Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46208.849ON59759728630.0
KLTH0C03586g8.849ON5785598691e-108
SAKL0D01188g8.849ON5815528671e-108
KLLA0C06226g8.849ON5925618671e-108
Kwal_27.101998.849ON5725578501e-106
ZYRO0C14850g8.849ON5945738291e-102
TDEL0B001808.849ON5825508191e-101
NCAS0C003208.849ON6085817665e-93
Smik_13.5008.849ON6025557657e-93
NDAI0K003608.849ON6205867632e-92
YMR284W (YKU70)8.849ON6025627431e-89
Skud_13.4578.849ON6025627361e-88
Suva_13.4748.849ON6025657343e-88
Kpol_1068.18.849ON5144747231e-87
ABL117C8.849ON6025937186e-86
KNAG0M02650singletonON5745547122e-85
KAFR0L019508.849ON5885636792e-80
AFR443CsingletonON5765476678e-79
TPHA0I003108.849ON6085646611e-77
CAGL0I02662g8.849ON6065626349e-74
TBLA0B028908.849ON6485906361e-73
Kwal_33.133601.76ON140848724.5
KNAG0H031008.251ON25840695.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4620
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...  1107   0.0  
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   339   e-108
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   338   e-108
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   338   e-108
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   332   e-106
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   323   e-102
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   320   e-101
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   299   5e-93
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   299   7e-93
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     298   2e-92
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   290   1e-89
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   288   1e-88
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   287   3e-88
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   283   1e-87
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   281   6e-86
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   278   2e-85
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   266   2e-80
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   261   8e-79
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   259   1e-77
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   248   9e-74
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   249   1e-73
Kwal_33.13360 s33 (183914..188140) [4227 bp, 1408 aa] {ON} YCR04...    32   4.5  
KNAG0H03100 Chr8 (584089..584865) [777 bp, 258 aa] {ON} Anc_8.25...    31   5.8  

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/597 (90%), Positives = 540/597 (90%)

Query: 1   MSMGDPLTKVQHSKNIKHERRQSIIVCIELSSRVYQSSEISPXXXXXXXXXXXXXXXXXX 60
           MSMGDPLTKVQHSKNIKHERRQSIIVCIELSSRVYQSSEISP                  
Sbjct: 1   MSMGDPLTKVQHSKNIKHERRQSIIVCIELSSRVYQSSEISPKAQLAEMLEALLELMKQL 60

Query: 61  XXXXPNSEVCCYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEI 120
               PNSEVCCYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEI
Sbjct: 61  AMLLPNSEVCCYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEI 120

Query: 121 PFEEIDGSPLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNT 180
           PFEEIDGSPLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNT
Sbjct: 121 PFEEIDGSPLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNT 180

Query: 181 INALYDDSFSIVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXX 240
           INALYDDSFSIVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNT       
Sbjct: 181 INALYDDSFSIVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTKPIEIKE 240

Query: 241 XXXXXXXXXXXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDA 300
                        FHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDA
Sbjct: 241 LKGKLLQKKEGNKFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDA 300

Query: 301 FSHRKFYNANDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVD 360
           FSHRKFYNANDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVD
Sbjct: 301 FSHRKFYNANDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVD 360

Query: 361 KVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLM 420
           KVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLM
Sbjct: 361 KVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLM 420

Query: 421 VAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSS 480
           VAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSS
Sbjct: 421 VAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSS 480

Query: 481 YRAAEFPSPVLKSFYXXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKSSQNM 540
           YRAAEFPSPVLKSFY               WGMGFKLSNDITLGKVQHLRELINKSSQNM
Sbjct: 481 YRAAEFPSPVLKSFYTTLSDKLLQKSLSDQWGMGFKLSNDITLGKVQHLRELINKSSQNM 540

Query: 541 EQPILAKYMKYWNTYYNKEGNNSITNRKKLYQIYSGDPQVQKSMRIRATNAKSVFNL 597
           EQPILAKYMKYWNTYYNKEGNNSITNRKKLYQIYSGDPQVQKSMRIRATNAKSVFNL
Sbjct: 541 EQPILAKYMKYWNTYYNKEGNNSITNRKKLYQIYSGDPQVQKSMRIRATNAKSVFNL 597

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/559 (32%), Positives = 301/559 (53%), Gaps = 4/559 (0%)

Query: 9   KVQHSKNIKHERRQSIIVCIELSSRVYQSSEISPXXXXXXXXXXXXXXXXXXXXXXPNSE 68
           K   SK  K E  + II C+ELS  +++                            P + 
Sbjct: 10  KDSESKYKKFEVHEGIIFCVELSEAMFKEPFDLNKVQLLEILETLLELMTQVIIILPGTG 69

Query: 69  VCCYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGS 128
           + C+ +QC     K GIYE LPL  VN + + K++ LL D+K     L ++ PF +   +
Sbjct: 70  IGCFFFQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPFNDKQNT 129

Query: 129 PLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDS 188
            L +V   +Q Q       +  + NK+I L T ND P E  D E + + +  I+ L D  
Sbjct: 130 SLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLDDSF 189

Query: 189 FSIVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXX 248
            +I+ FF+ S+ RPF+ +FY+D+LK   + +  D   +Y +GPNT               
Sbjct: 190 INIIPFFVGSEQRPFDQSFYSDILKLGAKKKASDGPFKY-EGPNTTPISAKLIKSRVLRK 248

Query: 249 XXXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYN 308
                  F+C+ I+N+ +DF +S+KG+  I+ E+AG ++K +Y      ++A SHRK+ +
Sbjct: 249 KEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHRKYLD 308

Query: 309 ANDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNN 368
           AN GE    R+ KVF    ++IE +E++  KM   +S +++FL+L+GFR  ++  FY+NN
Sbjct: 309 ANTGEDVTERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFNN 368

Query: 369 ISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNT 428
           IS SS+V+PDD+V++GS KT++ L+  + +K K+A+VWGKL   ++P L+ +   +  + 
Sbjct: 369 ISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFNDH 428

Query: 429 NQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPS 488
           N+GFYL R+PFI+EIR+FP T         + +  M KIT  +I++F+L+ SYR ++F +
Sbjct: 429 NEGFYLTRVPFIDEIRKFPPTAYHGNLSKTKTFEQMCKITETLISYFSLRHSYRPSDFEN 488

Query: 489 PVLKSFYXXXXXXXXXXXXXXXWGMG-FKLSNDITLGKVQHLRELINKSSQNME--QPIL 545
           P L+  +                G     L  D TL K+  +R  I +S+++ +  Q  L
Sbjct: 489 PTLQKHFELLHDYLLQVEVDPTSGSKEHLLKKDDTLLKLHQVRAKILESAESDDPVQARL 548

