Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46168.845ON1577157767350.0
ABL121C8.845ON128598723050.0
KLLA0D01452g8.845ON144576618380.0
SAKL0D01342g8.845ON127072617620.0
TDEL0B005308.845ON130176215690.0
Kwal_27.102328.845ON120975115570.0
ZYRO0G14278g8.845ON125052515180.0
KLTH0C03762g8.845ON120650414421e-175
NCAS0C003908.845ON116449511471e-133
Suva_13.4688.845ON141853811591e-133
KAFR0B039508.845ON124649111221e-129
YMR280C (CAT8)8.845ON143353811161e-127
NDAI0K003908.845ON149551311001e-125
KNAG0J002508.845ON123765010851e-124
Smik_13.4938.845ON143354610661e-120
Skud_13.4528.845ON143253710641e-120
CAGL0M03025g8.845ON12545109551e-107
Kpol_1016.201.277ON1086702295e-18
YJL089W (SIP4)1.277ON829612133e-16
Skud_10.1251.277ON833612124e-16
AFR096W1.277ON852482115e-16
Smik_10.1531.277ON829562106e-16
KAFR0A014801.277ON725492097e-16
ZYRO0G15136g1.277ON1027482072e-15
KLLA0F14322g1.277ON717482062e-15
Ecym_63401.277ON952482053e-15
TPHA0I028201.277ON1044512053e-15
KLTH0D03564g1.277ON862482043e-15
SAKL0D05654g1.277ON919482044e-15
Suva_6.1611.277ON832612035e-15
Kwal_26.7397singletonOFF201481861e-14
TDEL0D014501.277ON945481963e-14
CAGL0L03377g1.277ON1209541955e-14
NDAI0G055301.277ON1186481911e-13
KNAG0B018401.277ON1072511892e-13
TBLA0D054201.277ON757581883e-13
NCAS0A094101.277ON932451589e-10
NDAI0F012206.279ON960541321e-06
KLLA0E13993gsingletonON678441292e-06
TPHA0F013802.231ON8901281284e-06
TBLA0G026102.231ON1000421284e-06
KLLA0C10923g5.235ON775491274e-06
SAKL0G11902g5.235ON906581265e-06
Kpol_1039.112.231ON992411241e-05
KAFR0F014901.128ON658541221e-05
SAKL0A02860g6.279ON745521222e-05
KLLA0F04609g2.231ON916331222e-05
YPL248C (GAL4)6.279ON881471222e-05
Smik_6.4526.279ON878471222e-05
SAKL0C02024gsingletonON898481212e-05
KNAG0D006906.279ON875451212e-05
NDAI0A087907.17ON1059341212e-05
KAFR0J017102.231ON848331203e-05
NCAS0D041906.279ON890451203e-05
NCAS0B065502.231ON906331203e-05
ZYRO0E08272g6.279ON794471203e-05
Ecym_7440na 1ON898521193e-05
NDAI0B038502.231ON930411194e-05
Smik_9.392.231ON1012331194e-05
NCAS0D025405.235ON890561194e-05
YIL130W (ASG1)2.231ON964331194e-05
Skud_9.372.231ON954331194e-05
Suva_9.592.231ON926331194e-05
NCAS0G011006.279ON935451194e-05
Kpol_1018.306.279ON881451184e-05
CAGL0G08844g2.231ON847411185e-05
TDEL0C044802.231ON852411186e-05
KLTH0G09108g2.231ON782331176e-05
Kwal_23.47542.231ON812331176e-05
SAKL0E08998g2.231ON823331176e-05
KNAG0B051205.235ON888441177e-05
KNAG0E017602.231ON902331168e-05
Kwal_23.29055.235ON881581168e-05
KLTH0G07898g5.235ON866581168e-05
KLTH0D07260g2.547ON979501169e-05
Suva_16.596.279ON895451151e-04
SAKL0C03938g1.128ON780391141e-04
TPHA0H019806.279ON993471141e-04
TBLA0G018006.279ON1154451141e-04
NDAI0I023505.235ON889441141e-04
KAFR0J006905.235ON864441142e-04
Suva_10.945.235ON906441132e-04
TDEL0E039105.235ON862441132e-04
KLTH0E14454gna 1ON902451122e-04
KLTH0D02222gna 2ON847471122e-04
KLLA0A02585gna 3ON370501112e-04
SAKL0A09856g2.547ON1020631122e-04
TDEL0E00160singletonON631471122e-04
Kpol_495.213.109ON1085371122e-04
ZYRO0A10956g5.235ON855441123e-04
KNAG0E002107.17ON948331113e-04
NDAI0I007406.279ON1033451123e-04
TPHA0N002307.17ON1232331113e-04
AER183Cna 1ON879471113e-04
YOR380W (RDR1)na 4ON546531104e-04
KLTH0H16170gna 5ON619331104e-04
ZYRO0E06270g2.565ON912461104e-04
Smik_2.438na 6ON469421095e-04
CAGL0M12298g7.17ON994461105e-04
KAFR0F010406.279ON834471095e-04
Smik_12.775.235ON903441095e-04
KAFR0C049807.17ON951411095e-04
ZYRO0C18150g1.128ON571441086e-04
YBR297W (MAL33)na 6ON468411086e-04
KAFR0F034104.113ON995371096e-04
TBLA0E007007.17ON1274571096e-04
Smik_1.137.17ON1046461096e-04
SAKL0B06732gna 1ON878421087e-04
AER370W2.231ON801331087e-04
YLR014C (PPR1)5.235ON904441088e-04
SAKL0D01100g4.113ON940561088e-04
TBLA0A012101.380ON1422301088e-04
Smik_18.8singletonON775381079e-04
Ecym_53972.231ON826331070.001
YKL015W (PUT3)2.654ON9791401070.001
CAGL0A00451g4.113ON1107601070.001
KLTH0B00352gsingletonON934431070.001
NDAI0D00900singletonON865331070.001
KLTH0H02684g6.279ON749451060.001
TBLA0C040504.113ON1207361060.001
Skud_12.825.235ON899441060.001
KAFR0I002307.17ON1045331060.001
Skud_11.2142.654ON9811401060.001
SAKL0D00264g8.879ON848371050.002
Suva_1.147.17ON1045461050.002
Smik_11.2402.654ON9761401050.002
CAGL0F07909g3.109ON1049631050.002
Suva_15.773.109ON1029671050.002
Kpol_538.427.17ON1088421050.002
Skud_1.107.17ON1040461050.002
SAKL0A00704gna 7ON718461040.002
SAKL0B04620gna 3ON362371030.002
SAKL0D14520g7.17ON983331040.002
TPHA0A045403.109ON1178371040.002
KLLA0D12672g6.279ON865451040.002
ADR403C7.17ON970461040.002
NDAI0F00110singletonON508331030.002
NCAS0I002707.17ON944341040.002
SAKL0H24860gna 8ON971651040.002
YAL051W (OAF1)7.17ON1047461040.002
CAGL0I07755g3.109ON1053361040.002
CAGL0J07150g7.17ON1022431040.002
SAKL0H00682gna 9ON922591040.002
Skud_15.546na 4ON542461030.002
Ecym_50177.17ON978331030.003
ZYRO0C00726g7.17ON1035461030.003
NDAI0K001508.879ON953391030.003
YGL013C (PDR1)4.113ON1068381030.003
SAKL0C09944g3.109ON10611831030.003
CAGL0B03421g1.380ON1355511030.003
TPHA0A06090singletonON847331030.003
TDEL0C056801.128ON691301020.003
TBLA0C062306.60ON795331020.003
KLLA0C03201g1.128ON650541020.004
Kwal_26.81092.547ON970501020.004
Skud_2.427na 6ON468381010.004
NCAS0A035804.113ON1113371020.004
KNAG0I005601.128ON6631291020.004
TBLA0A007302.654ON10371281020.004
TDEL0D051503.109ON996471020.004
TDEL0H043407.17ON989331020.004
Suva_8.436na 4ON545381010.004
Smik_15.561na 4ON546381010.004
KLLA0F22990g1.380ON1253301020.004
NCAS0C002208.879ON839371010.004
TBLA0D006307.389ON1077641020.004
TBLA0G011308.879ON1132341020.004
Smik_7.2774.113ON1069381010.005
SAKL0D14542gna 10ON946331010.005
Skud_7.2744.113ON1080381010.005
YJL206C1.128ON7581641010.005
Suva_6.2851.128ON7862121010.005
Smik_17.27singletonON688331000.005
NDAI0H019907.17ON1161331010.005
KLLA0C14212gna 9ON1040361010.006
KNAG0E041507.17ON1136461010.006
Suva_11.2132.654ON9851401000.006
Skud_15.5327.17ON1000471000.006
TBLA0A097606.75ON1530431010.006
YOR363C (PIP2)7.17ON996471000.006
Skud_11.1902.547ON1171501000.006
KAFR0C039002.654ON8181461000.006
KLLA0F09559gsingletonON658381000.007
KLLA0F02750g3.109ON1148401000.007
NDAI0D035504.113ON1118661000.007
CAGL0K05841g1.380ON1372301000.007
KAFR0I020301.380ON1233401000.007
KLLA0A09119g4.113ON1082361000.007
NCAS0A03070singletonON65633990.008
NCAS0D04860singletonON70139990.008
YLR256W (HAP1)1.380ON1502661000.008
AFR117C1.380ON115242990.008
Ecym_2522na 7ON92634990.008
KLLA0A10329gna 11ON63939990.008
Smik_13.1832.565ON91146990.008
Smik_15.5477.17ON99571990.009
SAKL0B10538g7.56ON70167990.009
Kpol_467.11.380ON128930990.009
TPHA0H012405.59ON87739990.009
KNAG0I014501.380ON147630990.010
KAFR0B014502.547ON108850990.010
NCAS0A076107.17ON102233990.010
KNAG0A025508.423ON73038980.010
KAFR0C03730singletonON79135980.010
AFL160C6.279ON64847980.011
KLTH0E05786gna 12ON81760980.011
NCAS0C027308.423ON77539980.011
Skud_15.643.109ON103236980.011
TBLA0A058601.128aON81046980.011
Suva_16.25singletonON14342910.011
NDAI0G052601.380ON158130980.011
ACL058Wna 8ON81779980.012
KAFR0A021302.565ON70754980.012
Ecym_27321.380ON119830980.012
KLLA0A03421gna 10ON88047980.012
Smik_11.2102.547ON116950980.012
ZYRO0G22550gsingletonON72437980.012
KNAG0A071002.547ON128650980.012
TBLA0G005106.60ON93577980.012
NCAS0A088401.380ON147830980.013
KNAG0A02300singletonON72931970.013
NCAS0A047502.547ON114150970.014
YGR288W (MAL13)na 13ON47330970.014
Suva_8.4217.17ON100264970.014
Suva_7.2684.113ON100038970.014
YKL038W (RGT1)2.547ON117050970.014
CAGL0F09229gna 12ON83533970.015
Kwal_34.15751na 5ON62833970.015
TPHA0B036301.380ON142932970.015
CAGL0F07865g8.423ON84429970.015
Skud_3.181singletonON83150970.015
TBLA0G00490singletonON91838970.015
SAKL0D07898g1.380ON124430970.016
KLLA0F19602g8.283ON60340960.016
Kwal_YGOB_0.1391.380ON124030970.016
TDEL0B004808.879ON83529970.016
Kpol_260.25.59ON75641960.016
Smik_10.251.128ON772214960.016
Suva_11.1872.547ON117150960.018
Skud_7.638singletonON47339950.019
KLTH0H11572g1.380ON123730960.019
KLLA0A03443g7.17ON97533960.020
KNAG0M00120singletonON88135960.020
NDAI0G041403.109ON100149960.020
Skud_10.101.128ON833161960.020
NDAI0A034204.113ON110833960.020
NDAI0E034608.423ON94943960.021
ADR404Cna 10ON87533960.021
ACL093C2.651ON1010190960.021
CAGL0L01903g2.547ON128748960.022
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4616
         (1577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...  2598   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   892   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   712   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...   683   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   608   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   604   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   589   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   560   e-175
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     446   e-133
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   451   e-133
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   436   e-129
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   434   e-127
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    428   e-125
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   422   e-124
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   415   e-120
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   414   e-120
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   372   e-107
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    93   5e-18
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    87   3e-16
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    86   4e-16
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    86   5e-16
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    86   6e-16
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    85   7e-16
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    84   2e-15
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    84   2e-15
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    84   3e-15
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    84   3e-15
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    83   3e-15
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    83   4e-15
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    83   5e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    76   1e-14
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    80   3e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    80   5e-14
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            78   1e-13
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    77   2e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    77   3e-13
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    65   9e-10
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    55   1e-06
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    54   2e-06
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    54   4e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    54   4e-06
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    54   4e-06
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    53   5e-06
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    52   1e-05
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    52   1e-05
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    52   2e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    52   2e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    52   2e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    52   2e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    51   2e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    51   2e-05
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    51   2e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    51   3e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     51   3e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    51   3e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    51   3e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    50   3e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    50   4e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    50   4e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    50   4e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    50   4e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    50   4e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    50   4e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    50   4e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    50   4e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    50   5e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    50   6e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    50   6e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    50   6e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    50   6e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               50   7e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    49   8e-05
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    49   8e-05
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    49   8e-05
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    49   9e-05
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    49   1e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    49   1e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    49   1e-04
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    49   1e-04
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     49   1e-04
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    49   2e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    48   2e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    48   2e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    48   2e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    48   2e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    47   2e-04
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    48   2e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 48   2e-04
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    48   2e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    48   3e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    47   3e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    48   3e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    47   3e-04
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    47   3e-04
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    47   4e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    47   4e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    47   4e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    47   5e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    47   5e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    47   5e-04
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    47   5e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    47   5e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    46   6e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    46   6e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    47   6e-04
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    47   6e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    47   6e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    46   7e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    46   7e-04
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    46   8e-04
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    46   8e-04
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    46   8e-04
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    46   9e-04
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    46   0.001
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    46   0.001
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    46   0.001
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    46   0.001
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               46   0.001
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    45   0.001
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   0.001
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    45   0.001
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.001
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    45   0.001
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    45   0.002
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    45   0.002
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    45   0.002
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    45   0.002
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    45   0.002
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    45   0.002
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    45   0.002
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    45   0.002
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    44   0.002
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    45   0.002
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    45   0.002
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    45   0.002
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    45   0.002
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 44   0.002
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    45   0.002
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    45   0.002
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    45   0.002
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    45   0.002
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    45   0.002
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    45   0.002
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    44   0.002
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    44   0.003
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    44   0.003
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    44   0.003
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    44   0.003
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    44   0.003
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    44   0.003
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    44   0.003
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    44   0.003
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.003
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    44   0.004
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    44   0.004
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    44   0.004
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    44   0.004
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    44   0.004
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    44   0.004
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    44   0.004
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    44   0.004
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    44   0.004
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    44   0.004
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    44   0.004
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       44   0.004
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    44   0.004
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    44   0.004
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    44   0.005
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    44   0.005
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    44   0.005
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    44   0.005
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    44   0.005
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.005
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    44   0.005
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    44   0.006
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    44   0.006
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    43   0.006
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    43   0.006
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    44   0.006
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    43   0.006
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    43   0.006
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    43   0.006
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    43   0.007
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    43   0.007
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    43   0.007
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    43   0.007
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    43   0.007
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    43   0.007
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               43   0.008
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               43   0.008
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    43   0.008
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    43   0.008
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    43   0.008
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    43   0.008
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    43   0.008
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    43   0.009
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    43   0.009
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    43   0.009
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    43   0.009
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              43   0.010
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    43   0.010
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    43   0.010
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    42   0.010
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               42   0.010
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.011
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    42   0.011
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     42   0.011
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    42   0.011
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             42   0.011
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.011
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    42   0.011
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    42   0.012
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    42   0.012
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    42   0.012
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    42   0.012
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    42   0.012
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.012
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    42   0.012
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    42   0.012
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    42   0.013
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.013
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    42   0.014
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    42   0.014
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    42   0.014
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    42   0.014
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    42   0.014
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.015
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    42   0.015
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    42   0.015
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    42   0.015
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    42   0.015
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                42   0.015
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.016
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    42   0.016
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.016
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.016
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    42   0.016
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    42   0.016
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    42   0.018
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    41   0.019
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    42   0.019
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    42   0.020
