Y+Q+L +   S   V G+ F +M  +  +++ ++I L  GG ++ V G++
Sbjct: 38  DGPEVVEQFQYEQKLDKSLLSRGSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFM 97

Query: 115 IFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCS 174
           + G        ++ E+ S  P    L       A  K + + S+  G    L       S
Sbjct: 98  VVGFATWLCSLSLGEIVSKFPIE--LHGGSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTS 155

Query: 175 VEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYC-AAILATVILTSMATAAVSVLQTVSIV 233
           + +  AQ V+S++++  D      S   + V    AI+  V + ++  A    ++T++ V
Sbjct: 156 ITFAGAQLVISLISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFA--RFIETINKV 213

Query: 234 INLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLPIVWVIG 292
               ++  +I   I +    +  +    +  A+F N+ S +      F+ G     + + 
Sbjct: 214 CVYWIIYAIIFTDILLLLFHTGEYRSLKYALAHFDNSLSGYRSAALSFMIGFQQSNFTLQ 273

Query: 293 AFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQP 352
            F     +++E K   + +P  +  S+ +  L G   ++ I   + PD + +L+     P
Sbjct: 274 GFSMLPALADEVKEPERDIPRGMSLSVVLSALSGLVFLLPIMLIL-PDTSAILNNDRVMP 332

Query: 353 LAQLLFNVLGKQWAIAFMSLIAVCQYVM--GASILTAISRQIWAFARDDGLPF-SFWIKK 409
           +  L+F        ++F  ++ +   ++  G   +T  SR +++ +RD  LP+   W   
Sbjct: 333 IV-LIFTQSTHSIVVSFFLVLMILGNLLFSGIGSITTSSRAVYSMSRDHALPYHELWTYV 391

Query: 410 VNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMMPNLLR 464
              S S  P  +  +    + ++GLL L     S+A F+ +VGA  L    A  +P +L 
Sbjct: 392 EPASQSRVPKYSILLTMAISYVLGLLAL----VSTAAFNAFVGAAVLCLCSATCIPVVLV 447

Query: 465 MLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNY-TFLFT 523
           +   +         +      ++N  S+ + +  + ++ +P   + +T  +MNY  F+F 
Sbjct: 448 LASRRRALRGSPIKVRYKLGWLVNLASVAWLVFTMFVISMPPQ-VPVTLVTMNYAAFVFA 506

Query: 524 GFVWFGSIIYFVLYKHKTFEGP 545
            F+   + +YF   +H  F  P
Sbjct: 507 AFMVGITALYFCWGRHH-FRAP 527

>TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.173
           YKL174C
          Length = 647

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 96/478 (20%), Positives = 205/478 (42%), Gaps = 35/478 (7%)

Query: 67  YKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIALP-GGMVSFVWGWLIFGVFI---- 120
           Y+Q+L +   S   + G+ F +M  +  + + ++I L  GG ++ + G+++ G+F     
Sbjct: 54  YEQQLDKSLLSKSSIVGLGFGLMSPVLGMCTSMSIGLKDGGPLTILIGFMVSGIFTWFCS 113

Query: 121 LSIGAAMSELASAIPTSGGLXXXXXX--XAPPKFKAILSFLIGNSNSLALVAG---LCSV 175
           LS+G  +S+  + +  S  +            K + I S+  G    L L+       S+
Sbjct: 114 LSLGEVVSKYPNELHISSAMLSSYLTDNTLDSKLRYIASWYTG---WLMLIGNWTMSTSI 170

Query: 176 EYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVI--LTSMATAAVSVLQTVSIV 233
            +  AQ  +S++ + K      +    F V    ++ T++  +    +  +  +  + ++
Sbjct: 171 TFAGAQLTISLLLLMKSDLISETHLILFTVIVFYLVVTIVGFINLKFSRFIETINKICVI 230

Query: 234 INLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLPIVWVIG 292
                + F+ VL +      +  F    +   +F N+ S +      F+ G     + + 
Sbjct: 231 WIFYAIIFIDVLLLVF---QAGKFRSLKYALFHFDNSLSGYTSAFLSFIIGFQQSNFTLQ 287

Query: 293 AFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQ- 351
            F     +++E K   + +P  + T++ +    G   ++ I   + PD++ + +      
Sbjct: 288 GFSMLPALADEVKRPERDIPRGMSTAVLLSTFSGVVFLLPIMLIL-PDLDNIFNNKNSNL 346

Query: 352 -PLAQLLFNVLGKQWAIAFMSLIAVCQYVM-GASILTAISRQIWAFARDDGLPF-SFWIK 408
            P+  +       ++   F+    +   +  G   +T  SR +++F+RD  LP+   W  
Sbjct: 347 LPIVSIFTQSTHSKFVSVFLVFCILGNLLFSGIGSITTSSRAVYSFSRDHALPYHELWTF 406

Query: 409 KVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMMPNLL 463
             + S+S  P  + W+    +  +GLL L     S+A F+ +VGA  L    A ++P +L
Sbjct: 407 VDSDSVSKVPKYSIWLSMGVSYTLGLLAL----FSTAAFNAFVGAAVLCLCTATVIPLIL 462

Query: 464 RMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFL 521
            ++ G+         M      I+N +S+ + LL +V +  P   I +T S+MNY  +
Sbjct: 463 VLISGRRSIRNAPVKMKYKLGWIVNILSVAWLLLAMVSVCFPPQ-IPVTFSTMNYALM 519

>Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa]
           {ON} complement(159457..161325) [1869 nt, 623 aa]
          Length = 622

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 110/522 (21%), Positives = 218/522 (41%), Gaps = 45/522 (8%)

Query: 57  DDVELLAEIGYKQELSRHFSTIQV-----FGIAFSIMGLLPSIASILTIALP-GGMVSFV 110
           D VE++ +  Y+QEL +   ++       FG+   ++G+  S    ++I L  GG ++ +
Sbjct: 37  DQVEVVEQFKYEQELDKSLLSLSSVVGLGFGLMSPVLGMCTS----MSIGLKNGGPLTII 92

Query: 111 WGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVA 170
            G+L+ G+ I     ++ E+ S  P    L       AP   K I S+  G    L L+ 
Sbjct: 93  MGFLLSGISIWFCSLSLGEVVSKFPME--LHGSSALLAPDSLKLICSWYTG---WLMLIG 147

Query: 171 G---LCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVL 227
                 S+ Y  AQ  +S++ +  + D    ++  F       +   I+  +       +
Sbjct: 148 NWTMSTSITYAGAQLTISLI-LMNNSDLISEANLIFFTVIVFYMVVTIVGLVNLKFSRFI 206

Query: 228 QTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLP 286
           + ++ +  L ++  +I + I +    S  F    +   +F N+ S +   +  F+ G   
Sbjct: 207 EIINKICVLWIIYAIIFIDILLLIFHSGKFRSLKYALFHFDNHLSGYGSGVLSFIIGFQQ 266