Query: 546 AKYMKYWNTYYNKEGNNSI 564
           + Y+K WN+ YN+E N  +
Sbjct: 549 SNYVKAWNSMYNRELNGDL 567

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/552 (33%), Positives = 302/552 (54%), Gaps = 4/552 (0%)

Query: 17  KHERRQSIIVCIELSSRVYQS-SEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K+E    I+ CIEL+S +Y+  +E++                       PN+ V CY +Q
Sbjct: 21  KYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYFFQ 80

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLA 135
           C + N + GIYE LPL+ VN + + K++ LL D++ K+  L+++ PF       L SVL 
Sbjct: 81  CNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESVLV 140

Query: 136 KIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFF 195
            ++ Q   +  +   + N ++ L T N  P  Y + E +   +  +N L D   +   FF
Sbjct: 141 FLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTPFF 200

Query: 196 IHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXXXFH 255
           I ++ +PF+ +FY+D+LK LR   D     + +DGPNT                      
Sbjct: 201 IDTEEKPFDQSFYSDILK-LRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRVK 259

Query: 256 FKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEAA 315
           F+C  I++ +N+F IS+KG+  I+ EK G R+K +Y+     ++AFSHR++ +A+ G   
Sbjct: 260 FQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVDV 319

Query: 316 DSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYV 375
             ++ K+F  G  NIE ++E   K+      + +FL++IGFRS D+  FYYNN+  +++V
Sbjct: 320 SDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTAFV 379

Query: 376 IPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLV 435
           +PD+  YEGS + ++ LY ++  KGK+A+VWGKL   ++P ++LM      + N+GFYL 
Sbjct: 380 VPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFYLT 439

Query: 436 RLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFY 495
           R+PFI+EIRRFP   Q    ++ Q+Y  M + T  IIA+FNL++ Y+ +EF +P L+ ++
Sbjct: 440 RIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQHYF 499

Query: 496 XXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKSSQNME--QPILAKYMKYWN 553
                               +   D TL K+  +R+ I +SS++ E  +  L+KY K WN
Sbjct: 500 SLLHDQLLEAKEESSADEEQESLKDDTLLKLSQIRDKIIESSKSDEPGRQRLSKYFKGWN 559

Query: 554 TYYNKEGNNSIT 565
           T YNKE N  ++
Sbjct: 560 TLYNKEYNQHLS 571

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 181/561 (32%), Positives = 309/561 (55%), Gaps = 9/561 (1%)

Query: 12  HSKNIKHERRQSIIVCIELSSRVYQSS-EISPXXXXXXXXXXXXXXXXXXXXXXPNSEVC 70
           H K  ++E    I+ CI+L+  +Y S+ ++                        P++ V 
Sbjct: 25  HKKWRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAVG 84

Query: 71  CYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGS-P 129
           CY+Y C   N +D +YEL+PL  VN + + ++S LL DI+  ++ LKDEIP  + +    
Sbjct: 85  CYIYNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIPIADPNNPIE 144

Query: 130 LSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSF 189
           LS VL K++         + +  NK+I   T +D PAE+ + + + + +  ++ LYD   
Sbjct: 145 LSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKVVDDLYDYYI 204

Query: 190 SIVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXX 249
           + VTFFI S+ +PF+D+ YAD+LK   +  +    +  + GP+T                
Sbjct: 205 NFVTFFIGSEDKPFDDSMYADILKWGSKINEAQSWLSSH-GPSTNPINASYIKSKVKRTK 263

Query: 250 XXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNA 309
                 F+C  +++++ D ++S+ G+  ++ E  G ++K +Y  G+  ++A+SHR++ +A
Sbjct: 264 EIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLDA 323

Query: 310 NDGEAAD-SRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNN 368
             GEA D S+L+KV+  G   IE TE+++ K+ + +SEHE+FL+LIGFRS ++   YY+N
Sbjct: 324 ETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYDN 383

Query: 369 ISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNT 428
           I   ++V+P++  Y GS KTL+ LY +M  K K+A+VWGKL   + P +F++    +K+ 
Sbjct: 384 IDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSSKKDY 443

Query: 429 NQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPS 488
           NQGFYL ++PF+EE+R+ P  L  +  +   +Y +M K+T  +I FFNLK+ YR ++F +
Sbjct: 444 NQGFYLYKVPFMEEVRKLPDFLNHSALIESDDYKVMSKVTETLINFFNLKNGYRPSDFHN 503

Query: 489 PVLKSFYXXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKS--SQNMEQPILA 546
           P L+  +                        D TL KV+ +   I  S  S +++Q  L 
Sbjct: 504 PALQKHFKILREYLLQIEVDKSKPED---EGDETLQKVKQIYARIASSAKSDDVKQQRLV 560

Query: 547 KYMKYWNTYYNKEGNNSITNR 567
           KY+K WN++YN+  N  +  +
Sbjct: 561 KYLKLWNSFYNRLSNLEVDTK 581

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  332 bits (850), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/557 (31%), Positives = 297/557 (53%), Gaps = 4/557 (0%)

Query: 17  KHERRQSIIVCIELSSRVYQSSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQC 76
           K E  + II CIELS  +++ S                          P + + CY + C
Sbjct: 12  KFEVHEGIIFCIELSKGMFEKSSDMNKVQLVEILETLLELMSQVIISLPGTGIGCYFFHC 71

Query: 77  RRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLAK 136
              N   GIYELLPL  VN + + K++ LL DI      L+ + P +E   +PL +V   
Sbjct: 72  GHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDEQLSTPLETVFIL 131

Query: 137 IQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFFI 196
           +Q Q   +   +  + NK+I L T ND P E  D++ + + +  ++ L D   +  TFFI
Sbjct: 132 LQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHINFTTFFI 191

Query: 197 HSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXXXFHF 256
            ++ +PF+ +FY+D+LK L   +   +    ++GP+T                      F
Sbjct: 192 GTEQKPFDQSFYSDILK-LGAKKTASQGGSTFNGPSTAPINANLIKARALRKKEIKRIRF 250

Query: 257 KCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEAAD 316
           +C   +N+  DF +S+KG+  ++ E+ G ++K +Y      ++  SHRK+ NAN GE   
Sbjct: 251 QCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNANTGEDVT 310

Query: 317 SRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYVI 376
             + +VF    ++IEF+EE+  K+   +S +++FL+LIGFR   K  F+Y+NI  SS+V+
Sbjct: 311 DSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNIGNSSFVV 370

Query: 377 PDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLVR 436
           PD++V EGS KT+S L+ S++KK K+A+VWGKL   ++P ++++     K+ N+GFYL R
Sbjct: 371 PDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNEGFYLTR 430

Query: 437 LPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVL-KSFY 495
           +PF++E+R+FP   + +  +  + +  M KIT  +I++F+L+  Y+ ++F +P L K F 
Sbjct: 431 VPFVDEVRKFPPIPRYDEELGGKNFEQMCKITETLISYFSLRRPYKPSDFKNPTLQKHFK 490