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      42   0.020
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    42   0.020
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    42   0.020
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    42   0.020
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     42   0.021
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    42   0.021
ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON} ...    42   0.021
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    42   0.022
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    41   0.022
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    41   0.023
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    41   0.023
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.023
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    41   0.024
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    41   0.024
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    41   0.024
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    41   0.024
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    41   0.024
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    41   0.024
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    41   0.025
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               41   0.025
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    41   0.026
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    41   0.026
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    41   0.027
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    41   0.027
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    41   0.028
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    41   0.028
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    41   0.028
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    41   0.029
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    41   0.029
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    41   0.030
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    41   0.030
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    41   0.030
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    41   0.031
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    41   0.031
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    41   0.031
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    41   0.032
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     41   0.032
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    41   0.032
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    41   0.032
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    41   0.032
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    40   0.032
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    41   0.033
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    41   0.033
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    41   0.033
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    41   0.034
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    41   0.035
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    41   0.035
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    41   0.036
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    41   0.036
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    41   0.037
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    39   0.038
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    40   0.038
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    40   0.038
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    40   0.039
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    41   0.039
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    40   0.039
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    40   0.041
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    40   0.041
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    40   0.041
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    40   0.041
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    40   0.041
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    40   0.043
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    40   0.043
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    40   0.043
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    40   0.044
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    40   0.044
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               40   0.044
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.044
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    40   0.046
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.046
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.046
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    40   0.047
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    40   0.048
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    40   0.049
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    40   0.050
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    40   0.050
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    40   0.052
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    40   0.053
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    40   0.053
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.053
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    40   0.055
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    40   0.055
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    40   0.056
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    40   0.056
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    40   0.056
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    40   0.057
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    40   0.058
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    40   0.060
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    40   0.061
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    40   0.062
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    40   0.063
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    40   0.064
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    40   0.065
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    40   0.066
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    40   0.068
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    40   0.069
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    40   0.070
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    40   0.071
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    40   0.072
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    40   0.072
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    40   0.073
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    40   0.073
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    40   0.074
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    40   0.075
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    40   0.077
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    39   0.078
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    40   0.079
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    40   0.079
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.083
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    40   0.084
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.084
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    39   0.085
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    39   0.085
Smik_2.290 Chr2 complement(527416..530511) [3096 bp, 1031 aa] {O...    39   0.090
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    39   0.091
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    39   0.092
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    39   0.092
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.094
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    39   0.095
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    39   0.095
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       39   0.095
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    39   0.096
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.096
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    39   0.099
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    39   0.099
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.099
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    39   0.10 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    39   0.10 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.10 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    39   0.11 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.11 
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    39   0.11 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    39   0.11 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               39   0.11 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    39   0.11 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    39   0.11 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    39   0.11 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.12 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    39   0.12 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    39   0.12 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.12 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    39   0.12 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.13 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.13 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    39   0.13 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    39   0.13 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    39   0.13 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    39   0.13 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.14 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    39   0.14 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    39   0.14 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    39   0.14 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    39   0.15 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    39   0.15 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    39   0.15 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    39   0.15 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    39   0.15 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    39   0.15 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    39   0.15 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    39   0.16 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    39   0.16 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    39   0.16 
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    39   0.17 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    39   0.17 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    39   0.18 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    39   0.18 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    39   0.18 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    39   0.18 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    39   0.18 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    39   0.19 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    39   0.19 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    39   0.19 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    39   0.19 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    39   0.19 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    38   0.19 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    38   0.19 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    38   0.20 
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    38   0.20 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.20 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    38   0.21 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    38   0.21 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    38   0.21 
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    38   0.21 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    38   0.21 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    38   0.21 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    38   0.21 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    38   0.21 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    38   0.22 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    38   0.23 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.23 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    38   0.24 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    38   0.24 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    38   0.24 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    38   0.24 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.25 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    38   0.25 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    38   0.25 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    38   0.25 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    38   0.26 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    38   0.26 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    38   0.26 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    38   0.26 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    38   0.26 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    38   0.27 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    38   0.27 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    38   0.27 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    38   0.27 
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    38   0.27 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    38   0.29 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    38   0.29 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    38   0.29 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    38   0.29 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    38   0.29 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.29 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    38   0.30 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    38   0.31 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    38   0.31 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    38   0.32 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    38   0.32 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.32 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    38   0.33 
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    37   0.34 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.34 
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    37   0.34 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.35 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.35 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.35 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    37   0.36 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.36 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    37   0.36 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.37 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.37 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.37 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    37   0.37 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.37 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 37   0.37 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    37   0.38 
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    37   0.38 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.38 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    37   0.38 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    37   0.39 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.41 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     37   0.41 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    37   0.42 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    37   0.42 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.42 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    37   0.43 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    37   0.43 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.43 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.43 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    37   0.44 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    37   0.45 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    37   0.45 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    37   0.47 
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    37   0.47 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      37   0.48 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    37   0.49 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    37   0.49 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    37   0.49 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    37   0.50 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    37   0.51 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    37   0.51 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    37   0.51 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.52 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.56 
NCAS0D01290 Chr4 complement(233978..236194) [2217 bp, 738 aa] {O...    37   0.56 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    37   0.56 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    37   0.58 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    37   0.58 
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    37   0.59 
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    37   0.59 
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    37   0.59 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    37   0.60 
KAFR0G01220 Chr7 (276857..279406) [2550 bp, 849 aa] {ON} Anc_1.2...    37   0.61 
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    37   0.62 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    37   0.64 
KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa...    37   0.65 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    37   0.66 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    37   0.68 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    37   0.68 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    37   0.72 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    36   0.72 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.72 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    37   0.74 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    36   0.76 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    36   0.77 
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    36   0.77 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    36   0.83 
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    36   0.84 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    36   0.84 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    36   0.86 
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    36   0.88 
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    36   0.93 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    36   0.94 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    36   0.96 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    36   0.97 
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      36   0.99 
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    36   1.00 
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    36   1.0  
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    36   1.0  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    36   1.1  
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    36   1.1  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               36   1.1  
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             36   1.1  
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   1.1  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    36   1.1  
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    36   1.1  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    36   1.2  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   1.2  
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    36   1.2  
KLLA0C01023g Chr3 (76863..78773) [1911 bp, 636 aa] {ON} similar ...    35   1.2  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    36   1.3  
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    36   1.3  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.3  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    35   1.4  
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    35   1.4  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    35   1.4  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    35   1.5  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   1.5  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    35   1.5  
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    35   1.5  
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    35   1.5  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    35   1.5  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    35   1.5  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    35   1.5  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                35   1.5  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    35   1.6  
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    35   1.6  
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    35   1.7  
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    35   1.7  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    35   1.8  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    35   1.8  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    35   1.9  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     35   1.9  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    35   1.9  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   1.9  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    35   1.9  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    35   2.0  
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    35   2.0  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    34   2.0  
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    35   2.0  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    35   2.1  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    35   2.2  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    35   2.3  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    35   2.3  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    35   2.5  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    34   2.8  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    34   2.9  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    34   3.2  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    34   3.5  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    34   3.5  
TPHA0J00190 Chr10 (44450..45142) [693 bp, 230 aa] {ON}                 33   3.5  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    34   3.7  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             34   3.7  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    34   3.9  
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    34   4.4  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    34   4.5  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   4.6  
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    33   4.7  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   5.2  
TDEL0F05400 Chr6 complement(1005960..1007603) [1644 bp, 547 aa] ...    33   5.3  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    33   5.4  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    33   5.9  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   6.1  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   6.4  
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    33   6.7  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    33   8.7  