Query: 287 IVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLD 346
             + +  F     +SEE K     +P  +  ++ +  L G   ++ I   +       +D
Sbjct: 267 SNFTLQGFSMLPALSEEVKRPENDIPRGMSNAVLLSTLSGVIFLIPILIILP-----DID 321

Query: 347 TAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-----YVMGASILTAISRQIWAFARDDGL 401
           T F       + N+  K      +S+  V       +  G   +T  SR +++F+RD G+
Sbjct: 322 TLFTGHKILPIVNIFTKSTNSTVVSIFLVLMILGNLFFSGIGSITTSSRSVYSFSRDRGI 381

Query: 402 PF-SFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL---- 455
           P+ + W      S+S  P  + W+    +  +GLL L     S+A F+ ++GA  L    
Sbjct: 382 PYHNLWTYVDPSSVSKVPKYSIWLSMAISYFLGLLAL----FSTAAFNAFIGAAVLCLCS 437

Query: 456 AWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSS 515
           A ++P +L +   + +       M      I+N +S+++ LL +V +  P   I +T  +
Sbjct: 438 ATVIPLILVLFSRRRVIRNAPVKMKYKLGWIVNIISVLWLLLSMVSVCFPPQ-IPVTFQT 496

Query: 516 MNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTP 557
           MNY  +   F      + +  +    F+ P  +    ++N P
Sbjct: 497 MNYALIVYIFCLISITVLYFKWGKYNFQLPSVD----EMNKP 534

>KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 564

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 115/542 (21%), Positives = 208/542 (38%), Gaps = 97/542 (17%)

Query: 68  KQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPG-GMVSFVWGWLIFGVFILSIGAA 126
           + +L+R++S   + G++FS+      ++S   + L G G    V+G +   V  L  G +
Sbjct: 18  EGKLARNYSWWPLIGMSFSLTNSWLGVSSSFVVGLSGAGQPIVVYGLIFAFVLTLMCGYS 77

Query: 127 MSELASAIPTSGG----------------------------------------------- 139
           +SE +  +P S G                                               
Sbjct: 78  LSEFSRLLPNSAGTSFWTFKLLEKNAPGDVEELSVTRKVSSALEISKSVDNEGKVKENSV 137

Query: 140 --LXXXXXXXAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFEL 197
             L           F+  ++  +G  N    V    S+   L   ++ I +I     FEL
Sbjct: 138 VNLSTMYSNSCTSSFQKNMAIAVGLINYFGCVFTTASIVSALVYSIMGIHSILHP-SFEL 196

Query: 198 SSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTF 257
               TF +Y    + TV LT        +    S  + +SL+++ I   + + +  +   
Sbjct: 197 KQWHTFILY---EILTVFLTVFNCNYRCLPFLSSFGLAMSLLSYAITFILCLVSRSNSIS 253

Query: 258 NGP----GFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKN--ASKAV 311
             P      IF  F NN+ W      F+   +  +W     DS  HM +E  +  A   V
Sbjct: 254 EQPWPKSEDIFYKFHNNTGWKSNGMAFVVSLINPLWSFVGIDSATHMVDEVGHVAAQVLV 313

Query: 312 PVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMS 371
           P  I+T+I + ++  F   + +  C+  D   +L++    P+  + +   G +    FM 
Sbjct: 314 PKVIITTIFIGFITSFSYSIALFYCV-RDTAAVLESI--APVVTIYYQATGNRNLAVFMQ 370

Query: 372 L-IAVCQYVMGASILTAISRQIWAFARD------DGLPFSF------WIKKVNKSLSSPI 418
               V     G +  T  SR +W+ +R+      DG+   F       I  VNK    P+
Sbjct: 371 ASTIVAGLTCGVASGTWQSRMLWSLSREMETMRPDGILSGFVTARFATIDSVNK---VPL 427

Query: 419 RATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIF------ 472
            A +      ++IG + L    A +A+ S  V    +++ +P+L+ ++ G+N F      
Sbjct: 428 YAHFFSQALVVIIGCIMLGSTKAFNAIVSAAVTLLIVSYAIPSLILLVRGRNKFIAKCER 487

Query: 473 --------NPGVFYMG-KFWSPIINWVSIIFQLLCIVLMMLP-TNPINITGSSMNYTFLF 522
                    P  + M  K W  I + +++ + L C+V++  P   P  +T S+MNY  + 
Sbjct: 488 ETANETDIVPNKYSMWLKKWGVIPHTLTVAYALFCVVMLSFPYVKP--VTSSNMNYVSVV 545

Query: 523 TG 524
            G
Sbjct: 546 YG 547

>KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {ON}
           Anc_1.173 YKL174C
          Length = 714

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 106/520 (20%), Positives = 215/520 (41%), Gaps = 40/520 (7%)

Query: 50  INAKTAYDDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL-PGGMV 107
           I+  +  ++ E++    Y+QEL +   S   + G+ F +M  +  + + + I L  GG  
Sbjct: 28  IHEDSDENEPEIVEHFKYEQELDKSLLSRSSIVGLGFGLMSPVLGMCTSMAIGLINGGPA 87

Query: 108 SFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLA 167
           + +WG+LI G+ I     ++ E+ S  P    +       AP   K I S+  G    L 
Sbjct: 88  TIMWGFLISGICIWFCSLSLGEIVSKFPME--IHVGSAMLAPASLKLISSWYTG---WLM 142

Query: 168 LVAG---LCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAI--LATVILTSMATA 222
           L+       S+ +  AQ  +S++ +  +   +L       +Y   +  L   I+  +   
Sbjct: 143 LIGNWTMSTSITFAGAQLTISLILMNNN---DLIKDPHLVLYTVIVFYLVVTIVGLINLK 199

Query: 223 AVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNNSS-WPDCIQFFL 281
               ++T++ V    ++  +I + I +       +    +   +F N+ S + + +  F+
Sbjct: 200 FARFIETINKVCVYWILYAVIFIDILLLIFHKGKYRSLKYALTHFDNSRSGYGNFVISFI 259

Query: 282 CGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDI 341
            G     + +  F     +++E +   K +P  +  ++ +    G   ++ I   + PD+
Sbjct: 260 IGFQQSNFTLQGFSMLPALADEVRVPEKDIPRGMSNAVLLSAFSGIISLLPIMIIL-PDM 318

Query: 342 NGLLDTAFGQPLAQLLFNVLGKQ-----WAIAFMSLIAVCQYVMGASILTAISRQIWAFA 396
           +  +   F       + N+  +       +   + LI    +  G   +TA SR +++F+
Sbjct: 319 DTFI---FYDGRVLPIVNIFTQSTDSVILSTLLVLLILGNLFFSGIGSITASSRSVYSFS 375

