Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46178.846ON24924913280.0
ABL120W8.846ON2492499521e-131
SAKL0D01320g8.846ON2602515855e-75
KLLA0D01430g8.846ON2632465326e-67
Kwal_27.102278.846ON2542525282e-66
KLTH0C03740g8.846ON2542465142e-64
TDEL0B005208.846ON2682604823e-59
NDAI0K003308.846ON3132944811e-58
NCAS0C003808.846ON2762214754e-58
ZYRO0G14300g8.846ON2802674712e-57
Smik_13.4948.846ON3042854565e-55
KAFR0B039608.846ON2782674521e-54
KNAG0J002408.846ON2862754485e-54
Suva_13.4708.846ON3032864495e-54
Skud_13.4538.846ON3002824471e-53
YMR281W (GPI12)8.846ON3042864471e-53
TPHA0I002808.846ON3012954392e-52
Kpol_1068.48.846ON2912784251e-50
CAGL0M03047g8.846ON3042834113e-48
TBLA0B033008.846ON3193053897e-45
TDEL0E011604.254ON42379800.12
KNAG0D044104.254ON42879770.27
NCAS0A025104.254ON42679730.86
SAKL0H02860g4.254ON42179711.3
Kwal_23.42104.254ON42279702.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4617
         (249 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   516   0.0  
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   371   e-131
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   229   5e-75
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   209   6e-67
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   207   2e-66
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   202   2e-64
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   190   3e-59
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   189   1e-58
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   187   4e-58
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   186   2e-57
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   180   5e-55
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   178   1e-54
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   177   5e-54
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   177   5e-54
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   176   1e-53
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   176   1e-53
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   173   2e-52
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   168   1e-50
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   162   3e-48
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   154   7e-45
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    35   0.12 
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    34   0.27 
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    33   0.86 
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    32   1.3  
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    32   2.0  

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/249 (100%), Positives = 249/249 (100%)

Query: 1   MFGSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMF 60
           MFGSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMF
Sbjct: 1   MFGSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMF 60

Query: 61  FAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFK 120
           FAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFK
Sbjct: 61  FAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFK 120

Query: 121 DGMDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHHTLHLDS 180
           DGMDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHHTLHLDS
Sbjct: 121 DGMDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHHTLHLDS 180

Query: 181 GHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTA 240
           GHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTA
Sbjct: 181 GHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTA 240

Query: 241 SRYVYANEF 249
           SRYVYANEF
Sbjct: 241 SRYVYANEF 249

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  371 bits (952), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 208/249 (83%)

Query: 1   MFGSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMF 60
           MFGSFFAV+KLYL+LLAVYC S + LE HN++V+E LVG    +TS+TL+IAHPDDEVMF
Sbjct: 1   MFGSFFAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMF 60

Query: 61  FAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFK 120
           FAPTLLQLDAR+   +PFRVVCLTDG A+GLG++RR EL KALRLLVLE DV +++  F 
Sbjct: 61  FAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFT 120

Query: 121 DGMDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHHTLHLDS 180
           DGM E+W +  VR  L ++VTD +PLVLTFDERGVSGHRNHI CA AAA+LGH TL L S
Sbjct: 121 DGMKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARLGHKTLFLRS 180

Query: 181 GHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTA 240
             NL+RKYSFF +D+FR++FG P PTVF+ST +QYLH+LV M+VAH+SQMVWFRWGWW A
Sbjct: 181 ERNLLRKYSFFVLDVFRVVFGTPPPTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMA 240

Query: 241 SRYVYANEF 249
           SRYVYANE+
Sbjct: 241 SRYVYANEY 249

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  229 bits (585), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 155/251 (61%), Gaps = 11/251 (4%)

Query: 8   VIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTLLQ 67
           ++K Y +L  +Y    + +  HN +V+  +  S    TSV LI+AHPDDE MFF+PTLLQ
Sbjct: 10  LLKAYALLSVLYICVSQRIAAHNRQVFRNVFPSR-TPTSVNLIVAHPDDETMFFSPTLLQ 68

Query: 68  LDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGMDEEW 127
           L      SVP RV+CLT+GDADGLG VR +EL  +++LL+  R+  + + GF+DGM  EW
Sbjct: 69  LHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEW 128