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score = 2598 bits (6735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1302/1577 (82%), Positives = 1302/1577 (82%)

Query: 1    MSGNIGKKDKDTYGPRIIRTLGSQALXXXXXXXXXXXXNNTRMVXXXXXXXXXXXXXXVD 60
            MSGNIGKKDKDTYGPRIIRTLGSQAL            NNTRMV              VD
Sbjct: 1    MSGNIGKKDKDTYGPRIIRTLGSQALGGHIRGGHGSQGNNTRMVSGSQPSSLSESPISVD 60

Query: 61   VGALQDEAHXXXXXXXXXXXXXXXXXXXXXXXXXVRGALSPTMVQASATPGSTPLSSMTP 120
            VGALQDEAH                         VRGALSPTMVQASATPGSTPLSSMTP
Sbjct: 61   VGALQDEAHGGSQSSQQGQQKQQLVQQLGQQLGQVRGALSPTMVQASATPGSTPLSSMTP 120

Query: 121  MSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXX 180
            MSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY         
Sbjct: 121  MSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVR 180

Query: 181  XXXXXXXXXXXXCDLKEEQLRLVSKYXXXXXXXXXXXXXXXXXXXXNRSSVNGAVNESAS 240
                        CDLKEEQLRLVSKY                    NRSSVNGAVNESAS
Sbjct: 181  ELEAENRRLVALCDLKEEQLRLVSKYSAGSVGVGVGGPVTAGTTVGNRSSVNGAVNESAS 240

Query: 241  STVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNKK 300
            STVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNKK
Sbjct: 241  STVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNKK 300

Query: 301  TSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDNPAEFQKEHLQPRTLP 360
            TSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDNPAEFQKEHLQPRTLP
Sbjct: 301  TSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDNPAEFQKEHLQPRTLP 360

Query: 361  NIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLAT 420
            NIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLAT
Sbjct: 361  NIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLAT 420

Query: 421  LVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVPYQTSPELELLR 480
            LVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVPYQTSPELELLR
Sbjct: 421  LVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVPYQTSPELELLR 480

Query: 481  SKSLWEIDDVDSFLSKGLRFSFPSATSAENNNEEPGCGVTTRXXXXXXXXXXXXXXXXXX 540
            SKSLWEIDDVDSFLSKGLRFSFPSATSAENNNEEPGCGVTTR                  
Sbjct: 481  SKSLWEIDDVDSFLSKGLRFSFPSATSAENNNEEPGCGVTTRAVADNTSANTTAVSTSTT 540