Query: 496 XXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINK--SSQNMEQPILAKYMKYWN 553
                            +   L +D TL K+  +R  I +  SS++ E+  L  Y+K WN
Sbjct: 491 LLYDYLLQVEVDCSSESVDGALKHDDTLLKLYQVRRKIQESLSSKDPEEERLGTYVKAWN 550

Query: 554 TYYNKEGNNSITNRKKL 570
           + YNK  N  +T  K +
Sbjct: 551 SLYNKISNQELTPDKGM 567

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/573 (32%), Positives = 304/573 (53%), Gaps = 20/573 (3%)

Query: 1   MSMGDPLT------KVQHSKNI---KHERRQSIIVCIELSSRVYQS-SEISPXXXXXXXX 50
           MS  DPL         QH+++    K+E  + II CIELS+ ++Q  SE++         
Sbjct: 1   MSSLDPLNVELEQQDKQHTQSKSYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEIL 60

Query: 51  XXXXXXXXXXXXXXPNSEVCCYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIK 110
                         P + + CY Y C + + K+ IYE  PL  +N + + K+S LL D+ 
Sbjct: 61  ETLEQLMSQLVIVRPGTGIGCYFYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLA 120

Query: 111 NKKMFLKDEIPFEEIDGSPLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFD 170
           N ++ L+  +P++E + +PL  +   IQ +   +   +  F NK++ L T ND P E  D
Sbjct: 121 NDRITLQKFLPYDESERTPLDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAED 180

Query: 171 AELQKKFKNTINALYDDSFSIVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDG 230
            E + + ++ ++ + D   +  TFFI  +  PF+D+FY+D+LK     ED +     +DG
Sbjct: 181 NETKSRLRHLVDDMDDHFINFTTFFIGKEEAPFDDSFYSDVLKLGATAEDPNTE---FDG 237

Query: 231 PNTXXXXXXXXXXXXXXXXXXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYI 290
           PNT                      F+C  I+ ++  F++ +KG+  I QE+ G+R++ +
Sbjct: 238 PNTTPISASYIKSRVLRKQEVKRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLV 297

Query: 291 YQKGAKPQDAFSHRKFYNANDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETF 350
           Y+K    ++A S RKF ++N GE  +  LTKVF  G L+I  T+E+  ++  S++E E+F
Sbjct: 298 YEKDEVRKEANSKRKFLDSNTGEVIEEGLTKVFPYGDLDITITDEELNEVRKSYTEEESF 357

Query: 351 LELIGFRSVDKVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLT 410
           L++IGFR  +K   Y+NNI  + +V+PD+  +EGS +TL+ L+ ++  KGK A+VWGKL 
Sbjct: 358 LKIIGFRDYNKCIHYFNNIDRALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLK 417

Query: 411 RIAHPQLFLMVAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGN 470
             +HP +F++     ++ N+GFYL R+PF EE+RRFPQ+L ++ S +  EY  +K  T +
Sbjct: 418 TNSHPAVFVLSPSRNEDPNEGFYLYRIPFAEELRRFPQSLIRHNSYDTPEYNQLKDTTKS 477

Query: 471 IIAFFNLKSSYRAAEFPSPVLKSFYX-----XXXXXXXXXXXXXXWGMGFKLSNDITLGK 525
           II  F     YR +EF +P L+  +                          LS D +L K
Sbjct: 478 IIDHFQFAKGYRPSEFRNPDLQKHFKILHDYLLQVEQEEEDDSPESSKQRLLSEDDSLLK 537

Query: 526 VQHLRELINKSSQNMEQPI--LAKYMKYWNTYY 556
           +  +R+ I  S+Q+ +     L +Y + WN  Y
Sbjct: 538 LAQIRDKIMDSAQSSDPKKFQLDEYFQLWNRLY 570

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  320 bits (819), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/550 (32%), Positives = 291/550 (52%), Gaps = 12/550 (2%)

Query: 17  KHERRQSIIVCIELSSRVYQS-SEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           +++  + II CIELS+ ++    E++                       P++ + CY + 
Sbjct: 18  RYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCYFFN 77

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLA 135
           C R + KDGIY  LPL+ VN Q + K+S LL D++ ++  L+  +P++    +PL S+L 
Sbjct: 78  CNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESLLE 137

Query: 136 KIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFF 195
            ++ +      D+  F NK+I   T ND P E  D + + + ++ +N L D   +  TFF
Sbjct: 138 LVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTTFF 197

Query: 196 IHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXXXFH 255
           I     PF++ FY+D+L    R     K    +DGPNT                      
Sbjct: 198 IGKPGLPFDEGFYSDIL----RLGATTKASDEFDGPNTTPISAAYIKSRVLRKQEIKRIM 253

Query: 256 FKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEAA 315
           F+C  I+ +++ FI+ +KG+  I+ EK G R+K +Y+     Q+AFS RK+ NA  GE  
Sbjct: 254 FQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEI 313

Query: 316 DSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYV 375
              LTKV+  G L+IE +E    ++ N ++  E+FL++IGF+S +    YYNNI  +++V
Sbjct: 314 KDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFV 373

Query: 376 IPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLV 435
           +PD+  YEGS +TLS L+ ++ +K K AIVWGKL   ++P +F  V  D  + N+GFYL 
Sbjct: 374 VPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLY 433

Query: 436 RLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFY 495
           R+PF++E+RR P  L  +  +   +Y  +K+ T  +I  FNLK+ +  +EF +P L+  +
Sbjct: 434 RVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHF 493

Query: 496 X-----XXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKS--SQNMEQPILAKY 548
                               W     L  D +L ++  +R+ I++S  S++  +  L+KY
Sbjct: 494 KILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKY 553

Query: 549 MKYWNTYYNK 558
           +  WN+ Y+K
Sbjct: 554 LAIWNSLYDK 563

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  299 bits (766), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 185/581 (31%), Positives = 303/581 (52%), Gaps = 27/581 (4%)

Query: 5   DPLTKVQHSKNIKHERRQSIIVCIELSSRVYQS-SEISPXXXXXXXXXXXXXXXXXXXXX 63
           D +    H    K++  + II CIELS  +++   E++                      
Sbjct: 4   DEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVII 63

Query: 64  XPNSEVCCYVYQCRRLN--VKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIP 121
            P++ + CY + C R N   K+GIYE  PL  VN + + K+S L+ D+  K++ L +   
Sbjct: 64  RPSTGIGCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFN 123

Query: 122 FE-EIDGS-----PLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQK 175
           F+  +D       PL ++   +  Q    T D  K+ +K+I L T ND P E  D +   
Sbjct: 124 FDPTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATL 183