Query: 128 KMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHH---------TLHL 178
               V   + + V+D  PL+LTFDE GVSGH NH++C  A + L             L+L
Sbjct: 129 DTRQVVATINRHVSDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYL 188

Query: 179 DSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWW 238
           +S      KY  F VDL R++ G   P VF+STF QYL SL  M  AH SQMVWFRWGWW
Sbjct: 189 NSKRYFPPKYGSFAVDLARIITGR-QPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWW 247

Query: 239 TASRYVYANEF 249
            ASR+V+ NE 
Sbjct: 248 LASRFVFVNEL 258

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  209 bits (532), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 145/246 (58%), Gaps = 8/246 (3%)

Query: 12  YLVLLAVYCGSYKHLETHNSKVYEYLVGSH--GNYTSVTLIIAHPDDEVMFFAPTLLQLD 69
           YLV L +Y    K ++ HN   +  LV        TSVTL++AHPDDEVMFF+PTL Q +
Sbjct: 14  YLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFN 73

Query: 70  ARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGMDEEWKM 129
             +  S+P  VVC+T GDADGLG +R++EL  +LR++   R     +  F+DGMD  W  
Sbjct: 74  ELLPISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQ 133

Query: 130 EVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGH-HTLHLDSGHNLIRKY 188
            ++ ++L   + D  PLVLTFD+ GVSGH NHI+C     KL + H LHL S   +  KY
Sbjct: 134 VLLEKQLRSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHKLHLRSDQPIYVKY 193

Query: 189 SFFFVDLFRLLFG-----YPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRY 243
           S F   +F+L        Y  P  F+ST  QYL +   M +AH SQMVWFR GWW  SR+
Sbjct: 194 SAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRF 253

Query: 244 VYANEF 249
            + NE 
Sbjct: 254 CFINEL 259

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  207 bits (528), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 113/252 (44%), Positives = 148/252 (58%), Gaps = 7/252 (2%)

Query: 3   GSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFA 62
           G+F  V K+  +L  VY      +E  N +    L       TS+ L+IAHPDDEVMFFA
Sbjct: 2   GAFRTVFKVSGILWLVYILGSVQIERSNRRALGSLFRGSAP-TSINLVIAHPDDEVMFFA 60

Query: 63  PTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDG 122
           PTLLQ+D  +  S+   V+ LTDG ADGLG++R +EL   +RLL+ +R   +++  F DG
Sbjct: 61  PTLLQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLRKRKASVEVLDFLDG 120

Query: 123 MDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHH-----TLH 177
           MD EW +E   + L + + D  PL LTFDE G+SGH NHI+C  A  K+  H        
Sbjct: 121 MDVEWDLERAVKALQERILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFK 180

Query: 178 LDSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGW 237
           L S   L  KYS F   LF   F    P+  +++F QYL +L +M+ AH SQMVWFR+GW
Sbjct: 181 LVSKRYLFEKYSGFIPALFH-SFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGW 239

Query: 238 WTASRYVYANEF 249
           W  S YVYANE 
Sbjct: 240 WLFSYYVYANEL 251

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  202 bits (514), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 112/246 (45%), Positives = 144/246 (58%), Gaps = 7/246 (2%)

Query: 8   VIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTLLQ 67
           V KL  VL  +Y  S   ++  N + +  L  S  N TS+ L+IAHPDDEVMFFAPTLLQ
Sbjct: 7   VCKLLAVLCILYFASSARIKASNEQAFTTLF-SVLNPTSINLVIAHPDDEVMFFAPTLLQ 65

Query: 68  LDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGMDEEW 127
           LD      +P  V  LTDG ADGLG++R  EL  ++ LL   R  E+ +  F+DGM  EW
Sbjct: 66  LDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEW 125

Query: 128 KMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHA-----AAKLGHHTLHLDSGH 182
            ++   E L + V   +PL LTFD+ GVS H NHI+C        AA     +  L S  
Sbjct: 126 DLQKTSEALRKQVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKR 185

Query: 183 NLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASR 242
           ++ +KY+ F   L  +L G     VF+STF QYL +L  M+ AH SQMVWFR+GWW  S 
Sbjct: 186 SIFQKYTAFVPSLITVLRG-SRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSC 244