Query: 541  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEIDIATTKVGGSRKSTAYPSGLSFQECD 600
                                           SEIDIATTKVGGSRKSTAYPSGLSFQECD
Sbjct: 541  NAAETTAAVNTTGARNADDDGTATATTNTTNSEIDIATTKVGGSRKSTAYPSGLSFQECD 600

Query: 601  EMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSISYKIFAC 660
            EMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSISYKIFAC
Sbjct: 601  EMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSISYKIFAC 660

Query: 661  LLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIXXXXXXXX 720
            LLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSI        
Sbjct: 661  LLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQSLQLLSL 720

Query: 721  XXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGV 780
                  NVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGV
Sbjct: 721  LLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGV 780

Query: 781  YYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFS 840
            YYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFS
Sbjct: 781  YYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFS 840

Query: 841  KVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFNQL 900
            KVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFNQL
Sbjct: 841  KVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFNQL 900

Query: 901  KHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAISRQADRS 960
            KHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAISRQADRS
Sbjct: 901  KHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAISRQADRS 960

Query: 961  SSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDN 1020
            SSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDN
Sbjct: 961  SSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDN 1020

Query: 1021 KSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXXXXXISYY 1080
            KSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNT            ISYY
Sbjct: 1021 KSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQKKISYY 1080

Query: 1081 NKLIDHSVGMHASVITSAAIXXXXXXXXXXXXXXXXXXLHYKENKGNGAKRKPEIGSSTT 1140
            NKLIDHSVGMHASVITSAAI                  LHYKENKGNGAKRKPEIGSSTT
Sbjct: 1081 NKLIDHSVGMHASVITSAAIQHQRQQQQQQQQQQQQQQLHYKENKGNGAKRKPEIGSSTT 1140

Query: 1141 TNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQKMESEIP 1200
            TNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQKMESEIP
Sbjct: 1141 TNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQKMESEIP 1200

Query: 1201 VSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHTTGIGGGLTDV 1260
            VSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHTTGIGGGLTDV
Sbjct: 1201 VSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHTTGIGGGLTDV 1260

Query: 1261 XXXXXXXXXXXXXXXXXXXXXXXXXXXLANLSSKDGLFKVPSNGDFLKDYYSGMSSAQLA 1320
                                       LANLSSKDGLFKVPSNGDFLKDYYSGMSSAQLA
Sbjct: 1261 SGHNGLPSNNSLLNMSSIGFGIGSGPSLANLSSKDGLFKVPSNGDFLKDYYSGMSSAQLA 1320

Query: 1321 SLFVNGNTENALQKPTDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLED 1380
            SLFVNGNTENALQKPTDH                                       LED
Sbjct: 1321 SLFVNGNTENALQKPTDHRRYQPSQSQGQQLHLQPHPEPQRQRQQQQQQHPDHQRYPLED 1380

Query: 1381 EPGICEQSKIRTEKKNQQQGYGFVVDXXXXXXXXXXWSPKPGNDDAIILGSDPKDDSEPK 1440
            EPGICEQSKIRTEKKNQQQGYGFVVD          WSPKPGNDDAIILGSDPKDDSEPK
Sbjct: 1381 EPGICEQSKIRTEKKNQQQGYGFVVDASLGLASLLGWSPKPGNDDAIILGSDPKDDSEPK 1440

Query: 1441 LNTARSFTTVNKLDMIPXXXXXXXXXXXXXXDAGLPSSIRPNQNPASIKLVQNPLPLSTR 1500
            LNTARSFTTVNKLDMIP              DAGLPSSIRPNQNPASIKLVQNPLPLSTR
Sbjct: 1441 LNTARSFTTVNKLDMIPTLMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPLSTR 1500

Query: 1501 KQFAQAGNPSRYPFSPDLLQEDGMLTINTRSPRGPRRYWNNTASSTDQPQIHKNNTQQQS 1560
            KQFAQAGNPSRYPFSPDLLQEDGMLTINTRSPRGPRRYWNNTASSTDQPQIHKNNTQQQS
Sbjct: 1501 KQFAQAGNPSRYPFSPDLLQEDGMLTINTRSPRGPRRYWNNTASSTDQPQIHKNNTQQQS 1560

Query: 1561 QQLDDNINDLFKWQNSG 1577
            QQLDDNINDLFKWQNSG
Sbjct: 1561 QQLDDNINDLFKWQNSG 1577

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/987 (52%), Positives = 607/987 (61%), Gaps = 138/987 (13%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSI 653
            L+FQE +E+I LFFD+WYSLIPIFD+SEF++YW KFK+NVSTP FFTSGDT+F +RHKSI
Sbjct: 434  LTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSI 493

Query: 654  SYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIX 713
            SYKIFACLL+TV QMGLM+KVKRE   R  +LN LMTYYDRA+SH+I NPYF S+STSI 
Sbjct: 494  SYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPYFSSSSTSIQ 553

Query: 714  XXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGER 773
                         NVGD+SN+YELRGKVVS  QQLRLHRCPSAVLG DG TV +IQQGER
Sbjct: 554  SLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGER 613

Query: 774  RVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFS 833
            RVLFWGVYYLDVF+SLQLGVPRL+KDHEIECALPVSSD D  VNLAGQMI+LEGKMSPFS
Sbjct: 614  RVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFS 673

Query: 834  LSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTIN 893
            LS+IRFSKVLGNVLDSIFKRGMT S+TK+VALVHENALDNWRH LPD LRFQLDVNGTIN
Sbjct: 674  LSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTIN 733

Query: 894  MDEFNQLKHEYLNNDNS-KFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDT--SVQEKND 950
            M++ NQLK +YLN D + K N  N IFM LYFLAK MIH+PVVA KP +D    V + N 
Sbjct: 734  MEDLNQLKRDYLNKDTALKLN--NAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNI 791

Query: 951  PAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEY 1010
            P    Q DRSSSSY+LLQQATNTFLNVL+S+ + YLPLP+NI+R KTRFGL SARGSLEY
Sbjct: 792  PG--SQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGLVSARGSLEY 849

Query: 1011 TKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXX 1070
            TKGGALFQDNK+LLL+L+K+LE D+KL +PGTISWHSLKL DMA+NLILQPPNT      
Sbjct: 850  TKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQPPNTKPEKQE 909

Query: 1071 XXXXXXISYYNKLIDHSVGMHASVITSAAIXXXXXXXXXXXXXXXXXXLHYKENKGNGAK 1130
                  I+YYNKLID  +G  AS+ T                      +  KE   +  +
Sbjct: 910  KLLQKKINYYNKLIDSHLGPTASLPTPG------QTAPRKPEPAHARPIPEKEKPPSSKR 963

Query: 1131 RKPEIGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVP 1190
             + +  ++ +    L K+VK+E P+  +PT   P+SALHED   +L   L +N+ ++ + 
Sbjct: 964  HRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLAVL- 1022

Query: 1191 TGQKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHT 1250
               K E E  +  SA NAI EAFQLDP+L  TPFS+TDL SF           +A     
Sbjct: 1023 -AAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFF------GVDQYAAPPEL 1075

Query: 1251 TGIGGGLTDVXXXXXXXXXXXXXXXXXXXXXXXXXXXLANLSSKDGLFKVPSNGDFLKDY 1310
                 G                                  LSSKD LFKVPSNGDFLKDY
Sbjct: 1076 QPFPAGYAAPDKVPQAAAQGPSATAGPP------------LSSKDSLFKVPSNGDFLKDY 1123

Query: 1311 YSGMSSAQLASLFVNGNTENALQKPTDHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1370
            YSGMSSAQL SLF   +  +                                        
Sbjct: 1124 YSGMSSAQLNSLFTAPDRRDV--------------------------------------- 1144

Query: 1371 XXXXXXXLEDEPGICEQSKIRTEKKNQQQGYGFVVDXXXXXXXXXXWSPKPGNDDAIILG 1430
                       P   +  +  ++   QQ GYGFVVD          WSP+P +D  ++L 
Sbjct: 1145 ----------RPRAPQPDRAPSDGLQQQPGYGFVVDASLGLAPLLAWSPRPADD--LLL- 1191

Query: 1431 SDPKDDSEPKLNTARSFTTVNKLDMIPXXXXXXXXXXXXXXDAGLPSSIRPNQNPASIKL 1490
                DD   KL +ARSFT VNKL  IP                 L S+  P  +    KL
Sbjct: 1192 ----DDKGAKLASARSFTHVNKLSSIPT----------------LMSTQPPPASAPHAKL 1231

Query: 1491 VQNPLPLSTRKQFAQAGNPSRYPFSPDLLQEDGMLTINTRSPRGPRRYWNNTASSTDQPQ 1550
             Q                    P  PD  Q+DG+LTI  R  RGPRR WN+         
Sbjct: 1232 GQ--------------------PAPPD--QDDGILTIPPRDQRGPRRLWNSAL------- 1262