Query: 397 RDDGLP-FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANY 454
           RD  +P +  W     +S S  P  +  +    + ++GLL L     S+A F+ ++GA  
Sbjct: 376 RDHAIPGYDLWTFVKPESESKVPKNSILLSMLISYILGLLAL----FSTAAFNAFIGAAV 431

Query: 455 L----AWMMPNLLRMLFGKNIFN--PGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNP 508
           L    A  +P +L +   + I    P        W   IN  SI + LL +  + LPT  
Sbjct: 432 LCLCSATCIPLVLVLFRRRRILKSAPVKIRYKLGWG--INIFSICWLLLSMFSVCLPTR- 488

Query: 509 INITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSN 548
           I +T  +MNY  +          + +  +    F  PK++
Sbjct: 489 IPVTFKTMNYALVVYVVCLISITVLYFFWGKSNFRLPKAD 528

>SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 560

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 129/306 (42%), Gaps = 35/306 (11%)

Query: 244 VLPIGVANNDSMT-FNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSE 302
           V+ +   +ND +T +     IF+ F N + W      F+ G +  +W     DS  HM +
Sbjct: 241 VISLVCRSNDKVTPWPTKSSIFSEFSNTTGWSSSGMAFIVGLINPLWAFAGIDSATHMVD 300

Query: 303 EAKNASKA--VPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNV 360
           E  +++    VP  I+ ++ + ++  F   + +  C+  D   ++++    P+ Q+ +  
Sbjct: 301 EVGHSTSRTLVPRAIIGTVLLGFVTSFTYSIGMFYCI-TDTKSVVESIL--PILQIYYQA 357

Query: 361 LGKQWAIAFMSLIAVCQ-YVMGASILTAISRQIWAFAR-----DDGLP---FSFWIKK-- 409
            G +    F+    +    V G +  T  SR +W+ +R     D   P   F ++ K+  
Sbjct: 358 TGNRNLSIFLQCCCITSGVVCGIASGTWQSRILWSISRDFENIDTNKPRPVFRYFCKRFG 417

Query: 410 -VNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMP-NLLRMLF 467
            VN  L  P+ +         +IG + +    A +A+ +  +    L++ +P  +L ++ 
Sbjct: 418 HVNSLLKVPLTSHLFSQVIVAIIGCIFMGSTTAFNAIITACITLLLLSYAIPCTILLVVV 477

Query: 468 GKNIF--------------NPGVFYMGKFW-SPIINWVSIIFQLLCIVLMMLPTNPINIT 512
           GK  F                 +F+    W   I N  +I + L C++ +  P   + ++
Sbjct: 478 GKRQFYRRIGQELDELKLSTSSIFHSKNVWFGYIANGFTIAWALFCLIFLSFPYT-LPVS 536

Query: 513 GSSMNY 518
             +MNY
Sbjct: 537 AGNMNY 542

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 70  ELSRHFSTIQVFGIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWLIFGVFILSIGAAMS 128
           +L ++FS   + GI+FS+      ++S L + L  GG +  ++G +I   F    G ++S
Sbjct: 30  KLLKNFSWWSLIGISFSLTNSWLGVSSSLVVGLYSGGPLLIIYGLIIGLFFTFMCGWSLS 89

Query: 129 ELASAIPTSGG 139
           E +S +P S G
Sbjct: 90  EFSSLLPNSSG 100

>NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {ON}
           Anc_1.173 YKL174C
          Length = 641

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 116/541 (21%), Positives = 222/541 (41%), Gaps = 41/541 (7%)

Query: 41  SKTVDQVNYINAKTAYDDV-ELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASIL 98
            + +D ++ I  +   D+  E++    Y QEL +   S   + G+ FS+M     +++ +
Sbjct: 21  EELLDNLHTIIHEEPDDETTEVVEHFKYNQELDKSLLSRGSIVGLGFSLMSAPLGMSTSM 80

Query: 99  TIAL-PGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILS 157
            I L  GG  + +WG+LI G+ I     ++ E+ S  P    L       AP K K I S
Sbjct: 81  AIGLINGGPATIIWGFLISGICIWFCSLSLGEVVSKFPME--LHVSSAMLAPKKLKLICS 138

Query: 158 FLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILT 217
           +  G    L       S+ +  AQ  +S++ +  + D     S+ + +    I+  +++T
Sbjct: 139 WYTGWLMLLGNWTMSTSITFAGAQLTISLI-LMTNSDL---ISEKYLIGFTVIIFYLVVT 194

Query: 218 SMATAAVSVLQTVSIVINLSLVAFLIVLPIGVANNDSMTFNGP----GFIFANFQNN-SS 272
            +    +   + +   IN + V ++I   + +     +   G      +   +F N+ S 
Sbjct: 195 IVGLINLKFARFIE-TINRACVIWIIYAILFIDILLLIFHRGKYHSLKYSLFHFDNSLSG 253

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVT 332
           +   +  FL G     + +  F     +++E K   K +P  +  ++ +    G   ++ 
Sbjct: 254 YSGFLISFLIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGIVFLIP 313

Query: 333 IAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQ-YVMGASILTAISRQ 391
           I   + P+ + L       P+  +        +   F+ L+ +   +  G   +T  SR 
Sbjct: 314 IMIIL-PESDKLFTNHKILPIVNIFTQSTHSMFVSFFLLLMILGNLFFSGIGSITTSSRA 372

Query: 392 IWAFARDDGLP-FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMY 449
           +++F+RD  +P    W     +S S  P  +  +    + ++GLL L     S+A F+ +
Sbjct: 373 VYSFSRDHAIPHHETWTFVQPESQSKVPKNSILLSMAISYILGLLAL----FSTAAFNAF 428

Query: 450 VGANYL----AWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLP 505
           +GA  L    A  +P +L +   + +       +       +N VSI++ LL +V + LP
Sbjct: 429 IGAAVLCLCSATCIPLVLVLFRRRRVLRNAPVKIRYKLGWFVNIVSILWLLLSMVSVCLP 488

Query: 506 TNPINITGSSMNYTFLFTGFVWFGSIIYFVL---------YKHKTFEGPKSNLTDSDLNT 556
              I +T  SMNY  +    V+   II   L         +K    E  K N  D     
Sbjct: 489 PK-IPVTLESMNYALI----VYLLCIIIITLMYFKWGKDNFKLPLIEEEKKNQNDRTRKV 543

Query: 557 P 557
           P
Sbjct: 544 P 544

>TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 82/405 (20%), Positives = 165/405 (40%), Gaps = 39/405 (9%)

Query: 151 KFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAI 210
           K+K  L  + G  N    V    S+   L+  +L + ++    D+EL     F  Y    
Sbjct: 136 KWKKDLGIMTGLFNYAGAVFTSASICASLSLSILGVYSL-MHPDYELRHWNVFLTYELLN 194