Query: 176 KFKNTINALYDDSFSIVTFFIHSQTRPFNDTFYADLLKPLRR--PEDL-------DKNIQ 226
           + +  ++ + D+  + VTFFI  + +PF ++FY+++LK   +   E+L       D+   
Sbjct: 184 RIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYS 243

Query: 227 YYDGPNTXXXXXXXXXXXXXXXXXXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGER 286
            YDGPNT                      F+C  I+ ++N+FI+S++G+  +TQEK   R
Sbjct: 244 EYDGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATR 303

Query: 287 FKYIYQKGAKPQDAFSHRKFYNANDGEAAD-SRLTKVFDIGGLNIEFTEEQDQKMINSFS 345
           +K +Y+     ++A S RKF N N GE      L KVF  G  +IE  +++  K+ + +S
Sbjct: 304 YKLVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYS 363

Query: 346 EHETFLELIGFRSVDKVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIV 405
           +HE+FL++IGFRS      Y+NNI  + +V+PD++ YEG+ KT++ L+  + K+ K  IV
Sbjct: 364 KHESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIV 423

Query: 406 WGKLTRIAHPQLFLMVAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMK 465
           WGK+   ++ +L+++      + N+GFYL R+PF++EIR+FP+ L  N     ++Y  + 
Sbjct: 424 WGKVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLV 483

Query: 466 KITGNIIAFFNLKSSYRAAEFPSPVLKSFYXXXXXXXXXXXXXXXW-----GMGFK-LSN 519
           +IT NII +FNLK  YR ++F +P L+  Y                     G   + L  
Sbjct: 484 RITENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKE 543

Query: 520 DITLGKVQHLRELI--NKSSQNMEQPILAKYMKYWNTYYNK 558
           D TL K+ H+RE I  +K S ++ Q  L+KY+  WNT+Y K
Sbjct: 544 DDTLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIK 584

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  299 bits (765), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 175/555 (31%), Positives = 286/555 (51%), Gaps = 13/555 (2%)

Query: 17  KHERRQSIIVCIELSSRVY-QSSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K +  + I+ C+ELS  ++ +SSE+                        P + + CY Y 
Sbjct: 25  KFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCYFYY 84

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGS---PLSS 132
           C R + K+GIYEL PL  +NV+ + K++ LL D+ ++++ L +   F++ +     PL+S
Sbjct: 85  CYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMPLAS 144

Query: 133 VLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIV 192
           +   I       ++ + +  NKR+ L T ND P E  +A+ + + +     L+D+  +  
Sbjct: 145 LFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKINFT 204

Query: 193 TFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXX 252
           TFFI      F++ FY+D+L+              +DGPNT                   
Sbjct: 205 TFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRKREVK 264

Query: 253 XFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDG 312
              F+C  I +++ DFII +KG+   + EKAG R+K +Y+     Q+A+S RKF N   G
Sbjct: 265 RIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFMSG 324

Query: 313 EAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTS 372
           E       KV+  G L+I  +E QDQ ++ +++  + FL++ GFRS      Y+NNI  S
Sbjct: 325 EDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNIEKS 384

Query: 373 SYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGF 432
           S+++PD+  YEGS + L+ L   + KK K AI+WGKL   +HP LF++   + K  N+GF
Sbjct: 385 SFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYNEGF 444

Query: 433 YLVRLPFIEEIRRFPQTLQKNRSVNIQ-EYALMKKITGNIIAFFNLKSSYRAAEFPSPVL 491
           YL R+PF++EIR+FP  L  +   + + +Y  MKK+T +II +FNL+  Y  ++F +P+L
Sbjct: 445 YLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSDFKNPLL 504

Query: 492 KSFYXX------XXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKSSQNMEQPI- 544
           +  Y                       M   +  D +L K+ H+R  I +S ++ +  I 
Sbjct: 505 QKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKSEDPAIQ 564

Query: 545 -LAKYMKYWNTYYNK 558
            L KY+K WN +Y K
Sbjct: 565 RLNKYVKIWNMFYKK 579

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  298 bits (763), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 185/586 (31%), Positives = 303/586 (51%), Gaps = 34/586 (5%)

Query: 17  KHERRQSIIVCIELSSRVYQS-SEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K++  + II CIELS  ++Q   E++                       P++ V CY++ 
Sbjct: 27  KYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTGVGCYIHY 86

Query: 76  CRR-------LNVK--DGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEID 126
           C +       +N K  DGIYEL PL  VN   + K+S L  D++++++ L     F+  +
Sbjct: 87  CNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDE 146

Query: 127 G----SPLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTIN 182
                 PL  +   +  +      D   + +++I L T ND P E  + E + + +  ++
Sbjct: 147 NFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRRLVD 206

Query: 183 ALYDDSFSIVTFFIHSQTRPFNDTFYADLLK---PLRRPED------LDKNIQYYDGPNT 233
            + D+  +  TFFI +  RPF+D+FY+D+LK     R   D      +D     +DGPNT
Sbjct: 207 DMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDGPNT 266

Query: 234 XXXXXXXXXXXXXXXXXXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQK 293
                                 F+   I+N+  +FII ++G+   + EK   R+K +Y++
Sbjct: 267 KPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVYEQ 326

Query: 294 GAKPQDAFSHRKFYNANDGEA-ADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLE 352
               ++AFS RK+ N N GE   +    K+F  G +NIE  +++  K+    S  E FL+
Sbjct: 327 ENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEAFLK 386

Query: 353 LIGFRSVDKVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRI 412
           +IGFRS ++  +Y+NNI+ +++V+PD++ YEGS +T++ L+ ++ KK K AI+WGK+   
Sbjct: 387 IIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMKTN 446

Query: 413 AHPQLFLMVAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQ-KNRSVNIQEYALMKKITGNI 471
           + P L+L+      + N+GFYL R+PF+EEIR+FP+ L  K+RS N  +Y  + KIT  I
Sbjct: 447 SKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSN-PDYTNLIKITSKI 505

Query: 472 IAFFNLKSSYRAAEFPSPVLKSFYXXXXXXXXXXXXXXXWG-----MGFKLSNDITLGKV 526
           + +F+L++ Y  +EF +P L+ FY                G     +   L  D TL K+
Sbjct: 506 VEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRKI 565

Query: 527 QHLRE--LINKSSQNMEQPILAKYMKYWNTYYNK-EGNNSITNRKK 569
             +R+  L +K S +  Q  L KYM  WNTYY K +  NS++N  K
Sbjct: 566 SQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEENSLSNPPK 611

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  290 bits (743), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/562 (30%), Positives = 287/562 (51%), Gaps = 13/562 (2%)

Query: 17  KHERRQSIIVCIELSSRVY-QSSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K +  + I+ CIELS  ++ +SS++                        P + + CY Y 
Sbjct: 25  KFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGCYFYY 84