Query: 1551 IHKNNTQQQSQQLDDNINDLFKWQNSG 1577
                N  + +  LDD+I+DLF+WQNSG
Sbjct: 1263 ----NQARPAAALDDSISDLFRWQNSG 1285

 Score =  387 bits (995), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 228/421 (54%), Positives = 266/421 (63%), Gaps = 61/421 (14%)

Query: 97  GALSPTMVQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           G  SP     S T   TPLSS+TP +YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC
Sbjct: 48  GGASPAAAPQSTT--GTPLSSLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105

Query: 157 KISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSKYXXXXXXXXXX 216
           KISDKLSRRAFPRGY                     CDLKEEQLRLVSKY          
Sbjct: 106 KISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYG--------- 156

Query: 217 XXXXXXXXXXNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRIL 276
                                           +      +  NKK   SD TT E+++IL
Sbjct: 157 ------------------------------CASAPATSSSSANKK-GDSDHTTLEDEQIL 185

Query: 277 QQLSKSDGGTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTA 336
           QQLS SDGG LRVSSTNLYLLNKKT+    L+ P   N      + P   +    +++T 
Sbjct: 186 QQLSNSDGGALRVSSTNLYLLNKKTAAFP-LVQPVQQN------LSPTQLRSNPYTRATL 238

Query: 337 S-SHVADSDNPAEFQKEHLQPRTLPNIPVA-STAIPSAPPGVTAYSLANLNDPTSISFEQ 394
           S SHVA++D+  + +K       LP  PVA S+++   PP    Y   NLNDPTSISFEQ
Sbjct: 239 SPSHVAEADHVTDLRK------GLPANPVAISSSVGQVPP----YPFTNLNDPTSISFEQ 288

Query: 395 DQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQC 454
           DQAPGL AVKALS++A+HE+SSQLA LVA+SIPRTTEEILFVPQLLARIGQ+HGFTSKQC
Sbjct: 289 DQAPGLPAVKALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQC 348

Query: 455 LYTASVLASLKEIVPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATSAENNNEE 514
           LYTASVLASLKEI P +TS  LE L++K+LWEID+VD+FL +GL+      +S + N E 
Sbjct: 349 LYTASVLASLKEITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLEN 408

Query: 515 P 515
           P
Sbjct: 409 P 409

 Score = 40.0 bits (92), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/20 (85%), Positives = 19/20 (95%)

Query: 7  KKDKDTYGPRIIRTLGSQAL 26
          +K+KD YGPRIIRTLGSQAL
Sbjct: 5  RKEKDGYGPRIIRTLGSQAL 24

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/766 (49%), Positives = 479/766 (62%), Gaps = 94/766 (12%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFT-SGDTIFAKRHKS 652
            L+F E +E++ LFF +WY LIP+FDK+EF++Y++KFK NV+ P FF    DT+F  R +S
Sbjct: 500  LNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTVFNNRTRS 559

Query: 653  ISYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSI 712
            ISYKIF+CLL+ +VQMG+++K+KR+ +    KL+ LM YYD+ ++HI  NPYF S +TSI
Sbjct: 560  ISYKIFSCLLIIIVQMGMLSKIKRDKI-TSGKLSTLMKYYDKLMTHIWINPYFNSRNTSI 618

Query: 713  XXXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGE 772
                          NVGDIS+IYELRGKVVS +QQLRLHRCPSAVLGGDG TVS++QQGE
Sbjct: 619  QVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGE 678

Query: 773  RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPF 832
            RR+LFW +YYLDVF++LQLGVPRLLKD EIECALPV+SD DRQVNLAGQMI+LEGK+S F
Sbjct: 679  RRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQF 738

Query: 833  SLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTI 892
            SLSVIRF+KV+GN+LDS FKRGMT S+TK+ ALVHENALDNWRHGL   L FQLDVNGTI
Sbjct: 739  SLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNGTI 798

Query: 893  NMDEFNQLKH--EYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKND 950
            NMDEFNQ K   + L+   + F   + + MTLYF+AK MIH+PVVA KP V  ++Q   D
Sbjct: 799  NMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPLVAEAIQTPTD 858

Query: 951  PAISR-QADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLE 1009
                    DRS SSY+LLQQATNT LNVLT++ + YLPLPIN++R KTRFGLFSARGSLE
Sbjct: 859  NQTENGSVDRSLSSYVLLQQATNTLLNVLTALNSIYLPLPINLARTKTRFGLFSARGSLE 918

Query: 1010 YTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXX 1069
            YTKGGALFQDNK+LLL+L+KELE D+KL +PG  SWHSLKLFD++INLILQP N+     
Sbjct: 919  YTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKT 978

Query: 1070 XXXXXXXISYYNKLIDHSVGMHASVITSAAIXXXXXXXXXXXXXXXXXXLHYKENKGNGA 1129
                   I+YYNKL+            + A+                             
Sbjct: 979  EKMIQKKINYYNKLMGQP---------TVAVKR--------------------------- 1002

Query: 1130 KRKPEIGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDV 1189
            KR P+   +T+      K+VK+E+   +          LH   +     ++ S  +V DV
Sbjct: 1003 KRDPKATENTS------KKVKVEDDHSQ--------DNLHNITTGETTDTVHSEELVKDV 1048

Query: 1190 PTGQKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMF----- 1244
            P       E+ V       I EAFQ+DPVL+   FS+TDL +  N  +  NA        
Sbjct: 1049 P------KELNVYPENYTTIEEAFQMDPVLNTNLFSNTDLKTLFNSGIFENAGSIHNNIN 1102

Query: 1245 ----------------ADTMHTTGIGGGLTDVXXXXXXXXXXXXX-----------XXXX 1277
                              + +   +G G+ D+                            
Sbjct: 1103 DNNNNNNNTNNTNNNNGSSRNIHNLGAGIEDIDHGMSLRSNDASLLNLSNALGNHGNSAE 1162

Query: 1278 XXXXXXXXXXLANLSSKDGLFKVPSNGDFLKDYY-SGMSSAQLASL 1322
                      L NLS+ D LFKVPSNGDFLKDYY + MS+  L++L
Sbjct: 1163 GMKDGTSVSNLLNLSTSDSLFKVPSNGDFLKDYYINNMSNTGLSNL 1208

 Score =  299 bits (766), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 175/393 (44%), Positives = 220/393 (55%), Gaps = 77/393 (19%)

Query: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 181
           SYRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISDKLSRRAFPRGY          
Sbjct: 176 SYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVRE 235

Query: 182 XXXXXXXXXXXCDLKEEQLRLVSKYXXXXXXXXXXXXXXXXXXXXNRSSVNGAVNESASS 241
                      CDLKEEQL LVSKY                                   
Sbjct: 236 LEAENRRLVALCDLKEEQLHLVSKYS---------------------------------- 261

Query: 242 TVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNKKT 301
                            +K   G +  + EE++IL +LSK++GG+LRVSSTNLYLLNKK 
Sbjct: 262 ----------------NSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTNLYLLNKKA 305

Query: 302 SGQQQLLLPGSANKSEA----FPIQPDSYKLQQRSQSTASSHVADSDNPAEFQKEHLQPR 357
           S       PG  +  E+     P++  +         +  + VADSD P++         
Sbjct: 306 S-------PGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSD-PSQ--------- 348

Query: 358 TLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQ 417
                   +            ++  N  DP  ISFEQ++APGL A+KALS+++ ++Q +Q
Sbjct: 349 ------TNTGNNDHIHSNNNNHNQNNSTDPYGISFEQNEAPGLPALKALSSLSKYKQGTQ 402

Query: 418 LATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVPYQTSPELE 477
           LATLVA+S+PRTTEEILFVPQLLARIGQ+HGFTSKQC+YTASVLASLKE       PELE
Sbjct: 403 LATLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPELE 462

Query: 478 LLRSKSLWEIDDVDSFLSKGLRFSFPSATSAEN 510
           +L++ +LWEIDDV  F     +  F + T+ ++
Sbjct: 463 VLKNHNLWEIDDVLHFWKNVFKLDFMTHTAVDH 495

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 11/50 (22%)

Query: 1526 TINTRSPRGPRRYWNNTASSTDQPQIHKNNTQQQSQQLDDNINDLFKWQN 1575
            +I++ + RGPRR WNN ASS+D            +   D +++DL +WQN
Sbjct: 1405 SISSTNRRGPRRRWNNAASSSD-----------PNSAGDSSVSDLLRWQN 1443

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/726 (49%), Positives = 468/726 (64%), Gaps = 67/726 (9%)

Query: 598  ECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSISYKI 657
            E D ++  FF +WY+ IPI DK EF NY+ KFK ++  P FF     +F KR+KSISYKI
Sbjct: 385  EIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKI 444