Query: 211 LATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGVAN---NDSMTFNGPGFIFANF 267
           +A   + S A    ++ Q     + +S+V++++   I + +   N S  +     +F  F
Sbjct: 195 IAMAFVASWARWLPAISQ---FGLGISVVSYVLTFLISIISRSFNHSEQWPTGKTVFGEF 251

Query: 268 QNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEA--KNASKAVPVDILTSITVCWLL 325
            N + W      F+ G +  +W     DS  HM ++     + K VP  I+ +I + +  
Sbjct: 252 TNTTGWSSSGMAFIVGLINPLWSFAGIDSATHMVDDVGYSASRKLVPRIIIATILLGFAT 311

Query: 326 GFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFM-SLIAVCQYVMGASI 384
            F   + +  C+  D   ++ +    P+ Q+ +   G +   AFM S   +  ++ G S 
Sbjct: 312 AFPYAIVMFFCI-TDSTQVVSSIL--PILQIYYQATGNKSLSAFMQSCCIITGFICGVSS 368

Query: 385 LTAISRQIWAFARDDGL-----------PFSFWIKKVNKSLSSPIRATWVGAFAAIMIGL 433
            T  +R +W+ +R   L                I  ++ ++  P+ A  +  F   +IG 
Sbjct: 369 STWQNRILWSVSRTYHLIECDEMNAKKAQVVAKIASISPTIRIPVYAHLLSHFFVAVIGC 428

Query: 434 LTLAGPVASSALFSMYVGANYLAWMMPNLLRML------FGKNI--------FNPGVFYM 479
           + +    A +A+ +  +    L++ +P ++ +       F +NI         +  V   
Sbjct: 429 IFMGSSTAFNAIITACISILLLSYAVPCIIMVFVVGKKNFYRNIASEQQALGLSHQVEES 488

Query: 480 GKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTG 524
              W  + N ++I + L C++ +  P   I +  S+MNY  +  G
Sbjct: 489 RASWYLVPNILTICWALFCLIFLSFPY-VIPVDSSNMNYVSVVYG 532

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 75  FSTIQVFGIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWLIFGVFILSIGAAMSELASA 133
           F+ + + GIAFS+      ++S L   L  GG V  ++G +I  VF +  G ++ E +S 
Sbjct: 9   FNWLSLLGIAFSLTSSWLGVSSSLVAGLYSGGPVLIIYGLIIGAVFTIMCGLSLCEFSSM 68

Query: 134 IPTSGGL 140
           +P + G+
Sbjct: 69  LPNASGV 75

>YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON}
           TPO5Protein involved in excretion of putrescine and
           spermidine; putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 618

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 108/500 (21%), Positives = 199/500 (39%), Gaps = 45/500 (9%)

Query: 45  DQVNYINAKTAYDDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL- 102
           D ++ I  +    + E      Y Q L +   S   + G+   +M  +  + + + I L 
Sbjct: 25  DNLHTIVHEDDSQENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMCTSMAIGLI 84

Query: 103 PGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGN 162
            GG ++ + G+LI GV I     ++ E+ S  P    L       AP K K + S+  G 
Sbjct: 85  NGGPLTIMLGFLISGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLVCSWYTG- 141

Query: 163 SNSLALVAG---LCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVI-LTS 218
              L L+       S+ +  AQ  +S++ +        +    + V    ++ TV+ L +
Sbjct: 142 --WLMLIGNWTMSTSITFAGAQLTISLILMTNSNLISEAHLIFYTVIVFYLVVTVVGLVN 199

Query: 219 MATAA-VSVLQTVSI----VINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SS 272
           +  A  +  +  V +       + +   L+V   G        F    +   +F NN S 
Sbjct: 200 LKFARFIETINKVCVYWIIYAIIFIDILLLVFHKG-------KFRSLKYALFHFDNNLSG 252

Query: 273 WPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVT 332
           +      F+ G     + +  F     +++E K   K +P  +  ++ +    G   ++ 
Sbjct: 253 YKSAFLSFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGVIFLIP 312

Query: 333 IAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM-----GASILTA 387
           I   + PD N LL   F       + N+  K      +S   V   +      G   +T 
Sbjct: 313 IMLIL-PD-NDLL---FTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITT 367

Query: 388 ISRQIWAFARDDGLP-FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSAL 445
            SR +++F+RD  +P +  W      S S  P  +  +    +  +GLL L     S+A 
Sbjct: 368 SSRAVYSFSRDQAIPYYDKWTYVEPDSQSKVPKNSVVLSMIISYFLGLLAL----ISTAA 423

Query: 446 FSMYVGANYL----AWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVL 501
           F+ ++GA  L    A  +P +L +   +         +   +   IN VSI++ LL +V 
Sbjct: 424 FNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIVWLLLSMVS 483

Query: 502 MMLPTNPINITGSSMNYTFL 521
           + LPT  + +T  +MNY  +
Sbjct: 484 VCLPTQ-VPVTFKTMNYALM 502

>Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {ON}
           YKL174C (REAL)
          Length = 616

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 100/482 (20%), Positives = 191/482 (39%), Gaps = 43/482 (8%)

Query: 67  YKQELSRHFSTIQVF-----------GIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWL 114
           ++ E + HF+  QV            G+   +M  +  + + + I L  GG ++ + G+L
Sbjct: 37  HENEEAEHFNYDQVLDKSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFL 96

Query: 115 IFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAG--- 171
           I G+       ++ E+ S  P    L       AP   K + S+  G    L L+     
Sbjct: 97  ISGMCTWFSSLSLGEIVSKFPME--LHVGSAMLAPKNLKLVCSWYTG---WLMLIGNWTM 151

Query: 172 LCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVS 231
             S+ +  AQ  +S++ +  + D    +   F       L   ++  +       ++T++
Sbjct: 152 STSITFAGAQLTISLI-LMTNSDLISEAHLIFYTVIVFYLVVTVVGLVNLKFARFIETIN 210

Query: 232 IVINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLPIVWV 290
            V    +V  +I + I +       F    +   +F NN S +      F+ G     + 
Sbjct: 211 KVCVYWIVYAIIFIDILLLIFHKGKFRSLKYALFHFDNNLSGYKSAFLSFIIGFQQSNFT 270

Query: 291 IGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFG 350
           +  F     +++E K   + +P  +  ++ +    G   ++ I   + PD + L      
Sbjct: 271 LQGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLIL-PDNDALFTNHKV 329

Query: 351 QPLAQLLFNVLGKQWAIAFMSLIAVCQYVM-----GASILTAISRQIWAFARDDGLP-FS 404
            P+     N+  K      +S   V   +      G   +T  SR +++F+RD  +P + 
Sbjct: 330 LPIV----NIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDHAIPHYG 385