Query: 243 YVYANE 248
           YV+ANE
Sbjct: 245 YVFANE 250

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  190 bits (482), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 108/260 (41%), Positives = 149/260 (57%), Gaps = 13/260 (5%)

Query: 3   GSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFA 62
           G    V KL   L  +Y      +   N   ++    + G   S+TL+IAHPDDEVMFF+
Sbjct: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFS 64

Query: 63  PTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLV--LERDVEIQMGGFK 120
           P+LLQLD  + QSV F  VCL+ GDAD LGE R  EL ++L LL    +R  ++    + 
Sbjct: 65  PSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYP 124

Query: 121 DGMDEEWKMEVVRE--ELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKL---GHHT 175
           DG DE+W++E V    E    +     L+LTFD  GVS H NH+AC +A A+L   GH  
Sbjct: 125 DGFDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKGHKA 184

Query: 176 LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP-----TVFLSTFSQYLHSLVTMLVAHKSQ 229
           L+L+S   NL  KYS F  +L R+L    M        F+++F QY+ +   M  AH+SQ
Sbjct: 185 LYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANAHESQ 244

Query: 230 MVWFRWGWWTASRYVYANEF 249
           +VWFR+GWW+ SR+V+ N+ 
Sbjct: 245 LVWFRYGWWSLSRFVFVNDL 264

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  189 bits (481), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 161/294 (54%), Gaps = 59/294 (20%)

Query: 10  KLYLVLLAVYCGSYKHLETHNSKVYEYLV--------GSHGNY----TSVTLIIAHPDDE 57
           KL+L+L   Y  S + + ++N K ++  V         SH +     T ++L+IAHPDDE
Sbjct: 14  KLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDE 73

Query: 58  VMFFAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVL---ERDVEI 114
           +MFFAPTLLQL+  +  S+PF ++C +DGDA+GLG +RR+ELH ++ LL+     R + I
Sbjct: 74  LMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRKINI 133

Query: 115 QMGGFKDGMDEEWK----MEVVREELAQVV--TDRRPLVLTFDERGVSGHRNHIACAHAA 168
            +  F DGMD+ W     +  ++ EL   V  + +  ++LTFD  G+S H NHIAC  A 
Sbjct: 134 SILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAV 193

Query: 169 AKLGHHTLHLDSGH----------------------NLIRKYSFFFVDLFRLLFGYPMPT 206
               H  +  D G                       NL+ KY+FF +DL ++ +     T
Sbjct: 194 ----HDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGT 249

Query: 207 V------------FLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANE 248
                        F++T+SQY+ S  +ML  HKSQMVWFR+GWW  SR+V++N+
Sbjct: 250 FNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSND 303

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  187 bits (475), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 137/221 (61%), Gaps = 21/221 (9%)

Query: 45  TSVTLIIAHPDDEVMFFAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALR 104
           T++ L+IAHPDDEVMFFAPTLLQLD  M  S+P  V+C ++GDA GLGE R+ EL  ++ 
Sbjct: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112

Query: 105 LLVL-ERDVEIQMGGFKDGMDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIA 163
            L+  +R   + +  F+DG D+ W ++ + + L Q   +     LTFD  GVSGH+NHIA
Sbjct: 113 ALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ---NDHQAFLTFDSHGVSGHKNHIA 169

Query: 164 CAHAAAKLGHHT-----LHLDS-GHNLIRKYSFFFVDLFRLLFG------YPM-----PT 206
           C +A   L +       L LDS  H+L+ KY+FF +DL +L +        P        
Sbjct: 170 CHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWESHDKI 229

Query: 207 VFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYAN 247
            F + +SQY+ +  TML AHKSQ+VWFR+GWW  SR+V++N
Sbjct: 230 TFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSN 270

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  186 bits (471), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 157/267 (58%), Gaps = 27/267 (10%)

Query: 10  KLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTLLQLD 69
           K+Y +L  ++      +++ N  V+   +       S++L++AHPDDEVMFFAPT+L+LD
Sbjct: 9   KVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELD 68

