Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46188.847ON52752727980.0
SAKL0D01298g8.847ON5514115709e-66
Kwal_27.102248.847ON5464155472e-62
KLTH0C03718g8.847ON5514195272e-59
TDEL0B005108.847ON5504094833e-53
ABL119C8.847ON5373884455e-48
Kpol_1068.38.847ON5664784467e-48
KLLA0D01408g8.847ON5184044411e-47
ZYRO0G14322g8.847ON5504444291e-45
TPHA0I002908.847ON5694703763e-38
Smik_13.4958.847ON5763783102e-29
YMR282C (AEP2)8.847ON5803763074e-29
Skud_13.4548.847ON5803563031e-28
Suva_13.4718.847ON5813723003e-28
KNAG0J002308.847ON4744112593e-23
TBLA0B033108.847ON6134002596e-23
KAFR0B039708.847ON4743992513e-22
CAGL0M03069g8.847ON5484042462e-21
NDAI0K003408.847ON6245701973e-15
NCAS0C003708.847ON4953911892e-14
Smik_14.393.67ON40396760.91
ZYRO0F07238g8.670ON38981741.7
TPHA0C030602.230ON75174732.9
TBLA0I024106.342ON368105723.1
ZYRO0F05368gsingletonON28682713.3
TBLA0E037302.230ON91383723.4
Ecym_64642.28ON310155714.0
NDAI0E034708.427ON49840706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4618
         (527 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...  1082   0.0  
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   224   9e-66
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   215   2e-62
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   207   2e-59
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   190   3e-53
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...   176   5e-48
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   176   7e-48
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   174   1e-47
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   169   1e-45
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   149   3e-38
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   124   2e-29
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   122   4e-29
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   121   1e-28
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   120   3e-28
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   104   3e-23
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   104   6e-23
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   101   3e-22
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...    99   2e-21
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...    80   3e-15
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...    77   2e-14
Smik_14.39 Chr14 (67153..68364) [1212 bp, 403 aa] {ON} YNL292W (...    34   0.91 
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    33   1.7  
TPHA0C03060 Chr3 complement(666031..668286) [2256 bp, 751 aa] {O...    33   2.9  
TBLA0I02410 Chr9 (554763..555869) [1107 bp, 368 aa] {ON} Anc_6.3...    32   3.1  
ZYRO0F05368g Chr6 complement(446808..447668) [861 bp, 286 aa] {O...    32   3.3  
TBLA0E03730 Chr5 complement(928264..931005) [2742 bp, 913 aa] {O...    32   3.4  
Ecym_6464 Chr6 complement(898624..899556) [933 bp, 310 aa] {ON} ...    32   4.0  
NDAI0E03470 Chr5 (745331..746827) [1497 bp, 498 aa] {ON} Anc_8.4...    32   6.3  

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score = 1082 bits (2798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/527 (98%), Positives = 521/527 (98%)

Query: 1   MSYGRQFVRIIKRVNSSTSNLDANVANGISSDTLQARAMVFHKQYDPVRVERKALKNTLS 60
           MSYGRQFVRIIKRVNSSTSNLDANVANGISSDTLQARAMVFHKQYDPVRVERKALKNTLS
Sbjct: 1   MSYGRQFVRIIKRVNSSTSNLDANVANGISSDTLQARAMVFHKQYDPVRVERKALKNTLS 60

Query: 61  KSYLYENDKYQMLRSFLDDTKLSGDVHPGGLPACQEMSSEEFSIFFNRLLPTSGSSFSLK 120
           KSYLYENDKYQMLRSFLDDTKLSGDVHPGGLPACQEMSSEEFSIFFNRLLPTSGSSFSLK
Sbjct: 61  KSYLYENDKYQMLRSFLDDTKLSGDVHPGGLPACQEMSSEEFSIFFNRLLPTSGSSFSLK 120

Query: 121 EAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQ 180
           EAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQ
Sbjct: 121 EAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQ 180

Query: 181 QILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTPKVQSACYDKLVRGSRRPKYVVYNS 240
           QILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTPKVQSACYDKLVRGSRRPKYVVYNS
Sbjct: 181 QILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTPKVQSACYDKLVRGSRRPKYVVYNS 240

Query: 241 LPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKK 300
           LPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKK
Sbjct: 241 LPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKK 300

Query: 301 VEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLEKAVRLVDAFLNKYPQMDLRTEFWEKL 360
           VEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLEKAVRLVDAFLNKYPQMDLRTEFWEKL
Sbjct: 301 VEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLEKAVRLVDAFLNKYPQMDLRTEFWEKL 360

Query: 361 FLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDA 420
           FLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDA
Sbjct: 361 FLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDA 420

Query: 421 MAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEK 480
           MAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEK
Sbjct: 421 MAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEK 480

Query: 481 ELQDTFQRHWNKYTIRQEKRRSSARNKQLKLQXXXXXXFSLTGVQLW 527
           ELQDTFQRHWNKYTIRQEKRRSSARNKQLKLQ      FSLTGVQLW
Sbjct: 481 ELQDTFQRHWNKYTIRQEKRRSSARNKQLKLQDDDDDDFSLTGVQLW 527

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  224 bits (570), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 224/411 (54%), Gaps = 10/411 (2%)

Query: 101 EFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLN 160
           E+S+F N+LL  +     L   IP  +   +  KLY+ Y   +        TP++L+DLN
Sbjct: 133 EYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVV--GNATLTPVQLYDLN 190

Query: 161 KFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTPKVQS 220
           +F   F  + +L  A++VL  +L   GS  +PRD QTL+ Y +L  G++   W  P  + 
Sbjct: 191 QFIKRFTGDAQLAKAQQVLGFVLENYGS--IPRDPQTLINYLELKCGAMPRNWSIPLSRP 248

Query: 221 ACYDKLVRGSRRPKYV-VYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLCHYN 279
                L   S        Y  L    +  ++ +++++  W + R+ +L+A ++YSL +  
Sbjct: 249 ELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMG 308