Query: 658  FACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIXXXXX 717
            F C+L+ + QMGL++KVK ENL   +K + LM YYD  +  ++ NPYF   STSI     
Sbjct: 445  FGCILLIICQMGLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQF 504

Query: 718  XXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLF 777
                     N+G++S++Y+LRGKVVS +QQLRLHRCPSAVLGG+G  VS+ QQGERR+LF
Sbjct: 505  TSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILF 564

Query: 778  WGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVI 837
            WG+YYLDVF++LQLGVPRLLKDHEIECALPV+ + D++VNLAGQMI+LEG++S  SLSVI
Sbjct: 565  WGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI 624

Query: 838  RFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEF 897
            RF+KVLGN+LDSIFKRGM+ S+TK+++LVHENALDNWR GLP  L+F+LDVNGTINMDEF
Sbjct: 625  RFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVNGTINMDEF 684

Query: 898  NQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQ--EKNDPAISR 955
            N LK   L+   + ++KEN   M LYF+AK MIH+PVVA +P V+   Q  E + P+ + 
Sbjct: 685  NHLKQ--LDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPEQSPESSTPS-NN 741

Query: 956  QADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGA 1015
              DRSSSSY+LLQQATNT LNV TS+R  Y P+PIN+SR KTRF L SARGSLEYTKGGA
Sbjct: 742  CGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGA 801

Query: 1016 LFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXXXX 1075
            LFQDNK+LLL+L+KELEVD+KL +PGT+SWHSLKL DM+I+LILQP NT           
Sbjct: 802  LFQDNKALLLDLVKELEVDKKLELPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQR 861

Query: 1076 XISYYNKLIDHSVGMHASVITSAAIXXXXXXXXXXXXXXXXXXLHYKENKGNGAKRKPEI 1135
             ++YYNKL +    +      S+                       K ++  G+   P++
Sbjct: 862  KLNYYNKLTNRRSNLGGGRSASSPGGNSKR----------------KLDENQGSAEPPKL 905

Query: 1136 G-SSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQK 1194
              +S+  +   +K++K+E+    +P     +S   + DSE                   K
Sbjct: 906  TPASSKGDTPPDKKIKLEDTGF-VPVR--AVSQHSQSDSE-------------------K 943

Query: 1195 MESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHTTGIG 1254
             E+  P  ++  N+IAEAF LDPVL+  PFS+TDL +F N    TN       + +   G
Sbjct: 944  FENFQP-PVAPQNSIAEAFHLDPVLNNNPFSNTDLNAFFN----TNNGNVPAALRS---G 995

Query: 1255 GGLTDVXXXXXXXXXXXXXXXXXXXXXXXXXXXLANLSSKDGLFKVPSNGDFLKDYYS-- 1312
            G L ++                                  +GLFKVPSNGDFLKDYY+  
Sbjct: 996  GSLFNIAATAAASGNNANSTAPSNTL-------------NEGLFKVPSNGDFLKDYYNVP 1042

Query: 1313 GMSSAQ 1318
            G SS+Q
Sbjct: 1043 GASSSQ 1048

 Score =  310 bits (793), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 231/417 (55%), Gaps = 106/417 (25%)

Query: 99  LSPTMVQASATPGSTPLSSM--TPMS---YRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           +SPT + ++     T ++S   TP S   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVG
Sbjct: 56  MSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115

Query: 154 FECKISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSKYXXXXXXX 213
           FECKISDKLSRRAFPRGY                     CDLKEEQL LVSKY       
Sbjct: 116 FECKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYS------ 169

Query: 214 XXXXXXXXXXXXXNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEED 273
                                                        NK+   S+ +  E++
Sbjct: 170 ---------------------------------------------NKRT--SEISENEDE 182

Query: 274 RILQQLSKSDGGTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQ 333
           +ILQQLS ++GG+LRVSSTNLYLLNK T G QQ                    + Q  S+
Sbjct: 183 QILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQ------------------DEEDQMSSK 224

Query: 334 STASSHVADSDNPAEFQKEHLQPRTLPNI---PVASTAIPSAPPGVTAYSLANLNDPTSI 390
           +T   +    ++  +           PNI   PV++                NLNDPTSI
Sbjct: 225 TTVDCNGVGCNHSHQ-----------PNIHDKPVST----------------NLNDPTSI 257

Query: 391 SFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFT 450
           SFEQ++APGL AVKAL++MANHE S QLATLVA+S+PR+TEEIL +PQLLARIGQVHG T
Sbjct: 258 SFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLT 317

Query: 451 SKQCLYTASVLASLKEIVPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATS 507
           SKQ LYTAS+LASLKE +P      +++L+S +LWE+DDV  F     +F   + +S
Sbjct: 318 SKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQAESS 374

 Score = 73.9 bits (180), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 97/214 (45%), Gaps = 51/214 (23%)

Query: 1394 KKNQQQGYGFVVDXXXXXXXXXXWSPK-----PG----NDDAIILGSDPKDDSEPKLNTA 1444
            + N   G+GF VD          WSP      PG    N+++IIL +   +  E ++ T 
Sbjct: 1077 QNNDNNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENSIILDTSAAN-MESEMATG 1135

Query: 1445 -------RSFTTVNKLDMIPXXXXXXXXXXXXXXDAGLPSSIRPNQNPASIKLVQNPLPL 1497
                   RS+T    LD++P                 LPSS +  Q    ++   +  P 
Sbjct: 1136 GRLHSNTRSYTDAKNLDIVPT----------------LPSSKQQQQQQHRLQKGASQQPR 1179

Query: 1498 S----TRKQFAQAGNPSRYPFSPDLLQEDGMLTINTRSPRGPRRYWNNTASSTDQPQIHK 1553
            S    TRKQ     NP+    S D    DG+LT+ TR+ RGPRR WN+T     + Q+  
Sbjct: 1180 SASIPTRKQSLCESNPTTATGSRD----DGVLTMGTRNHRGPRRRWNSTTGQNTRTQLAT 1235

Query: 1554 NNTQQ----QSQQL------DDNINDLFKWQNSG 1577
             NT Q    +SQ +      +D+++DLF+WQNSG
Sbjct: 1236 MNTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSG 1269

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 20/22 (90%)

Query: 5  IGKKDKDTYGPRIIRTLGSQAL 26
          + K++++T+ PRIIRTLGSQ+L
Sbjct: 1  MSKRERETFAPRIIRTLGSQSL 22

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/762 (45%), Positives = 455/762 (59%), Gaps = 84/762 (11%)

Query: 593  GLSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVST-PEFFTSGDTIFAKRHK 651
            GLS +E DE+++LFFD W   IPI DK EF +Y+ K K+++ST P  F  G + FA+R+K
Sbjct: 399  GLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNK 458

Query: 652  SISYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNI-LMTYYDRALSHIITNPYFGSNST 710
             ISYKIFAC+L TV QMGL+TKVK E +       + L +YY RA+S I  NPYFG  +T
Sbjct: 459  IISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVLTT 518

Query: 711  SIXXXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQ 770
            S+              N G++S IYELRG+VVS AQQLRLHRCPSAVLGG G T+++ +Q
Sbjct: 519  SLQSLQFLSLLLFYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQ 578

Query: 771  GERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMS 830
            G+RRVLFWG+YYLDVF++LQLGVPRL+KD EIECALPV+ + DR+V+LAGQMI LEG++S
Sbjct: 579  GDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVS 638

Query: 831  PFSLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNG 890
             FSL++IRF+KVLGN+LD++FKRGMT S++K++AL+HENALDNWR GLP  L F+++VNG
Sbjct: 639  QFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNG 698

Query: 891  TINMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKP----------- 939
            TINMD+FN++K     N+ +  N E  + +  YFLAK MIH+PVVA +P           
Sbjct: 699  TINMDKFNEMKQ----NNATVENVEQMVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDI 754

Query: 940  PVDTSVQEKNDPAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRF 999
              +  V +KN    S  A RSSSSY+LLQQATNT LNVL S+++ YLPLP N++R K RF
Sbjct: 755  KEEEEVNDKNGE--SNFAIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVARTKARF 812

Query: 1000 GLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLIL 1059
             L SARGSLEY KGGALF DNK+LLL+++K +E DRKL IPG ISWH LKL DM I+L+L
Sbjct: 813  ALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLL 872

Query: 1060 QPPNTXXXXXXXXXXXXISYYNKLIDHSVGMHASVITSAAIXXXXXXXXXXXXXXXXXXL 1119
            QPPNT            ++YY+++      M   ++ ++++                   
Sbjct: 873  QPPNTKVEKLDRLLKKKLNYYSRV------MGRPILKTSSLRQEANGKRRNSSDDKLSRS 926