Query: 70  ARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVL--ERDVEIQMGGFKDGMDEEW 127
           +R+  +V F VVCL+ G AD LG+ R +EL +++ LL+   +R  ++Q   + DG +E W
Sbjct: 69  SRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHEETW 128

Query: 128 KMEVVREELAQVVTD--RRPLVLTFDERGVSGHRNHIACAHAAAKLGHH------TLHLD 179
             E V+  +   V    R  ++LTFD++GVS H NHIAC  A + L          L+LD
Sbjct: 129 DQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAALYLD 188

Query: 180 S-GHNLIRKYSFFFVDLFRLLFGY----PMPT------------VFLSTFSQYLHSLVTM 222
           S G N++ KYS FF ++++L   +     +PT              +S +S Y+ S  +M
Sbjct: 189 SYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILSFASM 248

Query: 223 LVAHKSQMVWFRWGWWTASRYVYANEF 249
           L +HKSQMVWFR+GWWT SR+V+ N+ 
Sbjct: 249 LHSHKSQMVWFRYGWWTFSRFVFVNDL 275

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  180 bits (456), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 160/285 (56%), Gaps = 40/285 (14%)

Query: 5   FFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPT 64
            + + KL +VL  +Y      + + N++  +++  +  +   + LIIAHPDDEVMFF+P 
Sbjct: 15  LYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPM 74

Query: 65  LLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLV-LERDVEIQMGGFKDGM 123
           + QL +    +VPF ++CL+ G+A+GLG+ R REL+ +  LL+  ER V +Q+  F+DGM
Sbjct: 75  ISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGM 134

Query: 124 DEEWKMEVVREELAQVV----TDRRPLVLTFDERGVSGHRNHIACAHAAAKL-GHHT--- 175
           +E W ++ +   L+Q +     +   +++TFD  GVSGH NH +C  A  KL   +T   
Sbjct: 135 NEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSN 194

Query: 176 ------------LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP----------------- 205
                       L+L S  +N++ KY+ F  ++ R+L+G   P                 
Sbjct: 195 VRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKN 254

Query: 206 -TVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249
             + ++T +QY+ +   ML AHKSQ+VWFR+GWW  SR+V+ NEF
Sbjct: 255 SLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 299

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  178 bits (452), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 152/267 (56%), Gaps = 27/267 (10%)

Query: 6   FAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGS----HGNYTSVTLIIAHPDDEVMFF 61
           F + KL L+   +Y      ++  N ++    + S      N  S+TL++AHPDDEVMFF
Sbjct: 9   FKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFF 68

Query: 62  APTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKD 121
           +PTLLQLD+ +  +  F ++  +DGDA+GLG +R  EL  ++ +L+  R+ EI +    D
Sbjct: 69  SPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTD 128

Query: 122 GMDEEWKMEVVREELAQVVTDRRP-LVLTFDERGVSGHRNHIAC---------AHAAAKL 171
           GM+E W  +++  +L  +++D +  ++LTFD+ GVS H NH AC         +HA    
Sbjct: 129 GMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNNF 188

Query: 172 GHHTLHLDS-GHNLIRKYSFFFVDLFRL-----LFGYPMPTV----FLSTFSQYLHSLVT 221
               L LDS   NL++KY+ F   L  L     + G  +P +      + +S Y+ +  T
Sbjct: 189 A---LLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYITAYAT 245

Query: 222 MLVAHKSQMVWFRWGWWTASRYVYANE 248
           ML AHKSQMVWFR+GWW  SR+VY N+
Sbjct: 246 MLKAHKSQMVWFRYGWWFFSRFVYVND 272

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  177 bits (448), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 107/275 (38%), Positives = 157/275 (57%), Gaps = 35/275 (12%)

Query: 6   FAVIKLYLVLLAVYC-GSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPT 64
           + V KL L+L  +Y   S   + + N    E L G H +  SV L+IAHPDDEVMFFAP+
Sbjct: 11  YKVTKLSLLLGILYIYASTSKIGSFNYTNLETL-GEH-DINSVNLVIAHPDDEVMFFAPS 68

Query: 65  LLQLDARMAQ-SVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGM 123
           L+ L+ ++   S  F ++C ++G ADGLG VR +EL  ++ +L+  R+  I +  FKDGM
Sbjct: 69  LINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDGM 128