Query: 280 RMDLFEGFMERAWGI-VDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLEKAVR 338
           +  L E +++  WG+ V      E EVP ++    YP S +LI+IV+ ++ + +L +A++
Sbjct: 309 QFALLERYIKHTWGVSVSSNTSTEVEVPKNL----YPTSNLLISIVSCYAMKGNLHQALQ 364

Query: 339 LVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSRGESVP 398
           ++D+FL+K+PQ++L   FW +LF W+  ++++K DP G L   CW  M  W+  +  S+P
Sbjct: 365 IIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLP 424

Query: 399 YSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIRELSA 458
               + + RY +LK+T+N+ +A+ +  + ++ +Y K       + V++K+QK ++++++ 
Sbjct: 425 IDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAG 484

Query: 459 RGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQEKRRSSARNKQL 509
           RG      ++I +W  N+ NE E+++ F RH   Y  R E+R+      Q+
Sbjct: 485 RGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQV 535

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  215 bits (547), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/415 (30%), Positives = 211/415 (50%), Gaps = 12/415 (2%)

Query: 97  MSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMEL 156
           ++  EFS   N LL     S  L+  +P      +   LYQ Y+  +         P++L
Sbjct: 124 LTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTI---PAGSLNPLQL 180

Query: 157 HDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPT- 215
           HDLN F  +F+   +L  A+ VL +IL  + ++QLP D  T + Y QL  G+L   W   
Sbjct: 181 HDLNSFVQYFIETAQLGKAQIVLDRIL-ASNNDQLPCDTTTGIHYLQLRCGALPRNWKVF 239

Query: 216 -PKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLL-ENDDWKHLRSSELDAKILY 273
             +V  +C     R   +P    Y +L +  + + +  L  EN +W H +S  L+A ++Y
Sbjct: 240 DSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIY 299

Query: 274 SLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDL 333
           SL    ++ L +  +   WGI +    +  EV     +   P  EVLIAI TSF+   ++
Sbjct: 300 SLGFMGQLTLLKEHIAVRWGITELGASLATEV-----NEVPPSPEVLIAIFTSFASHQEV 354

Query: 334 EKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSR 393
              +RL+DAF+ KY +++L   FW +LF WT +++D K DP G L + CW  M  W++  
Sbjct: 355 TLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKG 414

Query: 394 GESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVI 453
            + +   + L + RY +L QT+NYK+A+ +       +Y K   +   + +V+KY K V+
Sbjct: 415 SKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVL 474

Query: 454 RELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQEKRRSSARNKQ 508
           + ++  G       FI +W  N+  E  L+  F++H + +T R+E+ R  +R KQ
Sbjct: 475 KSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKRKERLREESRRKQ 529

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  207 bits (527), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 123/419 (29%), Positives = 219/419 (52%), Gaps = 18/419 (4%)

Query: 96  EMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPME 155
           ++S  EFS F   LL  +     L   +P      +   LYQ Y+  +        +P++
Sbjct: 128 DLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTV---TPGPLSPLQ 184

Query: 156 LHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPT 215
           LHD NKF  +F+   +L+ A+ VL  IL+ + + QLP D  T   Y QL  G+L   W  
Sbjct: 185 LHDFNKFIRFFIRSAQLRKAQTVLDCILK-SNNNQLPCDSATATHYLQLRCGALPRNW-- 241

Query: 216 PKVQSACYDKLVR-GSRRPKYVV----YNSLPEGIMYDVLQKLLENDD-WKHLRSSELDA 269
            KV      +  R G+R+ +Y +    Y +L    +   +  L +    W H +S+ L++
Sbjct: 242 -KVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALES 300

Query: 270 KILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSY 329
            ++YSL    ++ L E  + R WGI      +++   V  +S T P SEVL+A++TS++ 
Sbjct: 301 AVVYSLGFMGQLKLLEEHVWRNWGI-----SLQEHNQVTDASFTSPSSEVLVAVLTSYAS 355

Query: 330 RNDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSW 389
             ++  A+ L+D F+ KYP ++L   FW +LF W+  ++  K DP G L + CW  M  W
Sbjct: 356 NKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREW 415

Query: 390 YKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQ 449
           + +R   +P  + L + R+ +L +T+NY+DA+ +     S+ + K+  ++H   + +K+ 
Sbjct: 416 HAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFA 475

Query: 450 KFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQEKRRSSARNKQ 508
           K +++ ++  G      +FI++W  N+  E  L+  F++H N Y+ R+++R  +A+  Q
Sbjct: 476 KLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQ 534

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  190 bits (483), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 115/409 (28%), Positives = 211/409 (51%), Gaps = 14/409 (3%)

Query: 95  QEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPM 154
           +E+S+ EFS F NRLL        L   IP+ +   +   LYQ Y   + ++ +   TP+
Sbjct: 124 KELSTSEFSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLTPL 183

Query: 155 ELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPR--DHQTLVTYFQLYLGSLASL 212
           ++HD+N+F   F++E +LK A++ LQ ++ + G   + +  D +T+  + QL  G+L   
Sbjct: 184 QVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKF 243

Query: 213 WPTPKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKIL 272
           W      +    +  +  + PK   YN L E    +++  LL++  W+   S  +D+ I+
Sbjct: 244 WRVDSNSTKVLGEDSKHFKSPK--SYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIV 301

Query: 273 YSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRN- 331
           YSL +  +  L + +++  WGI        ++  V + +   PG EVLI IV+++  +N 
Sbjct: 302 YSLSNLGQTKLIDQYIQLKWGI-------SEDGHVAVKNEAVPGHEVLINIVSAYCLKNG 354

Query: 332 DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYK 391
           D  K +R++D F+ KYPQ +L   FW +L   +   +D++ D    +   CW  M  W++
Sbjct: 355 DTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHE 414

Query: 392 SRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKS--AAAKHNLTVVRKYQ 449
            +G S+ Y S      Y++ K T N + A  +     S+VYAK     +K  + ++  +Q
Sbjct: 415 QKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQ 474