Query: 405 FWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMM 459
            W      S S  P  +  +    +  +GLL L     S+A F+ ++GA  L    A  +
Sbjct: 386 RWTYVEPDSQSKVPKNSVILSMIISYFLGLLALI----STAAFNAFIGAAVLCLCSATFI 441

Query: 460 PNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYT 519
           P +L +L  +         +   +   IN VSI + LL +V + LPT  + +T  +MNY 
Sbjct: 442 PLVLVLLTRRRAIRSAPVKIRYKFGWFINIVSIAWVLLSMVSVCLPTQ-VPVTFKTMNYA 500

Query: 520 FL 521
            +
Sbjct: 501 LM 502

>Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 105/501 (20%), Positives = 198/501 (39%), Gaps = 53/501 (10%)

Query: 45  DQVNYINAKTAYDDVELLAEIGYKQELSRHF-STIQVFGIAFSIMGLLPSIASILTIAL- 102
           D ++ I  +      E      Y Q L +   S   + G+   +M  +  + + + I L 
Sbjct: 25  DNLHTIVHEDDNQHNEEAEHFNYDQVLDKSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLI 84

Query: 103 PGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGN 162
            GG  + + G+LI GV I     ++ E+ S  P    L       AP   K + S+  G 
Sbjct: 85  NGGPFTIMLGFLISGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPETLKLVCSWYTG- 141

Query: 163 SNSLALVAG---LCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSM 219
              L L+       S+ +  AQ  +S++ +  + D     S+   ++   I+  +++T++
Sbjct: 142 --WLMLIGNWTMSTSITFAGAQLTISLI-LMTNSDL---ISEAHLIFYTVIVFYLVVTAV 195

Query: 220 ATAAVSVLQTVSIVINLSL----------VAFLIVLPIGVANNDSMTFNGPGFIFANFQN 269
               +   + + I+  + +             L+V   G        F    +   +F N
Sbjct: 196 GLVNLKFARFIEIINKVCVYWIIYAIIFIDILLLVFHKG-------KFRSLKYALFHFDN 248

Query: 270 N-SSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFC 328
           N S +      F+ G     + +  F     +++E K   + +P  +  ++ +    G  
Sbjct: 249 NLSGYKSAFISFIIGFQQSNFTLQGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVI 308

Query: 329 IVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVM-----GAS 383
            ++ I   + PD N LL   F       + N+  K      +S   V   +      G  
Sbjct: 309 FLIPIMIIL-PD-NDLL---FTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIG 363

Query: 384 ILTAISRQIWAFARDDGLP-FSFWIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVA 441
            +T  SR +++F+RD  +P +  W      S S  P  +  +    +  +GLL L     
Sbjct: 364 SITTSSRAVYSFSRDQAIPYYDKWTYVEPDSQSKVPKNSVILSMIISYFLGLLAL----I 419

Query: 442 SSALFSMYVGANYL----AWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLL 497
           S+A F+ ++GA  L    A  +P +L +   +         +   +   IN VSI++ LL
Sbjct: 420 STAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIVWLLL 479

Query: 498 CIVLMMLPTNPINITGSSMNY 518
            +V + LPT  + +T  +MNY
Sbjct: 480 SMVSVCLPTQ-LPVTFKTMNY 499

>Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 104/481 (21%), Positives = 194/481 (40%), Gaps = 43/481 (8%)

Query: 68  KQELSRHFSTIQVF-----------GIAFSIMGLLPSIASILTIAL-PGGMVSFVWGWLI 115
           + E + HF+  QV            G+   +M  +  +++ + I L  GG ++ + G+LI
Sbjct: 38  ENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMSTSMAIGLINGGPLTIMLGFLI 97

Query: 116 FGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLALVAG---L 172
            GV I     ++ E+ S  P    L       AP K K   S+  G    L L+      
Sbjct: 98  SGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLACSWYTG---WLMLIGNWTMS 152

Query: 173 CSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSI 232
            S+ +  AQ  +S++ +  + +    +  TF       L   I+  +       ++T++ 
Sbjct: 153 TSITFAGAQLTISLI-LMTNSNLISEAHLTFYTVIVFYLVVTIVGLVNLKFARFIETINK 211

Query: 233 VINLSLVAFLIVLPIGVANNDSMTFNGPGFIFANFQNN-SSWPDCIQFFLCGSLPIVWVI 291
           V    ++  +I + I +       F    +   +F N+ S +      F+ G     + +
Sbjct: 212 VCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSLSGYKSAFLSFIIGFQQSNFTL 271

Query: 292 GAFDSTIHMSEEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQ 351
             F     +++E K   + +P  +  ++ +    G   ++ I   + PD N LL   F  
Sbjct: 272 QGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMLIL-PD-NDLL---FTN 326

Query: 352 PLAQLLFNVLGKQWAIAFMSLIAVCQYVM-----GASILTAISRQIWAFARDDGLP-FSF 405
                + N+  K  A   +S   V   +      G   +T  SR +++F+RD  +P +  
Sbjct: 327 HKVLPIVNIFTKSTASVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDRAIPHYEK 386

Query: 406 WIKKVNKSLSS-PIRATWVGAFAAIMIGLLTLAGPVASSALFSMYVGANYL----AWMMP 460
           W      S S  P  +  +    +  +GLL L     S+A F+ ++GA  L    A  +P
Sbjct: 387 WTYVEPDSQSKVPKNSVILSMVISYFLGLLALI----STAAFNAFIGAAVLCLCSATFIP 442

Query: 461 NLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTF 520
            +L +   +         +   +   IN VSI + LL +V + LPT  + +T  +MNY  
Sbjct: 443 LVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIAWLLLSMVSVCLPTQ-VPVTFKTMNYAL 501

Query: 521 L 521
           +
Sbjct: 502 M 502

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 51/114 (44%), Gaps = 10/114 (8%)

Query: 71  LSRHFST--IQVFGIAFSI-MGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAM 127
           L RH     +Q+  I  SI  GL       L I   GG  + V  W++ G  + S+  A+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRI---GGPAAVVIAWIMTGSMVYSVVQAL 145

Query: 128 SELASAIPTSGGLXXXXXXXAPPKFKAILS--FLIGN--SNSLALVAGLCSVEY 177
            ELA A+P SG           P F   ++  +LIGN  +  L L+A   +V Y
Sbjct: 146 GELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNY 199

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 61/149 (40%), Gaps = 16/149 (10%)

Query: 9   QPSKVDVILLQPALTNNTSVRVQQISSIKT----SRSKTVDQVNYINAKTAYDDVELLAE 64
           +P++     L+ A +   S   +  S  K     S +K ++ ++  + +    D      
Sbjct: 16  KPAETQPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQDAR---- 71