Query: 124 DEEWKMEVVREELAQVVTD-RRPLVLTFDERGVSGHRNHIACAHAAAKLGHHT------- 175
            E+W ++ +  +L  +V      ++LTFD +GVSGH NHIAC  AA  LG++        
Sbjct: 129 KEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAA--LGYYNEFKSKQK 186

Query: 176 ---LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMPT-----------------VFLSTFSQ 214
              L L S   N+++KYS +  +L +LL+   +P+                    ST+ Q
Sbjct: 187 LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQ 246

Query: 215 YLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249
           Y+ SL  ML AHK+Q+VWFR+GWW  SR V+ N+ 
Sbjct: 247 YVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  177 bits (449), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 154/286 (53%), Gaps = 41/286 (14%)

Query: 5   FFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPT 64
            F + KL +VL  +Y      + + N+   +++       + + L+IAHPDDEVMFF+P 
Sbjct: 13  LFKITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPV 72

Query: 65  LLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELH-KALRLLVLERDVEIQMGGFKDGM 123
           + QL A    +VPF ++CL+ GDA+GLGE R +EL+  A+ LL  ER V +Q+  F+DGM
Sbjct: 73  ISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFEDGM 132

Query: 124 DEEWKMEVVREELAQVVTDRRP----LVLTFDERGVSGHRNHIACAHAAAK-----LGHH 174
           DE W ++ +   L+Q +         +++TFD  GVS H NH +C  A  K     +G  
Sbjct: 133 DEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSK 192

Query: 175 T-----------LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP----------------- 205
           T           L+L S  +N+  KY+ F  ++ ++L+    P                 
Sbjct: 193 TKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEK 252

Query: 206 --TVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249
              + ++T SQY+ +   ML AHKSQ+VWFR+GWW  SR+V+ NEF
Sbjct: 253 NGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 298

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  176 bits (447), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 155/282 (54%), Gaps = 38/282 (13%)

Query: 6   FAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTL 65
           + + KL +VL  +Y      + + N ++ +++       + + L+IAHPDDEVMFF+P +
Sbjct: 14  YKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVI 73

Query: 66  LQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVL-ERDVEIQMGGFKDGMD 124
            QL +    +VPF ++CL+ G+ADGLGE R +EL+ +  LL+  ER V +Q+  F+DGMD
Sbjct: 74  SQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMD 133

Query: 125 EEWKMEVVREELAQVV----TDRRPLVLTFDERGVSGHRNHIAC-----------AHAAA 169
           E W +  +   ++Q +         +++TFD  GVS H NH +C           A + A
Sbjct: 134 EVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKA 193

Query: 170 KLGHHTLHLDS------GHNLIRKYSFFFVDLFRLLFG--YPMPT--------------V 207
           +    T H+ +       +N++ KY+ F  ++ ++L+    P P               +
Sbjct: 194 ETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQPPTTTTQRSKLL 253

Query: 208 FLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249
            ++T +QY+ +   ML AHKSQ+VWFR+GWW  SR+V+ NEF
Sbjct: 254 LMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 295

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  176 bits (447), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 162/286 (56%), Gaps = 42/286 (14%)

Query: 5   FFAVIKLYLVLLAVYCG-SYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAP 63
            + + KL +VL  +Y   + K +  +N+ +       +G+Y  + L+IAHPDDEVMFF+P
Sbjct: 15  LYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDY-EINLVIAHPDDEVMFFSP 73

Query: 64  TLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLV-LERDVEIQMGGFKDG 122
            + QL++   ++VPF ++CL+ G+A+GLGE R REL+++  LL+  ER V +Q+  F+DG
Sbjct: 74  IISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDG 133

Query: 123 MDEEWKMEVVREELAQVVTDR----RPLVLTFDERGVSGHRNHIACAHAAAKL------- 171
           MDE W ++ +   L+Q +  +      +++TFD  GVS H NH +C  A  KL       
Sbjct: 134 MDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQP 193

Query: 172 --------GHHT-LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP---------------- 205
                    H T L+L S  +N++ KY+ F  ++ ++L+    P                
Sbjct: 194 KTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEK 253