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSP---LSS 132
           C R + K+GIYEL PL  +N   + K++ LL D+ + ++ L D   F++        LS 
Sbjct: 85  CNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVRLSV 144

Query: 133 VLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIV 192
           +   +      +   + +  NKR+ L T  D P E  D + + + +     L+D+  +  
Sbjct: 145 LFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFDNKVNFA 204

Query: 193 TFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXX 252
           TFFI    +PF++ FY+D+L+      +       +DGP+T                   
Sbjct: 205 TFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDAKYIKSRILRKKEVK 264

Query: 253 XFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDG 312
              F+C  I++++ +FI+ +KG+   T EKAG R+K +Y+     Q+A+S RKF N   G
Sbjct: 265 RIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPITG 324

Query: 313 EAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTS 372
           E    +  KV+  G L+I  ++ QDQ ++ ++++ + FL++IGFRS  K   Y+NNI  S
Sbjct: 325 EDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNIDKS 384

Query: 373 SYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGF 432
           S+++PD+  YEGS +TL+ L   + KK K AI+WGKL   +HP L+ +     K+ N+GF
Sbjct: 385 SFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYNEGF 444

Query: 433 YLVRLPFIEEIRRFPQTLQ-KNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVL 491
           YL R+PF++EIR+FP  L   + S +  +Y  MKK+T +I+ +FNL+  Y  ++F +P+L
Sbjct: 445 YLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPSDFKNPLL 504

Query: 492 KSFYXXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELI---NK--SSQNMEQPI-- 544
           +  Y                        D  + +   LR+L    NK   S+  E PI  
Sbjct: 505 QKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLRKLYYIRNKILESEKSEDPIIQ 564

Query: 545 -LAKYMKYWNTYYNKEGNNSIT 565
            L KY+K WN +Y K  +++I+
Sbjct: 565 RLNKYVKIWNMFYKKFNDDNIS 586

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  288 bits (736), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 170/562 (30%), Positives = 282/562 (50%), Gaps = 13/562 (2%)

Query: 17  KHERRQSIIVCIELSSRVY-QSSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K +  + I+ C+ELS  ++ +S E+                        P + + CY Y 
Sbjct: 25  KFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAIGCYFYY 84

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGS---PLSS 132
           C R + K GI+E  PL  +N   + +++ LL D+ + +M L +   F+  +     PL  
Sbjct: 85  CSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNFQPTEKQRQMPLGV 144

Query: 133 VLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIV 192
           +   +          + +  +K++ L T ND+P E  D + + + ++    L+D+  +  
Sbjct: 145 LFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLRSLTIDLFDNKVNFS 204

Query: 193 TFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXX 252
           TFFI    + F++ FY+D+L+              +DGPNT                   
Sbjct: 205 TFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEFDGPNTKPINAKYIKSKILRKKEIK 264

Query: 253 XFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDG 312
              F+C  +  +  DF + +KG+   + EKAG R+K +Y+     ++AFS RKF N   G
Sbjct: 265 RIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDVRREAFSKRKFLNPMTG 324

Query: 313 EAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTS 372
           E   S   KV+  G L+I F+E Q+Q ++ ++++ + FL +IGFRS  K   Y+NNI  S
Sbjct: 325 EDVTSSTVKVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIGFRSSSKAIHYFNNIEKS 384

Query: 373 SYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGF 432
           ++++PD+  YEGS +TL+ L+ ++ KK K AI+WGKL   +H  LF++     K  N+GF
Sbjct: 385 AFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHASLFVLSPSSIKEYNEGF 444

Query: 433 YLVRLPFIEEIRRFPQTLQKNRSVNIQ-EYALMKKITGNIIAFFNLKSSYRAAEFPSPVL 491
           YL R+PF++EIR+FP  L  +     + +Y  MKKIT NI+ +FNLK  Y  ++F +P L
Sbjct: 445 YLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKITQNIMGYFNLKDGYNPSDFRNPSL 504

Query: 492 KSF------YXXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKSSQNMEQPI- 544
           +        Y                 +   +  D +L K+ H+R  I  S ++ +  I 
Sbjct: 505 QKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDDSLRKLYHIRNKILDSEKSEDPAIQ 564

Query: 545 -LAKYMKYWNTYYNKEGNNSIT 565
            L KY+K WN +YNK  ++SI+
Sbjct: 565 RLNKYVKIWNVFYNKFNDDSIS 586

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  287 bits (734), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 173/565 (30%), Positives = 289/565 (51%), Gaps = 19/565 (3%)

Query: 17  KHERRQSIIVCIELSSRVY-QSSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K +  + I+ CIELS+ ++ +S E++                       P + + CY Y 
Sbjct: 25  KFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCYFYY 84

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGS---PLSS 132
           C R + K+GIYEL PL  +N + +  ++ LL D+ + ++ L +   F+  +     PL  
Sbjct: 85  CGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMPLGK 144

Query: 133 VLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIV 192
           +   +          + +  +K+I L T ND P E  DA+ + + +     L+D+  +  
Sbjct: 145 LFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKVNFA 204

Query: 193 TFFIHSQTRPFNDTFYADLLK---PLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXX 249
           TFFI      F++ FY+D+L+      +  DLD     +DGPNT                
Sbjct: 205 TFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSE---FDGPNTKPIDAKYIKSKILRKK 261

Query: 250 XXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNA 309
                 F+C  I ++  +FII +KG+   + EKAG R+K +Y+     Q+A+S RKF N 
Sbjct: 262 EVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNP 321

Query: 310 NDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNI 369
             G        KV+  G L+I  +E+Q+Q ++ ++++ + FL +IGFRS      Y+NNI
Sbjct: 322 TTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNI 381

Query: 370 STSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTN 429
             S++++PD+  YEGS +TL+ L  ++ KK K AIVWGKL   +HP LF++     +  N
Sbjct: 382 EKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYN 441

Query: 430 QGFYLVRLPFIEEIRRFPQTLQKNRSVNIQ-EYALMKKITGNIIAFFNLKSSYRAAEFPS 488
           +GFYL R+PF++EIR+FP  L  +     + EY  MK+I+ +I+ +FNL+  Y  ++F +
Sbjct: 442 EGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFKN 501

Query: 489 PVLKSF------YXXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKSSQNMEQ 542
           P L+        Y                 +   +  D +L K+ H+R  I +S ++ + 
Sbjct: 502 PSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDP 561

Query: 543 PI--LAKYMKYWNTYYNKEGNNSIT 565
            I  L KY+K WNT+YNK  +++I+
Sbjct: 562 AIQRLNKYVKIWNTFYNKFNDDNIS 586

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  283 bits (723), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 160/474 (33%), Positives = 263/474 (55%), Gaps = 14/474 (2%)

Query: 17  KHERRQSIIVCIELSSRVYQS-SEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K++  + I+ C+ELS +++Q   E++                       P + V CY+Y 
Sbjct: 43  KYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGTGVGCYIYN 102