Query: 65  IGYKQELS-RHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSI 123
             Y ++LS RH  T+ V G   +  GL  +  + LT   PG   S V  W+I    + +I
Sbjct: 72  --YNKDLSVRHLLTLAVGGAIGT--GLFVNSGAALTTGGPG---SLVIDWVIISTCLFTI 124

Query: 124 GAAMSELASAIPTSGGLXXXXXXXAPPKF 152
             A+ EL+S  P  GG          P F
Sbjct: 125 VNALGELSSTFPVVGGFNVYISRFVEPSF 153

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 63/148 (42%), Gaps = 21/148 (14%)

Query: 8   QQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVEL--LAEI 65
           +Q S+ D       L+   S  ++Q ++  TS  ++ D           DDVE   +   
Sbjct: 38  EQKSQTDSTF---PLSTKGSPGMKQTTNDITSSERSRDN----------DDVEQVDINNT 84

Query: 66  GYKQELS-RHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIG 124
              ++LS RH  T+ V G   +  GL  +  + L+    GG  S V  W+I G  + ++ 
Sbjct: 85  NLNKDLSVRHLLTLAVGGAIGT--GLYVNTGTALST---GGPASLVIDWVIIGTCLFTVI 139

Query: 125 AAMSELASAIPTSGGLXXXXXXXAPPKF 152
            ++ EL++A P  GG          P F
Sbjct: 140 NSLGELSAAFPVVGGFNVYGMRFVEPSF 167

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 39/87 (44%), Gaps = 6/87 (6%)

Query: 67  YKQELS-RHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGA 125
           Y ++LS RH  T+ V G   +  GL  +  S LT   PG   S V  W+I    + +I  
Sbjct: 70  YNKDLSVRHLLTLAVGGAIGT--GLFVNSGSALTTGGPG---SLVIDWVIISTCLFTIVN 124

Query: 126 AMSELASAIPTSGGLXXXXXXXAPPKF 152
           A+ EL+S  P  GG          P F
Sbjct: 125 ALGELSSTFPVVGGFNVYISRFVEPSF 151

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 19/146 (13%)

Query: 48  NYINAKTAY--DDV-------ELLAEIGYKQELSRHFST--IQVFGIAFSI-MGLLPSIA 95
           N+++    Y  DDV       E  A    +  L RH     +Q+  I  SI  GL     
Sbjct: 52  NFVDGFREYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSG 111

Query: 96  SILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAI 155
             L I   GG  + +  W++ G  + S+  A+ EL  A+P SG           P F   
Sbjct: 112 KALRI---GGPAAVILAWILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFA 168

Query: 156 LS--FLIGN--SNSLALVAGLCSVEY 177
           ++  +L+GN  +  L +VA   +V+Y
Sbjct: 169 IAYNYLVGNLVTMPLEIVAASITVDY 194

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 58  DVELLAEIGYKQELS-RHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIF 116
           D E L      ++LS RH  T+ V G   +  GL  +  S L     GG  S V GW+I 
Sbjct: 132 DEETLLATDMNKDLSVRHLLTLAVGGAIGT--GLFVNSGSSLNT---GGPASLVIGWVIV 186

Query: 117 GVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKF 152
              + ++  ++ ELA+A P  GG          P F
Sbjct: 187 STALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSF 222

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 49/123 (39%), Gaps = 20/123 (16%)

Query: 464 RMLFGKNIFNPGVFY---------MGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGS 514
           +M F   +++P +           +   WSP+I   S +  L  ++    P +P +   +
Sbjct: 68  KMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

Query: 515 SM----NYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS-IEHISSQTF 569
                   +F  T  +W        LY  +T  G K N+ +SDL   D   I+   SQ F
Sbjct: 128 QHYLRDRESFNKTAALWTR------LYASETSNGQKGNVEESDLYGIDHDLIDEFESQGF 181

Query: 570 EKQ 572
           EK 
Sbjct: 182 EKD 184

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 56/134 (41%), Gaps = 13/134 (9%)

Query: 25  NTSVRVQQISS-----IKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELS-RHFSTI 78
           N+ VRV   SS     +K    +    V       +Y  VE +      ++LS RH  T+
Sbjct: 43  NSPVRVNVSSSGNDDILKGDTKEYPRDVKATPEAASY--VEDINNTNLNKDLSVRHLLTL 100

Query: 79  QVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSG 138
            V G A      + S AS+ T    GG  S V GW+I    + ++  ++ ELA+A P  G
Sbjct: 101 AVGG-AIGTGLFVNSGASLTT----GGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVG 155

Query: 139 GLXXXXXXXAPPKF 152
           G          P F
Sbjct: 156 GFNVYITRFIEPSF 169

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 132/548 (24%), Positives = 212/548 (38%), Gaps = 89/548 (16%)

Query: 57  DDV--ELLAEIGYKQELS-RHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGW 113
           DDV  E +      +ELS RH  T+ V G   +  GL  +  + L+    GG  S V  W
Sbjct: 74  DDVQQEDINNTNLSKELSVRHLLTLAVGGAIGT--GLFVNTGAALST---GGPASLVIDW 128

Query: 114 LIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKFKAILSFLIGNSNSLA------ 167
           +I    + ++  ++ EL++A P  GG          P F    +F + N N LA      
Sbjct: 129 VIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSF----AFAV-NLNYLAQWLVLL 183

Query: 168 ---LVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAV 224
              LVA   +++Y            W D   +++S    A++ A I    +L   +    
Sbjct: 184 PLELVAASITIKY------------WND---KINSDAWVAIFYATIAMANMLDVKSFGET 228

Query: 225 S-VLQTVSIVINLSLVAFLIVLPIGVANNDSMT----FNGPGFIFANFQNNSSWPDCIQF 279
             VL  + I+  +      IVL  G   +        +N PG  F    + + +      
Sbjct: 229 EFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPG-AFVGHDSGTKFKG---- 283

Query: 280 FLCGSLPIVWVIGAFD-STIHMS----EEAKNASKAVPVDILTSITVCWL--LGFCIVVT 332
            LC     V+V  AF  S I M+     E+KN  + +P     +    WL  + +  ++T
Sbjct: 284 -LCS----VFVTAAFSYSGIEMTAVSAAESKNPRETIPK---AAKRTFWLITISYVTILT 335

Query: 333 IAACMGPD-----ING--LLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMGASIL 385
           +  C+ P      +NG   +D A   PL   + N   K       ++I +    +  S +
Sbjct: 336 LIGCLVPSNDPRLLNGSSSVDAA-SSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAV 394

Query: 386 TAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVASSAL 445
            A SR + A A    LP   ++++V+K    PI A  +  F     GLL+        A 
Sbjct: 395 YACSRCMVAMAHIGNLP--KFLRRVDKR-GRPINAIVLTLF----FGLLSFVAASDKQAE 447