Query: 450 KFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQE 498
           K  ++ ++ +G+ +   Q I++W  ++ N+  L D F RH  KY + ++
Sbjct: 475 KLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRD 523

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score =  176 bits (445), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 111/388 (28%), Positives = 185/388 (47%), Gaps = 17/388 (4%)

Query: 100 EEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDL 159
           E FS+F +RLLPT   S  LK  + ++  + L  KLY FY          R +P  LHD 
Sbjct: 131 EGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDA 190

Query: 160 NKFSNWFLNENKLKLARKVLQQIL-RQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTPKV 218
           N F+ WF+ E+KL+LAR V  +++   T   +LPRD +T++T  QL+LG+    W  P  
Sbjct: 191 NSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGN 250

Query: 219 QSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLCHY 278
                 +L   +       YNSL E  +  +L+ L  +  WK + S +LD  I+ +L  +
Sbjct: 251 SVGRGGQLFTPAHMAVVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDLDRNIILALAFH 310

Query: 279 NRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLEKAVR 338
           NR+DL      R +        +        S+   P   ++ A+VT+F++++ L + + 
Sbjct: 311 NRLDLVHAQAARYYAPAAPGHGLP-------STPLLPDGALVGAVVTAFAFKHQLAQGLA 363

Query: 339 LVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKA----CWLRMLSWYKSRG 394
           +   FL+++  +    E W+ +F W       +  P GS   A     W +M + Y   G
Sbjct: 364 IAYQFLDRFTHLPNEHELWKIIFTWL-----ARRHPTGSQGAALYDEAWSKMRTRYAEHG 418

Query: 395 ESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIR 454
           +  PY   +A   Y I+++ S+ +   A+  DYMS +Y + A A  +  ++ K Q  ++ 
Sbjct: 419 QPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVG 478

Query: 455 ELSARGKRDACTQFIEQWRFNEENEKEL 482
            L    +  A   F++QW  + E    L
Sbjct: 479 RLVRARRNSAAADFVDQWALDSEARSHL 506

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  176 bits (446), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 123/478 (25%), Positives = 228/478 (47%), Gaps = 40/478 (8%)

Query: 38  AMVFHKQYDPVRVERKALKNTLSKSYLYEN--DKY--QMLRSFLDDTKLSGDVHPGGLPA 93
           ++V  +  + +  +   L   + ++YL  N  DK+   +L S   D     ++   G   
Sbjct: 62  SLVHSRNSNTIIKQSDVLPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSG--- 118

Query: 94  CQEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVP---LANKLYQFYMAILEREKKT- 149
             +++  E SIF NR+  ++G    +K  I  +  +    L  ++++ Y + + +E    
Sbjct: 119 --DLTYNELSIFINRIYKSNGHD--IKRVIQNHHSLSYTELIYEIFELYTSTIPKESGII 174

Query: 150 RFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSL 209
           +   + L DLN F   F+ E +L  A+ VLQ I+   GS +   DH T+V + +L  G L
Sbjct: 175 KLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGL 234

Query: 210 ASLWPTPKVQSACYDKLVRGSR--------RPKYVVYNSLPEGIMYDVLQKLLENDDWKH 261
              W  P+   A   +  + SR        R      +++P  ++++V+  +L    WK 
Sbjct: 235 PKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKS 294

Query: 262 LRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDI-----SSGTYPG 316
             S  LD+ I+YSL H  +  + +GF++  WGI  H        P+D+        + P 
Sbjct: 295 KHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGD------PLDLFIKKKKVASAPS 348

Query: 317 SEVLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPL 375
           +E+LIAI++S+ Y++ +++ A++++D F+  YP + L   FW +L  W   ++D K+D  
Sbjct: 349 NEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQ 408

Query: 376 GSLQKACWLRMLSWYKS-RGESV--PYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVY 432
           G+    CW  M +W  +  G+ V  PY   +    Y + K+T+N K A  +  + +    
Sbjct: 409 GTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHL 468

Query: 433 AKS--AAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQR 488
           ++   A  K  L ++ KYQ   +  L  R +      FIE+W  +  N  +L++ F++
Sbjct: 469 SEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKK 526

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  174 bits (441), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/404 (26%), Positives = 203/404 (50%), Gaps = 23/404 (5%)

Query: 95  QEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPM 154
           ++++ E++S+F N+L+        L           +   LY  Y   +          M
Sbjct: 95  EKLTPEDYSVFVNQLMDVYSKDIELLNK------TEVWKSLYHIYRVFVVNAVDDG-NAM 147

Query: 155 ELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWP 214
            L+DLN+F   F+N N L LAR V Q IL+ + + ++P+D QT+  Y +LY G+L+ LW 
Sbjct: 148 VLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELWT 207

Query: 215 TPKVQSACYDKL--VRGS-----RRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSEL 267
           T   ++   D +  + GS     R P ++ Y ++       +L+KL+E+ ++  LR++E+
Sbjct: 208 TQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTEM 267

Query: 268 DAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSF 327
           D+ I+ +L HY  +   + ++   +GI ++    E    +       P S++L ++++++
Sbjct: 268 DSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGI---KKLTPDSQLLKSVISAY 324

Query: 328 SYRNDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRML 387
            + N++   + ++ +F+ KYP+M+L   FW     W+   +++  D  GS  K  W  ML
Sbjct: 325 GHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAWNLML 384

Query: 388 SWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVR- 446
           +WY + G++VP+   +   R   LK   ++  A+         ++ K+   K+   V R 
Sbjct: 385 NWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKT--EKNTFIVERL 442

Query: 447 ---KYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQ 487
               YQ+F+I+ L  + +   C  FI +WR + EN + L+  F+
Sbjct: 443 VLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFK 486

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  169 bits (429), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 124/444 (27%), Positives = 215/444 (48%), Gaps = 31/444 (6%)

Query: 77  LDDTKLSGDVHPGGLPACQEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLY 136
           L++  +SG    GGL      +  E+S+F N+LL        L   IP+     L  KLY
Sbjct: 113 LNNEYISGLFTTGGL------TKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLY 166