Query: 206 --TVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249
                ++T +QY+ +  TML AH+SQ+VWFR+GWW  SR+V+ NEF
Sbjct: 254 DKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEF 299

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  173 bits (439), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 108/295 (36%), Positives = 158/295 (53%), Gaps = 48/295 (16%)

Query: 3   GSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVG---SHGNYTSVTLIIAHPDDEVM 59
           G  F + K Y +L  +Y     H+E  N K +   V    S  +  SV LIIAHPDDEVM
Sbjct: 2   GILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVM 61

Query: 60  FFAPTLLQLDARMAQSVPFRVVCLTDG-DADG--LGEVRRRELHKALRLLV------LER 110
           FF PTLLQLD  +   VPF V+CL+ G D DG  +G++R  E+  +L +L+      L R
Sbjct: 62  FFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121

Query: 111 DVEIQMGGFKDGMDEEWKMEVVREELAQVVTDRRPL------VLTFDERGVSGHRNHIAC 164
           +V++    ++DGMD++W +  V  ++   ++    +      +LTFD +GVS H NHIAC
Sbjct: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181

Query: 165 AHAAAKLGHHT--------LHLDS-GHNLIRKYSFFFVDLFRLLFG--------YPMPTV 207
             A   L   +        + L+S G N+I KYS F   +F+LL          + +  V
Sbjct: 182 YDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQV 241

Query: 208 -------------FLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249
                        F++TF  Y+ +L +ML +H SQMVWFR+GWW+ SR+V+ N+ 
Sbjct: 242 PFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDL 296

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  168 bits (425), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/278 (37%), Positives = 149/278 (53%), Gaps = 39/278 (14%)

Query: 6   FAVIKLYLVLLAVY---CGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFA 62
           F  IKLY +L   Y    G+ +       +   Y  GS    +SV L+IAHPDDEVMFF+
Sbjct: 8   FKAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGS----SSVNLVIAHPDDEVMFFS 63

Query: 63  PTLLQLDARMAQSVPFRVVCLTDG-DADG--LGEVRRRELHKALRLLVL-ERDVEIQMGG 118
           PTL+QLD  +   V   V+C + G + DG   GE R REL K++ +L+  +R V +    
Sbjct: 64  PTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLD 123

Query: 119 FKDGMDEEWKMEVVREELAQVVT-----DRRPLVLTFDERGVSGHRNHIACAHAAAKLGH 173
           +KDG D+ W ++ +  +L  ++       R+ L++TFDE GVS H NHIAC +A  +L  
Sbjct: 124 YKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIE 183

Query: 174 H-----TLHLDS-GHNLIRKYSFFFVDLFRLLFGY-----------------PMPTVFLS 210
                    L+S   N+I KYSFF  ++ +  + Y                 P   V  +
Sbjct: 184 EEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFN 243

Query: 211 TFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANE 248
           T S+Y+ +  TML AH+SQ+VWFR+GWW  SR  YANE
Sbjct: 244 THSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANE 281

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  162 bits (411), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 144/283 (50%), Gaps = 43/283 (15%)

Query: 5   FFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPT 64
            F + KL ++   +Y      +E  N +    L+ +H N+  + L+IAHPDDE+MFF+PT
Sbjct: 22  LFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPT 81

Query: 65  LLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLE---RDVEIQMGGFKD 121
           +LQL   + +     VVCL++GDADGLGE+R +EL  A+  L +    R+V + +  + D
Sbjct: 82  ILQLIDHVQE---LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTD 138

Query: 122 GMDEEWKMEVVREELAQVVTDRRP------LVLTFDERGVSGHRNHIACAHAAAKL---- 171
           G +E W    V  +L + +    P      ++LTFD  G+SGHRNHIAC           
Sbjct: 139 GQNEVWSG--VATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTI 196

Query: 172 -GHHTLHLD----SGHNLIRKYSFFFVDLFRLLFGYP----------MPT---------- 206
             +  + L+    S   +I KYS     L  +++             +P           
Sbjct: 197 KSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNV 256

Query: 207 VFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249
            F+STF QY  S   M  AHKSQMVWFR+ WW+ SRYV+ N+ 
Sbjct: 257 CFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  154 bits (389), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 153/305 (50%), Gaps = 64/305 (20%)