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLA 135
           C + N  + I+  +PLE VNV+ + K++ LL D+ N++  L    P+++   +PL S+L 
Sbjct: 103 CHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESLLE 162

Query: 136 KIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDS----FSI 191
             Q +L    +    F NK++ L T ND P E  D    K  K  +  L+DD+     + 
Sbjct: 163 LTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASD----KAGKARLRRLFDDNNENFITF 218

Query: 192 VTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQY-YDGPNTXXXXXXXXXXXXXXXXX 250
           V FFI+ + +PF+ +FY+D+ K L   E+   + +  +DGP+T                 
Sbjct: 219 VPFFINRENKPFDSSFYSDIFK-LGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQE 277

Query: 251 XXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNAN 310
                F+C+ I+NK+ +F +++KG+  ++QEK G R+K +Y+     ++AFS RK  N  
Sbjct: 278 IKRVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCI 337

Query: 311 DGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNIS 370
             E     LTKVF  G LNIE +EE  +K+  ++ E   FL+L+GFRS++    YYNNI+
Sbjct: 338 TAEEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNIT 397

Query: 371 TSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQ 430
             S+V+PD++  +GS + L+ L+ +M KK K A++WGKL   +HP L+++ A +  + N+
Sbjct: 398 KPSFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNE 457

Query: 431 GFYLVRLPFIEEIRRFPQTLQ---KNRSVNIQEYALMKKITGNIIAFFNLKSSY 481
           GF+L R+PF++EIR+FP       K  ++N  EY  +K+ T NI+ +FNLK  Y
Sbjct: 458 GFFLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGY 511

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  281 bits (718), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 179/593 (30%), Positives = 296/593 (49%), Gaps = 29/593 (4%)

Query: 19  ERRQSIIVCIELSSRVYQ-SSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQCR 77
           +R Q+I++CIELS  +   +  +                        PNS V C  ++  
Sbjct: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG 84

Query: 78  RLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLAKI 137
           R   +DGI E  PL  ++   +  IS  ++D++   M +    PF     + L  +LA  
Sbjct: 85  R-RAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPASLDVMLAAS 142

Query: 138 QHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFFIH 197
                   T++ +  + RI L+T  D P E+ D    +K +  + +LY     I TFF+H
Sbjct: 143 DRYF----TEDTQNADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLH 198

Query: 198 SQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXXXFHFK 257
           ++   FND+ YA++LK   R   +    Q     +T                     +F 
Sbjct: 199 TEHAAFNDSSYAEILK--TREWGIPGAPQ-----STSPLSICKLREKMLSQKDLNRAYFS 251

Query: 258 CAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNA-NDGEAAD 316
           C  +INK  D ++S+ G+ A T E+ G R+KYI +   + +     RK+    N+    D
Sbjct: 252 CPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRD 311

Query: 317 SRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYVI 376
           +  + V+ IGG  IE T+ + +KM    S++E+FLE++GFR+++    YY+NI  + Y++
Sbjct: 312 ADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYIL 371

Query: 377 PDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLVR 436
           P +  + GS+K L+ L  SM +KGKAAIVWG+L    HP LF ++  D +       LVR
Sbjct: 372 PRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGETC--ALRLVR 429

Query: 437 LPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFYX 496
           +PFIEE+R FP    ++R  + +EY L+K ++ N+I  F+L++SYR ++  +P+L++FY 
Sbjct: 430 IPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYS 489

Query: 497 XXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKSSQNMEQPILAKYMKYWNTYY 556
                           + +   +D TL KVQ +R+ I  S  + E PI+++Y+  WN YY
Sbjct: 490 TLYHEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPIISEYINCWNIYY 549

Query: 557 NKEGNNSI---TNRKKLYQIYSGD---------PQVQKSMRIRATNAKSVFNL 597
           N   + ++      K+  + ++GD         P  Q++ R  A NAK+ FNL
Sbjct: 550 NHIIDKAVYEYGAPKRPLKYFTGDTLHLEDALTPNQQRTQRNTAKNAKTRFNL 602

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  278 bits (712), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 169/554 (30%), Positives = 273/554 (49%), Gaps = 15/554 (2%)

Query: 17  KHERRQSIIVCIELSSRVYQSSE-ISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K++  + I+ CIEL+  +++  E +                        P S V C  + 
Sbjct: 18  KYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVIVRPGSSVGCIFHY 77

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLA 135
                  DG+YE LPL  VN + +  +S  L DI+ K++ +     F+      L  +  
Sbjct: 78  TDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFKFDGSKHVSLERLFQ 137

Query: 136 KIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFF 195
            I  +   +  D  KF +KR  L T ND P E  D E  ++    ++ L + + S  TFF
Sbjct: 138 LIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIVDDLDETAVSFTTFF 197

Query: 196 IHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXXXFH 255
           I S+  PF++ FY+++LK   + +  D     YDGP+                       
Sbjct: 198 IGSEEAPFDNRFYSNVLKLGAQLKHSD-----YDGPSVRPITGSDIKARILRGKEIKRTM 252

Query: 256 FKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEAA 315
           F+C   +NK ++FII ++G+  +T EK G R+K  Y+K    Q+AFS RK+ N+  GE  
Sbjct: 253 FQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSKRKYLNSKTGEEV 312

Query: 316 DSR-LTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSY 374
           D + ++KV   G +NIE + E  Q+M  S+ E   F++++GFRS D    Y+NNI   S+
Sbjct: 313 DPKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDLCVKYFNNIDKPSF 372

Query: 375 VIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYL 434
           ++PD+  YEGS KTL+ L+ ++  K K+AI+WGK    ++  L++MV   R++ N GFY+
Sbjct: 373 IVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVPSHREDRNDGFYM 432

Query: 435 VRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSF 494
            R+PF++E+R+ P  +  N    +    L   +T  I+ +FNL+  Y  +EF +P ++++
Sbjct: 433 HRIPFLDELRKVPIKMVDNDWTQLDNDLLT--VTETILKYFNLRQGYIPSEFKNPGIQNY 490

Query: 495 YXXXXXXXXXXXXXXXWGMGFK----LSNDITLGKVQHLRELINKSSQNMEQPILAKYMK 550
           Y                G  F     L  D TL K+ H+R  I  S  N    +L+ YM 
Sbjct: 491 YKVLHDYILQVEEIKHEGWDFSQEELLRQDDTLKKISHIRGKIEAS--NDSDKVLSGYMN 548

Query: 551 YWNTYYNKEGNNSI 564
            WN +Y     N++
Sbjct: 549 MWNLFYKSLETNNV 562

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  266 bits (679), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 162/563 (28%), Positives = 275/563 (48%), Gaps = 12/563 (2%)