Query: 137 QFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQIL-RQTGSEQLPR-D 194
           +FY   +  +     TP++L+DLN F   F+ E +L  A  VL  IL R+  ++ L   D
Sbjct: 167 EFYCDHIVDQHN--LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTD 224

Query: 195 HQTLVTYFQLYLGSLASLW---PTPKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQ 251
            + L+ + +L  G+L+  W   P  +  S       + S       Y    E ++  ++ 
Sbjct: 225 VEILIQFLRLKCGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIIN 284

Query: 252 KLLENDDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISS 311
            +L   +WK+ RS +LDA I+YSL +  + DL E ++ R W     P K       D   
Sbjct: 285 SVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWS----PSK-------DEGV 333

Query: 312 GTYPGSEVLIAIVTSFSYR-NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDR 370
            T P S++L+A++TS+  +  ++ K + ++D F+  YP+++L   FW +L   + +++D+
Sbjct: 334 KTNPNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDK 393

Query: 371 KLDPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFP-DYMS 429
           K D   +L   CW  M  W+  R   +PY   +    Y I  +T N   A+ +    +  
Sbjct: 394 KRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFG 453

Query: 430 AVYAKSAAAKHN-LTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQR 488
           A        + N L+++ KYQ+F+++ ++ +G      +F ++W F+  N+ ELQ  F  
Sbjct: 454 AFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFM- 512

Query: 489 HWNKYTIRQEKRRSSARNKQLKLQ 512
              K+    E+RR+S   ++  LQ
Sbjct: 513 ---KWRGIHEQRRTSQSKQKAALQ 533

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  149 bits (376), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 218/470 (46%), Gaps = 59/470 (12%)

Query: 47  PVRV------ERKALKNTLSKSYLYENDKYQMLRSFLDDTKLSGDVHPGGLPACQEMSSE 100
           PV++      ++  LK  L +   + ++ Y  LR  L+                ++++  
Sbjct: 82  PVQIHWGDLFQKSNLKTILEQLLQHNDNSYMFLRELLE---------------SKQLTFN 126

Query: 101 EFSIFFNRLLPTSG---SSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELH 157
           EFSIF NRL+   G    S  LKE  P      +  KL+Q Y   +  +K    + + L 
Sbjct: 127 EFSIFLNRLIDRKGFIYDSIVLKE-FPNGKHSEMVFKLFQLYGNAIGSDK---LSLLSLR 182

Query: 158 DLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLW--PT 215
           D+N F  +F+NE  L  A  VL  +L +T S     D  T+  Y QL  G+L   W    
Sbjct: 183 DMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQN 242

Query: 216 PKVQSACYDKLVRGSRRPKYVV--------------YNSL-PEGIMYDVLQKLLENDDWK 260
              + A  DK   G+R  KY                Y  L P G++  +  K++ +D WK
Sbjct: 243 KSAELAYKDKF--GNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVL-KIANKIITDDKWK 299

Query: 261 HLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISS-GTYP-GSE 318
              S++LDA ++YSLC+  ++     ++   W +         +V   IS+  + P  SE
Sbjct: 300 SNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSE 359

Query: 319 VLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGS 377
           V+ AI++S+SY +  +E+A+ ++D  +N YP ++L  +FW +L  W+ + +D KLD  GS
Sbjct: 360 VMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGS 419

Query: 378 LQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAA 437
           L   C+  +  +++ R   + +   L    Y ++  T N + A  +  ++M   + K + 
Sbjct: 420 LVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRS- 478

Query: 438 AKHNLTVVRKYQKFVIRELSAR---GKRD--ACTQFIEQWRFNEENEKEL 482
               +T   +   F  ++ S     GK+D    + FIE+W  + +N++EL
Sbjct: 479 --DEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEEL 526

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  124 bits (310), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 98/378 (25%), Positives = 181/378 (47%), Gaps = 28/378 (7%)

Query: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLP---RDHQTLVTYFQ 203
           + T     E+ D+N     F+   +L  A+K+L  I+ +     L     D  T+V + +
Sbjct: 187 RNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLK 246

Query: 204 LYLGSLASLWPTPKVQSACYD-----KLVRGSRRPKYVVYNSLPEGIMYDVLQKL--LEN 256
           L  G+LA+ W  P   ++  D     K+VR   +   +  +S  + + +  L K+  L  
Sbjct: 247 LRCGALAAYWKIP--DNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVL 304

Query: 257 DDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDIS---SGT 313
            + + L S +L + ++ S  H  +  + E  +E  W I        +E P  ++    G 
Sbjct: 305 HEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHIT------TQEFPSHVAIKPRGC 358

Query: 314 YPGSEVLIAIVTSFSYR-NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKL 372
           YP S++LI+I+ SF Y  NDL + + ++D+F+  YP++ L   FW +LF  +   +    
Sbjct: 359 YPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAK 418

Query: 373 DPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAV- 431
           D   +    CW  M  W+ S+G S+          Y+I+K+T N+   + +   + S + 
Sbjct: 419 DKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIE 478

Query: 432 -YAKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHW 490
              ++ + K N+ ++ KYQK++I++L  RG+  A  +FI  + F+    K L + F    
Sbjct: 479 RLRETNSDKLNIVLI-KYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNL-NIFCT-- 534

Query: 491 NKYTIRQEKRRSSARNKQ 508
           N+  +R +K +S   NK+
Sbjct: 535 NRLLLRSKKNKSKIENKK 552

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  122 bits (307), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 182/376 (48%), Gaps = 24/376 (6%)

Query: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQL-PR--DHQTLVTYFQ 203
           + T+    E+ D N     F+   +L  A+K+L  IL +     L P+  D  T+V + Q
Sbjct: 191 RNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQ 250

Query: 204 LYLGSLASLWPTP---KVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKL--LENDD 258
           L  G+LA  W  P   + +     K+VR   +   +  +S  + + +  L K+  L   +
Sbjct: 251 LRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQE 310