Query: 8   VIKLYLVLLAVYCGSYKHLETHNSKVYEYLVG--------SHGNYTSVTLIIAHPDDEVM 59
            +KL L+   +Y  +   ++  N + + Y            H    S++LIIAHPDDE+M
Sbjct: 10  TVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIM 69

Query: 60  FFAPTLLQLDARMAQSVPFRVVCLTDG-DADGLGEVRRR--ELHKALRLLVL-------E 109
           FF+PTLLQL+  + + + F VVCL+ G D+ G  +  +R  EL+ +L LL          
Sbjct: 70  FFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHN 129

Query: 110 RDVEIQMGGFKDGMDEEWKMEVVREELAQVV--TDRR-PLVLTFDERGVSGHRNHIACAH 166
           R+ ++    + DGM E W M+++ ++L Q +  TD    L+LTFD+ GVS H+NH+AC  
Sbjct: 130 RNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNE 189

Query: 167 AAAKLGHHT--------LHLDS-GHNLIRKYSFFFVDLFRLL-------------FGYP- 203
           A  KL  ++        + L+S   N   KYSFF   LF ++             F +P 
Sbjct: 190 AVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPN 249

Query: 204 --------------------MPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRY 243
                               +   F + F++Y+ S  TML AH+SQMVWFR+ WW  SR+
Sbjct: 250 SDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRF 309

Query: 244 VYANE 248
            + N+
Sbjct: 310 AFIND 314

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 165 AHAAAKLGHH---TLHLDSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVT 221
           AHA+ KL  +    L L + + +++KY   F D+F+ +F     T F +    Y H L+ 
Sbjct: 205 AHASFKLALNKKLNLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISYEHRLID 264

Query: 222 MLVAHKSQMVWFRWGWWTA 240
            +VA   QM+  + G+  A
Sbjct: 265 DMVA---QMIKSKGGFIMA 280

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 165 AHAAAKLGHHT---LHLDSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVT 221
           AHA+ KL       L L + + ++++Y   F DLF+ +F       F  +  QY H L+ 
Sbjct: 210 AHASFKLALSKKLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLID 269

Query: 222 MLVAHKSQMVWFRWGWWTA 240
            +VA   QM+  + G+  A
Sbjct: 270 DMVA---QMIKSKGGFIMA 285

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 165 AHAAAKLG---HHTLHLDSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVT 221
           AH++ KL       L L + + +++KY   F D+F+ +F     T F +    Y H L+ 
Sbjct: 208 AHSSFKLALTKKLNLFLSTKNTILKKYDGRFKDIFQEIFDMEYKTKFANLGISYEHRLID 267

Query: 222 MLVAHKSQMVWFRWGWWTA 240
            +VA   QM+  + G+  A
Sbjct: 268 DMVA---QMIKSKGGFIMA 283

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 165 AHAAAKLG---HHTLHLDSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVT 221
           AHA+ KL       L+L + + +++KY   F D+F+ L+       F +    Y H L+ 
Sbjct: 203 AHASFKLALTKKLNLYLSTKNTILKKYDGRFKDIFQELYDAEYKKQFEAAGIYYEHRLID 262

Query: 222 MLVAHKSQMVWFRWGWWTA 240
            +VA   QM+  + G+  A
Sbjct: 263 DMVA---QMIKSKGGFIMA 278

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 165 AHAAAKLG---HHTLHLDSGHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVT 221
           AHA+ KL       L + + + ++++Y   F D+F+ ++     T F      Y H L+ 
Sbjct: 203 AHASFKLALSKRLNLFMSTKNTILKQYDGRFKDIFQEVYAQEYQTQFRDEGISYEHRLID 262

Query: 222 MLVAHKSQMVWFRWGWWTA 240
            +VA   QM+  R G+  A
Sbjct: 263 DMVA---QMIKSRGGFVMA 278

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,975,380
Number of extensions: 1057534
Number of successful extensions: 2963
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2974
Number of HSP's successfully gapped: 30
Length of query: 249
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 142
Effective length of database: 41,212,137
Effective search space: 5852123454
Effective search space used: 5852123454
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)