Query: 1120 HYKENKGNGAKRKPEIGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKS 1179
              +EN        P   SS +    + K++K+E+ S    TSN  +   + DD       
Sbjct: 927  GTEEN-FRATNLTPI--SSKSDGSPVEKKIKLEDESSD--TSNALVDKSYTDD------- 974

Query: 1180 LRSNTIVSDVPTGQKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEV-- 1237
            L S+     VP             S   AIAEA  LDPVL+    S  DL +F  G +  
Sbjct: 975  LSSSANQPQVPA------------STQTAIAEALHLDPVLNNNILSVADLAAFFGGNMPA 1022

Query: 1238 --------VTNASMFA-DTMHTTGIGGGLTDVXXXXXXXXXXXXXXXXXXXXXXXXXXXL 1288
                     TN + FA   M         +D+                            
Sbjct: 1023 AGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKK------------------------ 1058

Query: 1289 ANLSSKDGLFKVPSNGDFLKDYYSGMSSAQLASLFVNGNTEN 1330
            ++++  DGLF+VPSN DFL D Y    ++ +     N N  N
Sbjct: 1059 SSVTGVDGLFRVPSNADFLMDEYYPSGTSHINLTLFNNNANN 1100

 Score =  282 bits (722), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 164/401 (40%), Positives = 215/401 (53%), Gaps = 95/401 (23%)

Query: 105 QASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 164
           + S     T ++S    + RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKLSR
Sbjct: 78  EVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSR 137

Query: 165 RAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSKYXXXXXXXXXXXXXXXXXX 224
           RAFPRGY                     CD+KE+Q+ LVS +                  
Sbjct: 138 RAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVSHFPT---------------- 181

Query: 225 XXNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDG 284
                                              KK  G+D      +++LQ+L+ ++ 
Sbjct: 182 ---------------------------------NKKKIGGND------EQMLQELTGANN 202

Query: 285 GTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSD 344
           G LR+SSTNL+LLNK   G+Q    P + +  +    +PD              H  D  
Sbjct: 203 GRLRISSTNLFLLNKARDGKQ----PATISNGDDHMTKPD--------HEHTGKHRCDEL 250

Query: 345 NPAEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVK 404
           +     K H +P +                        NLNDPT+ISFEQ++APGL AVK
Sbjct: 251 DCN--NKLHSKPVS-----------------------TNLNDPTAISFEQNEAPGLPAVK 285

Query: 405 ALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASL 464
           AL++MA  EQS+QLATLVA+S+PR+TEEILF+PQLLARI Q+HGFTSKQCLY+ S+LASL
Sbjct: 286 ALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASL 345

Query: 465 KEIVP---YQTSPELELLRSKSLWEIDDVDSFLSKGLRFSF 502
           K  +P        EL+ L++ +LWE+D++D F  + L+F+ 
Sbjct: 346 KNNLPGPQLVKWDELDYLKTTNLWEVDNLDKFFHETLKFNI 386

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/751 (46%), Positives = 461/751 (61%), Gaps = 78/751 (10%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVST-PEFFTSGDTIFAKRHKS 652
            L+  E +E+I ++F E ++LIP+ +++EF  Y+ KFK N++T PEFF +    FA+R KS
Sbjct: 356  LTISEIEELISIYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKS 415

Query: 653  ISYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSI 712
            ISYKIFAC+L+ + Q GLM KVKRE L  ++K ++LM+YY  AL  + TNPYF   +TSI
Sbjct: 416  ISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNTSI 475

Query: 713  XXXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGE 772
                          NVG++S++YE+RG VVS AQQLRLHRCPSAVLG +G T+S+ +QG+
Sbjct: 476  QTLQLLSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGD 535

Query: 773  RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPF 832
            RR+LFWG+YYLDVF +LQLGVPRLLKDHEIECALP+S  +   V+LA Q+I LEG++S  
Sbjct: 536  RRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSEL 595

Query: 833  SLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTI 892
            SLS++RFSK+LGN+LDSIFKRGMT S  ++VAL+HENALDNWR GLP  L F+LDVNGTI
Sbjct: 596  SLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTI 655

Query: 893  NMDEFN---QLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKN 949
             ++E     Q   ++  N +S    +  I M LYFL K ++H+PV+A KP +  S +   
Sbjct: 656  KIEELTGSAQNNQDFTKNASS----DKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDK 711

Query: 950  D--PAI---SRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSA 1004
            D  PA    S  ADRSSSSY+LLQQATNTFL+V +  +T +LPL I++ R K RF L SA
Sbjct: 712  DATPAFDDASSGADRSSSSYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSA 771

Query: 1005 RGSLEYTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNT 1064
            RG LEYTKGGALFQDNK+LLL ++KELE  +KL +PG++SWHSL L DMA  LI+QPP T
Sbjct: 772  RGILEYTKGGALFQDNKALLLEVVKELEASKKLELPGSLSWHSLILLDMATLLIMQPPQT 831

Query: 1065 XXXXXXXXXXXXISYYNKLIDHSVGMHASVITSAAIXXXXXXXXXXXXXXXXXXLHYKEN 1124
                        ++YYNKL      M  S +TS                        ++N
Sbjct: 832  KTDKLDKLLETRLNYYNKL------MGRSTLTSNG---------------------KRKN 864

Query: 1125 KGNGAKRKPEIGS--STTTNMSLNKRVKMEE--PSVKIPTSNGPLSALHEDDSEMLGKSL 1180
            + N A  K    +  S+  N   +KR+K+E    S  +P+++   S  H DD        
Sbjct: 865  EENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSE--SVHHFDD-------- 914

Query: 1181 RSNTIVSDVPTGQKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTN 1240
                I +D     K  +  P +    NAIAEAF LDPVL+  PFS+ DLT+F N +    
Sbjct: 915  ----IQND-----KFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNSD---- 961

Query: 1241 ASMFADTMHTTGIGGGLTDVXXXXXXXXXXXXXXXXXXXXXXXXXXXLANLSSKDGLFKV 1300
                        IGGG + +                           +A  +  DGLF+V
Sbjct: 962  -------NGIPQIGGGSSVLNLAGIGAANSNELNNNNNEAAGGGPRKVAT-TVNDGLFRV 1013

Query: 1301 PSNGDFLKDYYS--GMSSAQLASLFVN-GNT 1328
            PSNGDFLKDYY   G SS+QL  +F+  GNT
Sbjct: 1014 PSNGDFLKDYYRIPGASSSQLNLMFMGPGNT 1044

 Score =  308 bits (789), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 184/410 (44%), Positives = 229/410 (55%), Gaps = 109/410 (26%)

Query: 107 SATPGS----TPLSSMTPMS-YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           SA P +    +P++S TP S YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDK
Sbjct: 47  SAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106

Query: 162 LSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSKYXXXXXXXXXXXXXXX 221
           LSRRAFPRGY                     CDLK+EQ+ LVSKY               
Sbjct: 107 LSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVSKYSS------------- 153

Query: 222 XXXXXNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSK 281
                                                NK+    + ++ EE R+L+QLS 
Sbjct: 154 -------------------------------------NKR---HEPSSTEEGRMLEQLSN 173

Query: 282 SDGGTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVA 341
           SDGG+LRVSSTNLYLLNK T        P   + SE             + Q    +H +
Sbjct: 174 SDGGSLRVSSTNLYLLNKTT--------PAVQDGSEL-----------HKCQGLGCNHAS 214

Query: 342 DSDNPAEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLS 401
                      HL  +     PV+++                L+DP +ISFEQ++APGL 
Sbjct: 215 ---------HPHLHEK-----PVSTS----------------LSDPAAISFEQNEAPGLP 244

Query: 402 AVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVL 461
           AVKAL+TMANHE S+QLA LVA+S+PR+T+EILF+PQLLAR+GQVHG TSKQCLY+AS+L
Sbjct: 245 AVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLL 304

Query: 462 ASLKEI--VPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATSAE 509
           A+LKE     +Q SP+ + L+ KSLWEIDD  +F   G +F+  S+  AE
Sbjct: 305 AALKESSQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAE 354

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 76/180 (42%), Gaps = 35/180 (19%)

Query: 1400 GYGFVVDXXXXXXXXXXWSPK-PGNDDAIILGSDPKDDSEPKLNTARSFTTVNKLDMIPX 1458
            G+GF VD          WSP+ P      I  +  + DS+P L+  R             
Sbjct: 1062 GFGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRDSDP-LSRTR------------- 1107

Query: 1459 XXXXXXXXXXXXXDAGLPSSIRPNQNPASIKLVQNPLPLSTRKQFAQAGNPSRYPFSPDL 1518
                            LPS+  P  +P  + + Q+   +  R+Q+    N     ++ D 
Sbjct: 1108 ----------------LPSATIPASDPTHV-ISQDSNNVHLREQYR--SNSFNQLYAQDQ 1148