Query: 446 FSMYVGA-----NYLAWMMPNLLRMLFGKNI-FNPGVFYMGKFWSPIINWVSII-FQLLC 498
              ++ A         WM  NL  + F + + F         F S    W SI  F +L 
Sbjct: 448 VFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLF 507

Query: 499 IVLMM-LPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKS---NLTDSDL 554
           +VL+    T+   I  S  N    F G++ F  I+    + HK +         L D DL
Sbjct: 508 LVLIASFWTSMFPIGSSGANAESFFEGYLSF-PILIVCYFGHKIYTRDWRLLVKLEDMDL 566

Query: 555 NTPDGSIE 562
           +T    ++
Sbjct: 567 DTGRKQVD 574

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 50/122 (40%), Gaps = 20/122 (16%)

Query: 464 RMLFGKNIFNPGVFY---------MGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGS 514
           +M F   +++P +           +   WSP+I   S +  L  ++    P +P +   +
Sbjct: 68  KMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

Query: 515 SM----NYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS-IEHISSQTF 569
                   +F  T  +W        LY  ++  G KS++ +SDL   D   IE   SQ F
Sbjct: 128 QHYLRDRESFNKTAALWTR------LYASESINGQKSSVEESDLYGIDHDLIEEFESQGF 181

Query: 570 EK 571
           +K
Sbjct: 182 DK 183

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 57/140 (40%), Gaps = 20/140 (14%)

Query: 13  VDVILLQPALT----NNTSVRVQQISSIKTSRSKTVDQVNYINAKT---AYDDVELLAEI 65
           +D I+ +P  T    NN +   +   SI+   ++ VD    I  +       D E +A  
Sbjct: 25  MDDIVHEPCSTLSSNNNDN---ESRGSIRCKWTRFVDSFKRIELEELDPNLTDAEKIAIA 81

Query: 66  GYKQEL-----SRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFI 120
             +  L     SRH   I V G   +  GL       L  A P G++    GW + G  I
Sbjct: 82  TARSPLKHTLKSRHLHMIAVGGAIGT--GLFVGSGKALRTAGPAGILI---GWTVTGTMI 136

Query: 121 LSIGAAMSELASAIPTSGGL 140
            S+  A+ ELA   P SGG 
Sbjct: 137 YSMVMAVGELAVVFPVSGGF 156

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 48/122 (39%), Gaps = 20/122 (16%)

Query: 464 RMLFGKNIFNPGVFY---------MGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGS 514
           +M F   +++P +           +   WSP+I   S +  L  ++    P +P +   +
Sbjct: 68  KMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

Query: 515 SM----NYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS-IEHISSQTF 569
                   +F  T  +W        LY  +   G K N+ +SDL   D   IE   SQ F
Sbjct: 128 QHYLRDRESFNKTAALW------TRLYASEGANGQKGNVEESDLYGIDHDLIEEFESQGF 181

Query: 570 EK 571
           EK
Sbjct: 182 EK 183

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 48/122 (39%), Gaps = 20/122 (16%)

Query: 464 RMLFGKNIFNPGVFY---------MGKFWSPIINWVSIIFQLLCIVLMMLPTNPINITGS 514
           +M F   +++P +           +   WSP+I   S +  L  ++    P +P +   +
Sbjct: 68  KMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

Query: 515 SM----NYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDLNTPDGS-IEHISSQTF 569
                   +F  T  +W        LY  +   G K N+ +SDL   D   IE   SQ F
Sbjct: 128 QHYLRDRESFNKTAALW------TRLYASEGANGQKGNVEESDLYGIDHDLIEEFESQGF 181

Query: 570 EK 571
           EK
Sbjct: 182 EK 183

>Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)
          Length = 348

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 59/161 (36%), Gaps = 26/161 (16%)

Query: 1   MVSYLEGQQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYD--- 57
           M S  + +     DV  ++PA+T   S+  +  S+  +  ++   +    N  T +    
Sbjct: 1   MNSRFQEKDNVNYDVKGIEPAITETESISQEPFSTFSSDNNELTSEGGLNNTWTRFKNSF 60

Query: 58  -------------DVELLAEIGYKQELS-----RHFSTIQVFGIAFSIMGLLPSIASILT 99
                        D E +A    +  L      RH   I V G   +  GL       L 
Sbjct: 61  KRFELEELDPNLTDAEKIAIATARSPLKHTLKKRHLHMIAVGGAIGT--GLFVGSGKALR 118

Query: 100 IALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGL 140
            A P G++    GW + G  I  +  A+ ELA   P SGG 
Sbjct: 119 TAGPAGILI---GWTVTGSMIYCMVMAVGELAVIFPVSGGF 156

>Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)
          Length = 349

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 59/161 (36%), Gaps = 26/161 (16%)

Query: 1   MVSYLEGQQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYD--- 57
           M S  + +     DV  ++PA+T   S+  +  S+  +  ++   +    N  T +    
Sbjct: 1   MNSRFQEKDNVNYDVKGIEPAITETESISQEPFSTFSSDNNELTSEGGLNNTWTRFKNSF 60

Query: 58  -------------DVELLAEIGYKQELS-----RHFSTIQVFGIAFSIMGLLPSIASILT 99
                        D E +A    +  L      RH   I V G   +  GL       L 
Sbjct: 61  KRFELEELDPNLTDAEKIAIATARSPLKHTLKKRHLHMIAVGGAIGT--GLFVGSGKALR 118

Query: 100 IALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGL 140
            A P G++    GW + G  I  +  A+ ELA   P SGG 
Sbjct: 119 TAGPAGILI---GWTVTGSMIYCMVMAVGELAVIFPVSGGF 156

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 12/112 (10%)

Query: 48  NYINAKTAY-----DDV-ELLAEIGYKQELS-RHFSTIQVFGIAFSIMGLLPSIASILTI 100
           +  N++ +Y     DD+ E +      Q+L+ RH  T+ V G A      + S AS+ T 
Sbjct: 61  DRFNSQHSYNPGSPDDIKEDIHTSNMNQDLNVRHLITLAVGG-AIGTGLFVNSGASLNT- 118

Query: 101 ALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLXXXXXXXAPPKF 152
              GG  S V GW I    + ++  ++ ELA+A P  GG          P F
Sbjct: 119 ---GGPASLVIGWTIVSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSF 167

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 467 FGKNIFNPGVFYMGKF--------WSPIINWVSIIFQLLCIVLMMLPTNPINITGSSM 516
           F K I++P +   GK         WSP+++  SII  L+ + L   P +P+N+    +
Sbjct: 104 FLKKIYHPNIDLNGKICLNILREDWSPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGEL 161

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 55/130 (42%), Gaps = 14/130 (10%)