Query: 259 WKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSE 318
            K L S +L + ++ S  H  +  + E  +E  W I   P++    V +    G YP S+
Sbjct: 311 KKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQI--SPQEFPSHVVIK-HRGCYPSSK 367

Query: 319 VLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGS 377
           +L++I+ SF + + DL + + ++D+F+  YP + L   FW +LF  +   +    D   +
Sbjct: 368 ILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKAT 427

Query: 378 LQKACWLRMLSWYKSR--GESVPYSSYLASCRYEILKQTSNYK---DAMAMFPDYMSAVY 432
               CW  M  WY S+    SV Y +      Y+I+K+T N+    D +  F   +    
Sbjct: 428 SVVRCWHLMKQWYASKRLRPSVDYETLRQ--LYDIMKKTGNFPLGIDVLRSFKPGIERTR 485

Query: 433 AKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNK 492
           A++A   +N+ +  KYQK +I+EL  RG+  A  +FI+ + F+ +  K+L + F    N+
Sbjct: 486 AENAGKVNNIII--KYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDL-NIFCA--NR 540

Query: 493 YTIRQEKRRSSARNKQ 508
             +R +K ++   NK+
Sbjct: 541 MFLRSKKMKNKIENKK 556

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 167/356 (46%), Gaps = 33/356 (9%)

Query: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQL-PR--DHQTLVTYFQ 203
           + T     E+ DLN     F+   +L  A+K+L  IL +     L PR  D  T+V + Q
Sbjct: 191 RNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQ 250

Query: 204 LYLGSLASLWPTPKVQSACYDKL---VRGSRRPKYVVYNSLPEGIMYDVLQKL--LENDD 258
           L  G+L + W  P       ++L   VR   +   +  +S  + + +  L K+  L   D
Sbjct: 251 LRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQD 310

Query: 259 WKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDIS---SGTYP 315
            + L S +L + ++ S  H  +  + E  +E  W I        +E P  ++    G YP
Sbjct: 311 KRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS------SQEFPSHVAIKPRGCYP 364

Query: 316 GSEVLIAIVTSFSYRN-DLEKAVRLVDAFLNKYPQMDLRTEFWEKL-----FLWTRVMFD 369
            S++LI+I+ SF   + DL + + ++D+F+  YP++ L   FW +L     F WT V   
Sbjct: 365 SSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDK 424

Query: 370 RKLDPLGSLQKACWLRMLSWYKSR--GESVPYSSYLASCRYEILKQTSNYKDAMAMFPDY 427
           R      S+ K CW  M  WY+S+    SV Y +      YE++K+T N+   + +   +
Sbjct: 425 RA----ASIVK-CWHLMKHWYESKELSPSVDYETLRQ--LYEVMKKTGNFSLGIDVLKSF 477

Query: 428 MSAVYAKSAAAKHNL-TVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKEL 482
            S +     A    L  ++ KYQK +I++L  RGK  A  +FI  + FN    K+L
Sbjct: 478 KSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDL 533

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  120 bits (300), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 94/372 (25%), Positives = 175/372 (47%), Gaps = 16/372 (4%)

Query: 147 KKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQL-PR--DHQTLVTYFQ 203
           + T     E+ D+N     F+   +L  A+KVL  IL +     L P+  D  T++ + Q
Sbjct: 192 RNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQ 251

Query: 204 LYLGSLASLWPTPKVQSACYD-KLVR-GSRRPKYVV---YNSLPEGIMYDVLQKLLENDD 258
           L  G+LA+ W  P      Y  K+VR G++     +   Y ++    +  +   +L+ + 
Sbjct: 252 LRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKE- 310

Query: 259 WKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSE 318
            + L S +L + ++ S  H  +  + E  +E  W I          +    + G  P S+
Sbjct: 311 -RLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPK-TRGCCPSSK 368

Query: 319 VLIAIVTSFSYR-NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGS 377
           +LI+I+ SF    NDL + + ++D+F+  YP++ +   FW +LF  +   +    D   +
Sbjct: 369 ILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRAT 428

Query: 378 LQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAA 437
               CW  M  W++S+G S+          Y++ K+T NY   + +  ++   +   SA 
Sbjct: 429 SIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAM 488

Query: 438 AKHNLT-VVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIR 496
               +  +V K+QK++I++L  RGK  A  +FI  + F+    KEL + F    N+  +R
Sbjct: 489 KTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKEL-NVFCT--NRILLR 545

Query: 497 QEKRRSSARNKQ 508
            +K ++   N++
Sbjct: 546 SKKLKNKTENRK 557

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 100/411 (24%), Positives = 190/411 (46%), Gaps = 49/411 (11%)

Query: 98  SSEEFSIFFNRLLPTSG-SSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMEL 156
           ++ +FS+  NR+L +        KE + +   + +    Y+  +A+    +  + T ++L
Sbjct: 86  TAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIFMR---YKGAIAL----QSNKLTQIQL 138

Query: 157 HDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTP 216
           HD N   ++F+  N+LK A+ ++  +L+Q     +  D   +  Y +L  GS        
Sbjct: 139 HDFNLMCDYFIACNQLKKAQLIMDFLLQQ----DVKFDVFMIKNYTKLRCGS-------- 186

Query: 217 KVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLC 276
                       G +      Y    +  ++ ++ K +E D     + +  + +I+ SL 
Sbjct: 187 ----------SFGKQTLNNKAYKVFDQNTVFQLIGK-VEADR----KFAFWNNEIVSSLG 231

Query: 277 HYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDI---SSGTYPGSEVLIAIVTSFSYRND- 332
           + N + L E ++   W I  H    E  + +D        YP S+VL  IV+S++ R+D 
Sbjct: 232 YTNNITLMEIYIWDLWRISIHDHSTE-NIKIDHLQQGDAMYPSSKVLATIVSSYA-RHDQ 289

Query: 333 -LEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYK 391
            +++AV +V+ F   YP++ L   FW  L L   +      DP   L  ACW  M  W+ 
Sbjct: 290 TMKRAVDIVERFAKSYPKLLLNVHFWSTL-LNCAIKCGGSKDPSQFL--ACWNLMKKWHT 346