Query: 11  QHSKNIKHERRQSIIVCIELSSRVYQSSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVC 70
           Q++   K E  +++I  +ELS  ++++                           PN+ + 
Sbjct: 13  QNASYKKFESHEAMIFSVELSDGMFETVPELNKIQLIEILESLEELMSQLIVVRPNAAIG 72

Query: 71  CYVYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPL 130
           CY + C +     GIYE  PL  +N + + K+S LL D++  ++ L D   +     + +
Sbjct: 73  CYFHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFFQYNNAKKTSM 132

Query: 131 SSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFS 190
             +     +Q   +   + K+  +RI L T ND P +  D E +   +  ++ L +   +
Sbjct: 133 EKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHVN 192

Query: 191 IVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXX 250
            V FFI     PFN   Y+++LK   R +   +    YDGPNT                 
Sbjct: 193 FVPFFIGRPDAPFNSALYSEILKLGARKDSSTE----YDGPNTTPIQASYIKSKVLRKRE 248

Query: 251 XXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNAN 310
                F+C  I+N++ +FI+ L+G+  ++ EK   R+K +Y+     Q+AFS RKF ++ 
Sbjct: 249 IKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSE 308

Query: 311 DGEAADSR-LTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNI 369
             E    + LTK+F +G L+IE  E +  ++  +  +  +FL+++GFRS+     Y NNI
Sbjct: 309 TAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNI 368

Query: 370 STSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTN 429
               +V+PD+  Y  S K L+ L+ ++  KGKAAI+WGKL   ++P LF++     K+ N
Sbjct: 369 DKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPN 428

Query: 430 QGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSP 489
           +GFYL R+PF++EIR+ P  +      N  +Y  + K+T  I+A+FNLK  Y   +  +P
Sbjct: 429 EGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNP 488

Query: 490 VLKSFYXXXXXXXXXXXXXXXWGMGFK-----LSNDITLGKVQHLRELINKSSQNMEQPI 544
            ++ ++                    +     L  D TL KV H+RE I  SS++ +   
Sbjct: 489 CIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVSHIREKIISSSRSEDAGA 548

Query: 545 --LAKYMKYWNTYYNKEGNNSIT 565
             L+KY+K WN +Y K    S++
Sbjct: 549 QKLSKYIKVWNNFYAKIEKESVS 571

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  261 bits (667), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 153/547 (27%), Positives = 268/547 (48%), Gaps = 14/547 (2%)

Query: 14  KNIKHERRQSIIVCIELSSRVYQSS-EISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCY 72
           +++++   + I+ C+ELS  +Y+ S E+                        P++ V CY
Sbjct: 24  RHLRYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDTGVGCY 83

Query: 73  VYQCRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSS 132
            +QCR    K GIYEL PL  VNV  + K+  LL  I+  K  L++E+P++    + L  
Sbjct: 84  FFQCRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELPYDGRHPTSLDV 143

Query: 133 VLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIV 192
           V   IQ Q   +  ++  + NK+I L T ND P E      + + +  ++ L D   +  
Sbjct: 144 VFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVDDLNDYYINFS 203

Query: 193 TFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXXX 252
           TFFI ++ RPF+++FY+D+LK   +      +   YDGP+T                   
Sbjct: 204 TFFIGTEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISVSYIRSRVLRKKEVR 263

Query: 253 XFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDG 312
              + C   +N++   ++S+KG+ A T E+ G R++ +YQ     ++AFSHR++ + + G
Sbjct: 264 RLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQREAFSHRRYLDPDTG 323

Query: 313 EAADSRLTKVFDIGGLNIEFTEEQDQKMIN-SFSEHETFLELIGFRSVDKVNFYYNNIST 371
           E A   L KV+ IG   ++  ++ +  + N +    ++FL ++G R+   V  YYNNI  
Sbjct: 324 EEATEDLCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGSRTAVAVLPYYNNIHH 383

Query: 372 SSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQG 431
            ++++PDD+VY GS+  L+ L+ ++    +A +++GKL   + P L+ +        +  
Sbjct: 384 VTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPALYALAPAAAPLPDAV 443

Query: 432 FYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVL 491
           F L RLPF EE+R+FP       S+   +YA+++KIT  II    L S Y  A+F +PV+
Sbjct: 444 FILARLPFQEEVRKFPALSPPQASLASPDYAVLQKITSRIIDLLVLSSPYAPADFKNPVI 503

Query: 492 KSFYXXXXXXXXXXXXXXXWGMGFKLSNDITLGKVQHLRELINKSSQNMEQPILAKYMKY 551
            + +                   F+ + D            +     +  +  LAKY+++
Sbjct: 504 ATHFRLLSDHL------------FETAQDPRTDDTIARLLRLRHRVLDDPESRLAKYLRH 551

Query: 552 WNTYYNK 558
           WN +Y +
Sbjct: 552 WNAFYAR 558

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  259 bits (661), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 168/564 (29%), Positives = 282/564 (50%), Gaps = 25/564 (4%)

Query: 17  KHERRQSIIVCIELSSRVYQS-SEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           K+E  +  + CIELS  ++   S+++                       P++ V C+ + 
Sbjct: 37  KYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFN 96

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEID--GSPLSSV 133
           C     K  IYE LPL  +NV  + K+  LL D+K +++ ++D   F+EI+  G+ L S+
Sbjct: 97  CDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESL 156

Query: 134 LAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVT 193
              IQ +       +  + NK++ L T ND P E  D E   + +   + + D+    VT
Sbjct: 157 FLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVT 216

Query: 194 FFIH--SQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXXXXXXXXXXXXX 251
           FFI+    +  F+D+FY+D+LK LR    ++     +DGP+T                  
Sbjct: 217 FFINKIDSSDNFDDSFYSDILK-LRNSNSIE-----FDGPSTKPISVAYIKNKVLRKKEI 270

Query: 252 XXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNAND 311
               F+C  I+N  +DF +++KG+  I+ EK G R+K +Y+     ++AFS RK  N   
Sbjct: 271 KRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKT 330

Query: 312 GEAADSRLT-KVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNIS 370
           G       T K+F +G  +I   E + +K  ++    E FL+LIGFRS +     +NNI 
Sbjct: 331 GTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIG 390

Query: 371 TSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMD-RKNTN 429
            + +++PD++   GS +TLS +Y +M  K + AIVWGKL   ++P ++++   D  K+ N
Sbjct: 391 KALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQN 450

Query: 430 QGFYLVRLPFIEEIRRFPQT---LQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEF 486
           +GFYL ++PF++EIR+ P        +  +  ++Y  +K++T NI+ +FNL + Y   EF
Sbjct: 451 EGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLEF 510

Query: 487 PSPVLKSFYXXXXXXXXXXXXXXXWGMGFK------LSNDITLGKVQHLRELINKSSQNM 540
            +P+L+ +Y                 M  +      L  D T+ K   +R+ I KS+ + 
Sbjct: 511 KNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASST 570