Query: 29  RVQQISSIKTSRSKTVDQVNYINAK-TAYDDVE------LLAEIGYKQELS-RHFSTIQV 80
           R++++  ++ S +K+   V  +  K    DDVE          +   ++LS RH  T+ V
Sbjct: 27  RMEEVEVVE-SLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAV 85

Query: 81  FGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGL 140
            G   +  GL  +  S L I   GG  S V  W I    + +I  A+ ELA+  P  GG 
Sbjct: 86  GGAIGT--GLFVNSGSALNI---GGPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGF 140

Query: 141 XXXXXXXAPP 150
                    P
Sbjct: 141 NVYVTRLVDP 150

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 6/86 (6%)

Query: 58  DVELLAEIGYKQELSRHFST--IQVFGIAFSI-MGLLPSIASILTIALPGGMVSFVWGWL 114
           + E +A I  +  L RH     +Q+  I  +I  GL       L    P G++    GW 
Sbjct: 64  EAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLI---GWG 120

Query: 115 IFGVFILSIGAAMSELASAIPTSGGL 140
           + G+ I  +  +M ELA   P SGG 
Sbjct: 121 LIGLMIYCVVMSMGELAVTFPVSGGF 146

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 68  KQELSRHFST--IQVFGIAFSI-MGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIG 124
           +  L RH     +Q+  I  +I  GL     S L     GG  + + GW + G+ I S+ 
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRT---GGPAAVLIGWGLIGLMIYSVV 133

Query: 125 AAMSELASAIPTSGGL 140
            AM ELA   P +GG 
Sbjct: 134 MAMGELAVTFPVAGGF 149

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 46/122 (37%), Gaps = 6/122 (4%)

Query: 22  LTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFST--IQ 79
            TN+ +   +   S       +  ++  +       + E +A       L RH     +Q
Sbjct: 28  FTNHEASNEESSGSKWQDFKNSFKRMEVVELDPNLTEAEKIAIATANSPLKRHLKNRHLQ 87

Query: 80  VFGIAFSI-MGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSG 138
           +  I  +I  GL       L  A P G++    GW + G  I  +  AM ELA   P SG
Sbjct: 88  MIAIGGAIGTGLFVGSGKALRTAGPAGILI---GWALTGTMIYCMVMAMGELAVTFPVSG 144

Query: 139 GL 140
           G 
Sbjct: 145 GF 146

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 11/121 (9%)

Query: 24  NNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAE-----IGYKQEL-SRHFST 77
           +N  V+ Q+I +I    +    + +   + +A DD   +A+        K+EL +RH S 
Sbjct: 32  DNFPVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAIADGKDENTRLKKELKARHISM 91

Query: 78  IQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTS 137
           I + G   +  GLL    + L   L GG V+ +  +   G+ +    A + E+AS IP  
Sbjct: 92  IAIGGSLGT--GLLIGTGTAL---LTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLD 146

Query: 138 G 138
           G
Sbjct: 147 G 147

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 72  SRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELA 131
           SRH   I + G   +  GL       L  A P G++    GW I G  I ++  A+ ELA
Sbjct: 94  SRHLQMIAIGGAIGT--GLFVGSGKALRTAGPAGILI---GWGITGTMIFTMVMALGELA 148

Query: 132 SAIPTSGGL 140
              P SGG 
Sbjct: 149 VVFPVSGGF 157

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 50/130 (38%), Gaps = 34/130 (26%)

Query: 11  SKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQE 70
            +V+V  + P LT+   +      +IKT+RS    ++                       
Sbjct: 62  KRVEVEEVDPNLTDLEKI------AIKTARSPLQHKLK---------------------- 93

Query: 71  LSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSEL 130
            SRH   I + G   +  GL       L  A P G++    GW I G  I ++  A+ EL
Sbjct: 94  -SRHLQMIAIGGAIGT--GLFVGSGRALRTAGPAGILI---GWSITGTMIFTMVMALGEL 147

Query: 131 ASAIPTSGGL 140
           A   P SGG 
Sbjct: 148 AVMFPVSGGF 157

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 59/140 (42%), Gaps = 10/140 (7%)

Query: 24  NNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELL---AEIGYKQELS-RHFSTIQ 79
           N+ S    + S +   R +T ++  +IN +    +VE L    +   K++L  RH S I 
Sbjct: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENM-SEVESLYGNDDPDVKRDLKPRHMSMIS 75

Query: 80  VFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGG 139
           + G   +  GL   IAS + +A P G +     +L  G     +  ++ E+A+ IP +  
Sbjct: 76  LGGTIGT--GLFMGIASPIRVAGPVGSL---LAYLFMGTIAFCVTQSLGEMATFIPVTSS 130

Query: 140 LXXXXXXXAPPKFKAILSFL 159
                     P   A   +L
Sbjct: 131 FTMYTQRFLSPALGAANGYL 150

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 9/106 (8%)

Query: 41  SKTVDQVNYINAKTAYDDVELLAEIGYKQE---LSRHFST--IQVFGIAFSI-MGLLPSI 94
            K  D    ++     DD+  + +I ++     L  H     +Q+  I  +I  GL    
Sbjct: 48  RKFKDSFKPLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGS 107

Query: 95  ASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGL 140
            + L  A P G++    GW + G  I  +  AM EL+   P SGG 
Sbjct: 108 GTALRTAGPAGILI---GWGLTGTMIYCMVMAMGELSVVFPISGGF 150

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 53/137 (38%), Gaps = 16/137 (11%)

Query: 8   QQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVD----QVNYINAKTAYDDVELLA 63
           Q+P   D+            V  + + S +      VD    +++ I  +TA   ++   
Sbjct: 26  QEPLSHDLSSTGSEEHKKGKVWTRFVDSFRERERLEVDPNMSELDQIAFRTANSPLQ--- 82

Query: 64  EIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSI 123
                   +RH   I + G   +  GL     + L  A P G++    GW + G  I S+
Sbjct: 83  ----HHLKNRHLQMIAIGGAIGT--GLFVGSGTALRTAGPAGILI---GWGLTGTMIYSM 133

Query: 124 GAAMSELASAIPTSGGL 140
             A+ ELA   P SGG 
Sbjct: 134 VMALGELAVLFPVSGGF 150

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 68  KQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAM 127
            Q  +RH   I + G   +  GL     + L  A P G++    GW+I G  I  +  ++
Sbjct: 86  HQLKNRHLQMISIGGAIGT--GLFVGSGTALRTAGPAGILI---GWIIAGSMIYCMVMSV 140

Query: 128 SELASAIPTSGGL 140
           +ELA A P +GG 
Sbjct: 141 AELAIAFPVAGGF 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,360,696
Number of extensions: 2191392
Number of successful extensions: 7964
Number of sequences better than 10.0: 158
Number of HSP's gapped: 8048
Number of HSP's successfully gapped: 169
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)