Query: 392 SRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSA-AAKHNLTVVRKYQK 450
            R + +P+ S L       ++QTSN    + +   ++  +Y K     +    V+ KYQK
Sbjct: 347 QRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQK 406

Query: 451 FVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQEKRR 501
            ++R+L  + K + CT FI+QW  +  N+++L+  ++   ++  +R+ K R
Sbjct: 407 QILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYE---SRVDVRESKTR 454

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  104 bits (259), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 94/400 (23%), Positives = 175/400 (43%), Gaps = 50/400 (12%)

Query: 117 FSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLAR 176
           F + +   E +  P+ N     ++  +     T   P++L+DLNK   WF+   +LK A 
Sbjct: 187 FKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKAT 246

Query: 177 KVLQQILRQTGSE--QLPRDHQTLVTYFQLYLGSLASLWPTPKV-------QSACYDKLV 227
             L  IL++  +E  Q+P D +T++ + +LY G L + W    +       Q     KL 
Sbjct: 247 TALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLG 305

Query: 228 RGS---RRPKYVVYNSLPEGIMYDVLQKLLENDD--------WKHLRSSELDAKILYSLC 276
             S   R P    Y ++ E +   +++ + +N +        +  +R+ E D+ ++YSL 
Sbjct: 306 NNSSYYRLPS--SYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLT 363

Query: 277 HYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYR--NDLE 334
              R DL E + +  W + D    VE              S+++IAI +S+ Y   N++E
Sbjct: 364 SLGRFDLAEQYFKDNW-LSDSCDDVE------------LTSDIVIAIFSSYVYNNSNNIE 410

Query: 335 KAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYK--- 391
           KA +L+   + +YP + L    W ++  W   M+D   D  G +    +  ML++Y    
Sbjct: 411 KANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYC 470

Query: 392 SRGES-----VPYSSYLASCRYEILKQTSNYKDAMAMFPDYM--SAVYAKSAAAKHNLTV 444
           SR  +     +PY+  L    Y +     +    + +  +    S     S     +  +
Sbjct: 471 SRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQI 530

Query: 445 VRKYQKFVIRELSARGK--RDACTQFIEQWRFNEENEKEL 482
           + KYQK +++ L    K   +    FIE++  +  N+++L
Sbjct: 531 LLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQL 570

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 97/399 (24%), Positives = 180/399 (45%), Gaps = 56/399 (14%)

Query: 119 LKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKV 178
           +KE  PE     +  +L++ Y+ ++   ++   T +++ D+NKF N+F+   +LK A+ V
Sbjct: 108 IKERRPE-----IIFQLFETYVKLISSHEE--LTILQVEDMNKFINYFVEFKQLKKAQLV 160

Query: 179 LQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTP----KVQSACYDKLVRGSRRPK 234
           ++ ++ ++       D  T   Y +L  G+   LW T        +   DKLV      K
Sbjct: 161 MKYLILKSPRVLEKYDVSTTRNYLKLNCGACHELWYTNYKIFDFNNTTLDKLV------K 214

Query: 235 YVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGI 294
           Y    SL   I Y           W        D +I++SL +  R+   E ++ + WGI
Sbjct: 215 Y----SLDNKIGY-----------W--------DVEIIHSLGYSGRIRSLEDYILKKWGI 251

Query: 295 VDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRND-LEKAVRLVDAFLNKYPQMDLR 353
                 +     V+ ++   P SEVL AI+  F YR+  + +A+++++ F+N YP ++L+
Sbjct: 252 -----SLCDRAQVN-TTNEAPESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLK 305

Query: 354 TEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSRGESVPYSSYLASCRYEILKQ 413
             FW+         +D K+D  G +    W  M  WY      +P++           K+
Sbjct: 306 ITFWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKK 365

Query: 414 TSNYKDAMAMFPDYMSAVY-AKSAAAKHNLTVVRKYQKFVI-RELSARGKRDACTQFIEQ 471
            +N   A  +F +     Y   +      L V+++YQ F++ R +  +G  +A T FI  
Sbjct: 366 NNNLVLATDIFQNCFHNFYFCATRMNDSELNVIKEYQNFILSRLIEKKGFSNALT-FIND 424

Query: 472 WRFNEENEKELQDTFQRHWNKYTIRQEKRRSSARNKQLK 510
             F+ EN+++L + +         ++ K +   RN+ L+
Sbjct: 425 HCFSLENKRQLMNYYHGR------KEHKLKKMTRNENLE 457

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 100/404 (24%), Positives = 179/404 (44%), Gaps = 45/404 (11%)

Query: 134 KLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQIL---RQTGSEQ 190
           KL Q Y+++           +   D+NKF   F+  ++LK A+  LQ +L   ++ G + 
Sbjct: 145 KLMQIYISLTRTHNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDL 204

Query: 191 LP--RDHQTLVTYFQLYLGSLASLWPTP-----KVQSACYDKLVRGSRRPKYVVYNSLPE 243
           L    D QT+  +  L  G+L  LW          + A Y   + GS R     YN L  
Sbjct: 205 LGPYGDKQTIAHFLMLRSGALQDLWKIDVSNGNNKKQAFYK--INGSHRNVKSTYNVLDS 262

Query: 244 GIMYDVLQKLLE-NDDWKHLRSSELDAKILYS--LC--HYNRMDLFEGFMERAWGI--VD 296
             ++++++ +L  ND   H +    D  IL +  LC  +  +  L E  + + W +  V 
Sbjct: 263 VKLFEIVRYILRYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVS 322

Query: 297 HPKKVEKEVPVDISSGTYPGSEVLIAIVTSFS-YRNDLEKAVRLVDAFLNKYPQMDLRTE 355
            P K    V           S++L AIV+++S     ++  + + D F  K P + ++ +
Sbjct: 323 VPPKYNITVT----------SDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDD 372