Query: 541 E--QPILAKYMKYWNTYYNK-EGN 561
           E  +  L+     WN  Y+K EGN
Sbjct: 571 ESHKQRLSANFNIWNDIYSKLEGN 594

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  248 bits (634), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 161/562 (28%), Positives = 266/562 (47%), Gaps = 31/562 (5%)

Query: 17  KHERRQSIIVCIELSSRVYQ-SSEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQ 75
           + E  + I+ CIELS  +++   E+                        P++ + CY Y 
Sbjct: 33  RFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPSTAIGCYFYN 92

Query: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSP------ 129
           C R + K+ I+E +PL  +NVQ + K++ LL D+ N+++  K+ + +  ID +       
Sbjct: 93  CEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNYN-IDQNKKLNIPI 151

Query: 130 -----LSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKK----FKNT 180
                 S +L      ++G+     +F +K++ L T ND+P    + E Q++     K  
Sbjct: 152 LLEKLFSLILETFNRNIEGQK----EFNSKKVFLFTDNDLP----NVESQQRSIDVLKGI 203

Query: 181 INALYDDSFSIVTFFIHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTXXXXXXX 240
           +  + D+  +   FFI  + +PFN  FY+ +L+  R    L    Q Y GP+T       
Sbjct: 204 LKDIDDNMINFTNFFISKKDKPFNPAFYSKVLRNDRDYNSLGS--QAYFGPSTKPIGVND 261

Query: 241 XXXXXXXXXXXXXFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDA 300
                          F+C  ++++  +F+IS+KG+     EK   R+K +Y+     ++A
Sbjct: 262 IKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIRKEA 321

Query: 301 FSHRKFYNANDGEAADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVD 360
           FS RKF N   GE    +  K+   G   IE  ++     +N +      L +IGF + D
Sbjct: 322 FSKRKFINPKTGEDVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGFLNED 381

Query: 361 KVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLM 420
               +YNNI  + ++ PD+NV EGS    + L+ ++ K  K  +VWG     + P L+L+
Sbjct: 382 NSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPSLYLL 441

Query: 421 VAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSS 480
                 + NQGFYL ++PFI+EIR++P     N +   +EY  +K++T  II+ FNLKS 
Sbjct: 442 WPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVKELTQGIISHFNLKSG 501

Query: 481 YRAAEFPSPVLKSFYXXXXXXXXXXXXXXXWG--MGFKLSNDITLGKVQHLRELINKSS- 537
           Y A EF +P L   Y                       L  D TL K+  +RE I K + 
Sbjct: 502 YHAEEFRNPALNRHYKLLHDYLLQVEIPQDDNDIRDRYLREDDTLLKITKIRERIMKDTT 561

Query: 538 -QNMEQPILAKYMKYWNTYYNK 558
             ++E+  L+KY++ WN YY K
Sbjct: 562 IDDVEKRRLSKYLEVWNIYYRK 583

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  249 bits (636), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 171/590 (28%), Positives = 282/590 (47%), Gaps = 53/590 (8%)

Query: 22  QSIIVCIELSSRVYQS-SEISPXXXXXXXXXXXXXXXXXXXXXXPNSEVCCYVYQCRRLN 80
           + II C+ELSS ++++  E+                        PN+ +  Y++     +
Sbjct: 30  EGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFYLFHHTSDS 89

Query: 81  V---KDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLAKI 137
           V   K GIYE   L  +NV+ + K++ LL D+ + +  L+D   F+    + L  +   +
Sbjct: 90  VEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPTKLEDIFNVV 149

Query: 138 QHQ-LQGKTTDEWK-FRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFF 195
           Q Q L   +    K F  K++ L T ND P E  + E +KK +  +N L +      TFF
Sbjct: 150 QEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESEIFFSTFF 209

Query: 196 IHSQTRPFNDTFYADLLKPLRRPEDLDKNIQ-YYDG------------------------ 230
           I+     F+DTFY+D+LK     +  + +++ YYD                         
Sbjct: 210 INKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLKDTSKSKTTD 269

Query: 231 ------------PNTXXXXXXXXXXXXXXXXXXXXFHFKCAFIINKQNDFIISLKGFFAI 278
                       PNT                      F+C  I+++ ++FII + G+   
Sbjct: 270 RKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFIIGITGYNIF 329

Query: 279 TQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEA-ADSRLTKVFDIGGLNIEFTEEQD 337
           + EK G R+K +Y+     ++AFS RKF + N GE   D    KV+  G +NIE ++E  
Sbjct: 330 SIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDINIELSDEAT 389

Query: 338 QKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMT 397
           Q + N + E+  F++L+GFRS D    YYNNI  +S+V+PD++ YEGS KT++ L+ ++ 
Sbjct: 390 QNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKTMASLFRTLH 449

Query: 398 KKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLVRLPFIEEIRRFP--QTLQKNRS 455
           KK K AIVWG  +   HP + ++   +    N+G YL ++PF++EIRRFP   +     +
Sbjct: 450 KKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPALTSYSPGTN 509

Query: 456 VNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFYXXXXXXXXXXXXXXXWG--- 512
            NI EY  MKK+T  I+   +L+  YR + + +P L+ +Y                    
Sbjct: 510 KNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIEDTSLTDTPQ 569

Query: 513 --MGFKLSNDITLGKVQHLRELINKSSQNME--QPILAKYMKYWNTYYNK 558
             +  ++  D TL ++  LR+ I +SSQ  E     L+K++++WN  + K
Sbjct: 570 EVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKK 619

>Kwal_33.13360 s33 (183914..188140) [4227 bp, 1408 aa] {ON} YCR042C
            (TAF2) - TATA binding protein-associated factor (TAF)
            [contig 118] FULL
          Length = 1408

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 185  YDDSFSIVTFFIHSQTRPFNDT----FYADLLKPLRRPEDLDKNIQYY 228
            Y+D+  +VT      T   ND+    FY DLL  LRR ++LD+ I  Y
Sbjct: 995  YNDTHYVVTLITSVVTSALNDSEDVSFYQDLLHELRRFKNLDQWIPSY 1042

>KNAG0H03100 Chr8 (584089..584865) [777 bp, 258 aa] {ON} Anc_8.251
           YDR106W
          Length = 258

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 103 SQLLSDIKNKKMFL--KDEIPFEEIDGSPLSSVLAKIQHQ 140
           S LLSDI+ +++FL  +D +PFE++   PLS ++ +   Q
Sbjct: 62  SVLLSDIQRRQVFLALQDGVPFEKVTLIPLSMIVYRSMKQ 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,108,592
Number of extensions: 2539619
Number of successful extensions: 8283
Number of sequences better than 10.0: 37
Number of HSP's gapped: 8462
Number of HSP's successfully gapped: 39
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)