Query: 356 FWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYKS--RGESVPYSSYLASCRYEILKQ 413
           FW  L  W  ++   K      L K  W  M SW  S   G  +  +    +  Y++L  
Sbjct: 373 FWINLQKWN-IILPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVL-- 429

Query: 414 TSNY---KD---AMAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQ 467
           +S+Y   KD      +F   +  +Y+K++     + +++K+Q F I+++   G    C Q
Sbjct: 430 SSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQ 489

Query: 468 FIEQWRFNEENEKELQDTF----QRHWNKYTIRQEKRRSSARNK 507
           FI++W ++  N+++L + F     R+  K    QEK  +  + K
Sbjct: 490 FIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKK 533

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 135/570 (23%), Positives = 239/570 (41%), Gaps = 82/570 (14%)

Query: 5   RQFVRIIKRVN--SSTSNLDA-----NVANGISSDTLQARAMVFHKQYDPVRVE---RKA 54
           RQ +R+  R    SS S LD      +  N +  D L          ++P + +   R +
Sbjct: 36  RQVIRMFSRAKTLSSPSTLDELPNNRSSENALIDDQLSKTNTKKRYTFNPKKKQPLIRTS 95

Query: 55  LKNTLSKS---------YLYENDKYQMLRSFLDDTKLSGDVHPGGLPACQE-------MS 98
           LK T+  S          L + D  ++L + LD    S +         +E       +S
Sbjct: 96  LKPTIHNSKARKGLLHLLLAQKDNGKVLTTILDHCLYSPNEQATTRQLVKENNHLTTLLS 155

Query: 99  SEEFSIFFNRLLPTSGSSFSLK-----------EAIPENMVVPLANKLYQFYMAILEREK 147
            EE SIF  R+L    +  S K           E     ++  L N     Y        
Sbjct: 156 HEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYC-----NN 210

Query: 148 KTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQIL-RQTGSEQL--PRDHQTLVTYFQL 204
             +  P+ ++DLN+F  +FL E +LK A+ VL  I+ R  G EQL   +D  TL  + +L
Sbjct: 211 TNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKL 270

Query: 205 YLGSLASLW-PTPKVQSACYDKLVRGSRRPK------YVVYNSLPEGIMYDVLQKLLEND 257
             G++   W P    +S  + +  R S   K      +  Y  L    +  ++  +L   
Sbjct: 271 KNGAIYKNWKPLTDSESNTFLQ-YRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLT-- 327

Query: 258 DWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTY-PG 316
           D  H  +  L+  ILYSL    +++  E F+++ W +  HP    +E    +      P 
Sbjct: 328 DKTHCLNI-LNESILYSLGTLRQIEFMEHFIKQIWDV--HPDDAVEERNHQLDKYNLPPD 384

Query: 317 SEVLIAIVTSF--SYRNDLEKAVRLVDAFLNKYPQ-MDLR---TEFWEKLFLWTRVMFDR 370
           +  LIAI+TS+  +Y++ +++A  L+D  + KYP+ M  R    +FW K+  W   + D+
Sbjct: 385 TNELIAILTSYCQTYKS-MDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADK 443

Query: 371 KLDPL-GSLQKACWLRMLSWY-KSRGESV--------PYSSYLASCRYEILKQTSNYKDA 420
             + + G+    C   M  W+ K + ++          Y S L +  + I+K+  N    
Sbjct: 444 NGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIG 503

Query: 421 MAMFPDYMSAVYAKSAAA--KHNLT-VVRKYQKFVIRELSARGKRDACTQFIEQWRFNEE 477
           +    +++  +   S     + NLT V+   QK + R+++  G  +     I+   + + 
Sbjct: 504 LKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGLALIDNGAYTQN 563

Query: 478 NEKELQDTFQRHWNKYTIRQEKRRSSARNK 507
           +  E   +  R +   T+++ + + S RNK
Sbjct: 564 SGVE---SMLREYYITTVKEIRSKRSRRNK 590

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/391 (21%), Positives = 173/391 (44%), Gaps = 44/391 (11%)

Query: 95  QEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPM 154
           +  + EE+S+F  ++L    S  +          V +  +L++ Y  +   E       +
Sbjct: 98  EHFTLEEYSLFLGKVLSMKDSDVN----------VNVVFQLFEIYARMYCGEGS--LNAL 145

Query: 155 ELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVT---YFQLYLGSLAS 211
           +++DLNK   +F+  ++LK  + VL  I+ + G  +    H+ L++   + +L  GSL  
Sbjct: 146 QIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVK 205

Query: 212 LWPTPKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKI 271
            W     ++  Y +  +G    K++   SL +      +  L+ ND  K    + L   I
Sbjct: 206 DWKFEG-KNLRYLQSRQGRLNYKFLDGWSLLK------IADLVLNDPMKC--QNVLTNSI 256

Query: 272 LYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYR- 330
           +YSL H  +++L + F+++ W     P+          +   YP +  +IAI+TS+ Y  
Sbjct: 257 IYSLGHLRQVELLDHFIDQMWMQETRPR----------NGLLYPDTNNIIAIITSYCYNY 306

Query: 331 NDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWY 390
            +++K+  ++D  L KY  +     FW +LF W  ++ +   +  G +   CW  M    
Sbjct: 307 GNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWC-ILTEPNANK-GFILGQCWSLM---- 360

Query: 391 KSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQK 450
             + E V +   L     E + +  +   A+ +    +  +   +   + ++ ++ KYQK
Sbjct: 361 -EKQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQK 419

Query: 451 FVIRELSARGKRDACTQFI--EQWRFNEENE 479
           FV  +L    K     + +  + +  N+EN+
Sbjct: 420 FVFSKLGEINKTVKAMELLSCDDYTINKENK 450

>Smik_14.39 Chr14 (67153..68364) [1212 bp, 403 aa] {ON} YNL292W
           (REAL)
          Length = 403

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 38/96 (39%), Gaps = 26/96 (27%)

Query: 254 LENDDWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWG--------------IVDHPK 299
           L+  DW   R++      ++ L  +   D      E+ WG              +++  K
Sbjct: 308 LQQQDWSLERNN------VFQLADFTERD------EKVWGKVLKKVLDEGASVDVIEELK 355

Query: 300 KVEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLEK 335
           K EKEVP D+  GT P  +     +T      D+E+
Sbjct: 356 KAEKEVPADVKEGTVPNDQFESETITETKETADVEQ 391

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query: 218 VQSACYDKLVRGSRRPKYVVYNSLPE-----GIMYDVLQKLLEN-----DDWKHLRSSEL 267
           V S+  D+L+  + RPK +V  ++P+      I+  +    LEN     DD + L+  EL
Sbjct: 167 VTSSSEDELLENNVRPKAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIEL 226

Query: 268 D---AKILYSLCHYNRMDLFE 285
           D    +  YS   Y R ++F+
Sbjct: 227 DFLTHEAAYSFMKYGRTNMFK 247

>TPHA0C03060 Chr3 complement(666031..668286) [2256 bp, 751 aa] {ON}
           Anc_2.230 YNL068C
          Length = 751

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 12/74 (16%)

Query: 439 KHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQE 498
           +HNL++ + ++K V ++ S  GK          WR      K  QD F + WN   I + 
Sbjct: 384 RHNLSLNKAFEK-VAKKSSESGKG-------MNWRI----TKSYQDDFIKKWNSGKITKL 431

Query: 499 KRRSSARNKQLKLQ 512
            RR S+ ++QL+L 
Sbjct: 432 LRRGSSVSRQLQLH 445

>TBLA0I02410 Chr9 (554763..555869) [1107 bp, 368 aa] {ON} Anc_6.342
           YNR032W
          Length = 368

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 13/105 (12%)

Query: 174 LARKVLQQILRQTGSEQLPRDHQTLVTYFQLYL-GSLASLWPTPKVQSACYDKLVRGSRR 232
             R V+++ L+     ++ R HQ     FQ+Y  G + ++W  P     C +K       
Sbjct: 232 FGRSVVEKFLQLNNMSRIYRAHQLCNEGFQIYFDGLVTTVWSAPNYCYRCGNKASILELY 291

Query: 233 PKYVVY----------NSLPEGIMYDVLQKLLENDDWKHLRSSEL 267
            K V Y           SL EG    V+Q+   ND+  ++ SS+L
Sbjct: 292 SKDVYYFNVFEEAPENKSLNEGSTTKVIQEYFNNDN--NISSSQL 334

>ZYRO0F05368g Chr6 complement(446808..447668) [861 bp, 286 aa] {ON}
           no similarity
          Length = 286

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 119 LKEAIPENMVVPLANKLYQFYMAILEREKKTRFTP--MELHDLNKFSNWFLN----ENKL 172
           L  A   + V+   + L  FY   LE +    F+P  M +H    F+ +F+N      K+
Sbjct: 56  LSAAYSSSFVLLAYSSLRGFYDDQLETKLSDIFSPLWMIIHYFLCFTVFFMNFIYHRKKI 115

Query: 173 KLARKVLQQILRQTGSEQLPRD 194
            +  KVLQ++L++ G   L  D
Sbjct: 116 DIETKVLQKLLKEVGEMDLTGD 137

>TBLA0E03730 Chr5 complement(928264..931005) [2742 bp, 913 aa] {ON}
           Anc_2.230 YNL068C
          Length = 913

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 15/83 (18%)

Query: 432 YAKSA---AAKHNLTVVRKYQKFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQR 488
           +AKS    + +HNL++ + ++K V R+ +  GK         +WR NE+ +++L     +
Sbjct: 379 FAKSGWQNSIRHNLSLNKAFEK-VPRKPNEPGKG-------MKWRINEDYQRDLL----K 426

Query: 489 HWNKYTIRQEKRRSSARNKQLKL 511
            WN   I +  RR S+  +QL+L
Sbjct: 427 KWNSGKISKVIRRGSSVTRQLQL 449

>Ecym_6464 Chr6 complement(898624..899556) [933 bp, 310 aa] {ON}
           similar to Ashbya gossypii ABL181W
          Length = 310

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 57/155 (36%), Gaps = 36/155 (23%)

Query: 131 LANKLYQFYMAILEREKKTRFTPMELHDLNKFSNW----FLNENKLKLARKVLQ---QIL 183
           L N       A+L  +K  +F P    D   FS W    F+ E+ +    K+ +   ++ 
Sbjct: 108 LGNHELAILFALLNPKKARKFKPKRKMDPGDFSKWKRISFVTEDYIPQETKIKKMHMRLA 167

Query: 184 RQTGSEQLPR--DHQTLVTYFQLYLGSLASLWPTPKVQSACYDKLVRGSRRPKYVVYNSL 241
           RQ G + L R  DH +   YF L               +A  + L+        V    L
Sbjct: 168 RQLGPDVLDRIADHCSAAAYFNL---------------TATNETLIG-------VHAGIL 205

Query: 242 PEG-----IMYDVLQKLLENDDWKHLRSSELDAKI 271
           P G     I    + K ++ D+W H   +  D  I
Sbjct: 206 PNGFEHFKIADLTMMKFVDADNWNHTSKNRFDNAI 240

>NDAI0E03470 Chr5 (745331..746827) [1497 bp, 498 aa] {ON} Anc_8.427
           YLR227C
          Length = 498

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 4/40 (10%)

Query: 314 YPGSEVLIAIVTSFSYRNDLEKAVRLVDAFLNKYPQMDLR 353
           YP  EV+  I  + SYRN   K V+ +   +NKYP++DLR
Sbjct: 57  YP-MEVIQCIFNNKSYRN---KIVKCLGNEINKYPELDLR 92

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,779,398
Number of extensions: 2489040
Number of successful extensions: 8064
Number of sequences better than 10.0: 36
Number of HSP's gapped: 8233
Number of HSP's successfully gapped: 37
Length of query: 527
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 413
Effective length of database: 40,409,475
Effective search space: 16689113175
Effective search space used: 16689113175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)