Query: 1519 LQEDGMLTINTRSPRGPRRYWNNTASST-DQPQIHKNNTQQQSQQLDDNINDLFKWQNSG 1577
              +D  +TI TRS RGPRR WN++  +T   P   +      S+  ++N  DLF+WQNSG
Sbjct: 1149 SLDDTAITIPTRSHRGPRRRWNSSNGTTVITPNSDRPRNPPSSESENENYKDLFRWQNSG 1208

 Score = 35.0 bits (79), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 20/22 (90%)

Query: 5  IGKKDKDTYGPRIIRTLGSQAL 26
          +G+++ +++GPR IRTLGSQ+L
Sbjct: 1  MGERENESFGPRFIRTLGSQSL 22

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/525 (56%), Positives = 379/525 (72%), Gaps = 28/525 (5%)

Query: 584  SRKSTAYPSG--LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENV-STPEFFT 640
            S+  ++Y  G  L+  E +E+I +FF+     IPI  K EF +Y+ +FKENV    EF  
Sbjct: 386  SKSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFKENVLQNLEFLK 445

Query: 641  S---GDTIFAKRHKSISYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALS 697
            +   G  + A+R K ISYKIF C+++ + Q+GL++K+K ENLG   K + L +YY +A+S
Sbjct: 446  TPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASYYHKAIS 505

Query: 698  HIITNPYFGSNSTSIXXXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAV 757
             +  NPYFG  STS+              N+G++S IYELRG+VVS AQQLRLHRCPSAV
Sbjct: 506  LVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAV 565

Query: 758  LGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVN 817
            LGG G T+++ +QG+RRVLFWG+YYLDVF++LQLGVPRL+KD EIECALPV+ + DR VN
Sbjct: 566  LGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVN 625

Query: 818  LAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHG 877
            LAGQ I LEG+++ +SL++IRFSKVLGN+LDSIFKRGMT SITK+V+L+HENALDNWRHG
Sbjct: 626  LAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHG 685

Query: 878  LPDGLRFQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAG 937
            LP  L F+LDVNGTIN+DEFN+LK   +  + S    EN   + +YFLAK MIH+PVVA 
Sbjct: 686  LPKELIFELDVNGTINIDEFNRLKQMNVTVERS----ENMTLLVMYFLAKCMIHLPVVAT 741

Query: 938  KP-PV-------DTSVQEKN-------DPAISRQ---ADRSSSSYILLQQATNTFLNVLT 979
            +P P        +TS    N       DP+  R    ADRSSSSY+LLQQATNT LNVL 
Sbjct: 742  RPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLE 801

Query: 980  SMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKLGI 1039
            S++T +LPLP+NISR K RF L SARGSLEYTKGGALF DNKSLLL++IK+LE DRKL +
Sbjct: 802  SLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDL 861

Query: 1040 PGTISWHSLKLFDMAINLILQPPNTXXXXXXXXXXXXISYYNKLI 1084
            PG ISW+SLKL DM+INL+LQPPNT            ++YYN+L+
Sbjct: 862  PGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLM 906

 Score =  155 bits (392), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/240 (42%), Positives = 143/240 (59%), Gaps = 45/240 (18%)

Query: 271 EEDRILQQLSKSDGGTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQ 330
           +++R+L++L  ++GG+L +SSTNLYLLN  +  +Q    P    +      QP       
Sbjct: 190 DDERMLRELQSANGGSLNISSTNLYLLNTGSHQRQGPQGPQQQEQLTQQKRQP------- 242

Query: 331 RSQSTASSHVADSDNPAEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSI 390
                   HV D    A   K H++P +                        NLNDPTS+
Sbjct: 243 --------HVCDGLCCA--GKLHVKPVS-----------------------TNLNDPTSV 269

Query: 391 SFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFT 450
           SFEQ +APGL AV+AL+++A  EQS+QLATLVA+S+PR+TEEILF+PQLLARI Q++GFT
Sbjct: 270 SFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFT 329

Query: 451 SKQCLYTASVLASLKEIVP----YQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSAT 506
           SKQCLYT S+L+SLK  +P     +  P LE L S +LWE+DD++ F ++  +F   S +
Sbjct: 330 SKQCLYTVSLLSSLKSSLPEPHLVKHEP-LETLASTNLWEMDDLEQFFAEIFKFKLESKS 388

 Score =  124 bits (311), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 59/82 (71%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXX 183
           RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD+LSRRAFPRGY            
Sbjct: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRELE 158

Query: 184 XXXXXXXXXCDLKEEQLRLVSK 205
                    CD+KE+Q+ L S+
Sbjct: 159 AENRRLVALCDIKEQQIHLFSQ 180

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score =  560 bits (1442), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 273/504 (54%), Positives = 368/504 (73%), Gaps = 9/504 (1%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVST-PEFFTSGDTIFAKRHKS 652
            LS  E +++I ++F+E ++LIP+ +++EF  Y+ KFKE+++  P FF   ++ FA R KS
Sbjct: 356  LSISEIEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKS 415

Query: 653  ISYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSI 712
            ISYKIFAC+L+ V Q+G+M+KVKRE L  + K + +M YY+ A+  +  NPYF   +TS+
Sbjct: 416  ISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSV 475

Query: 713  XXXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGE 772
                          NVG++S++YELRG +VS AQQLRLHRCPSAVLG +G T+S+ +QG+
Sbjct: 476  KTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGD 535

Query: 773  RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPF 832
            RR+LFWG+YYLDVF++LQLGVPRLLKDHEIECALP+S +    V+LA Q+I LEG++S F
Sbjct: 536  RRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEF 595

Query: 833  SLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTI 892
            SLS++RFSK+LGN+LDSIFKRGMT SI ++VAL+HENALD+WR GLP  L F+LDVNGTI
Sbjct: 596  SLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTI 655

Query: 893  NMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKP------PVDTSVQ 946
            NM+E N   H +  + ++  + +N   M LYFL K ++H+PV+A KP       VDT   
Sbjct: 656  NMEELNSGSH-WKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDAT 714

Query: 947  EKNDPAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARG 1006
               D A S    RSSSSY+LLQQATNTFL+V +S+++ +LPL +N+ R K RF L SARG
Sbjct: 715  LAFDDASSGAD-RSSSSYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARG 773

Query: 1007 SLEYTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXX 1066
             LEYTKGGALFQ NK+LLL+++KELE  ++L IPG++SWHSL L DMA++LI+QPP+T  
Sbjct: 774  ILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKA 833

Query: 1067 XXXXXXXXXXISYYNKLIDHSVGM 1090
                      +SYYNKL+  S  +
Sbjct: 834  GKLDKLLEAKLSYYNKLMGRSANV 857

 Score =  187 bits (474), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 150/248 (60%), Gaps = 55/248 (22%)

Query: 266 DSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDS 325
           + ++ EE+++L+QLS S+GG+LRVSSTNLYLLNK +    ++               P++
Sbjct: 158 EPSSTEEEQMLEQLSSSNGGSLRVSSTNLYLLNKTSPAGHEV---------------PEN 202

Query: 326 YKLQQRSQSTASSHVADSDNPAEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLN 385
           +K     Q    +H +           HL  +     PV++T                L+
Sbjct: 203 HK----CQGIDCNHTS---------HPHLHEK-----PVSTT----------------LS 228

Query: 386 DPTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQ 445
           DPT+ISFEQ +APGL AVKALS+MANHE S+QLA LVA+S+PR+TEEILF+PQLLAR+GQ
Sbjct: 229 DPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQ 288

Query: 446 VHGFTSKQCLYTASVLASLKE----IVPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFS 501
           VHG TSKQCLYTAS+LASLKE    +VP  T+  L  L+  SLWEIDD   F     +F+
Sbjct: 289 VHGLTSKQCLYTASLLASLKEPSQAVVP--TTDGLTELKCTSLWEIDDPMRFFKDSCKFN 346

Query: 502 FPSATSAE 509
             S    E
Sbjct: 347 LGSDNDVE 354

 Score =  138 bits (347), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 113 TPLSSMTPMS-YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           +P +S+TP S YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY
Sbjct: 57  SPTASVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116

Query: 172 XXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSKY 206
                                CDLK+EQ+ LV KY
Sbjct: 117 TETLEERVRELEAENRRLVALCDLKDEQMHLVYKY 151

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 61/131 (46%), Gaps = 22/131 (16%)

Query: 1209 IAEAFQLDPVLHATPFSSTDLTSFL---NGEVVTNASMFADTMHTTGIGGGLTDVXXXXX 1265
            +AEAF LDPVL+  PFS+ DLT+F    NG  + N S  A  ++  G+            
Sbjct: 935  VAEAFHLDPVLNNNPFSNGDLTAFFSTDNG--MPNLSGGASMLNMVGVD----------- 981

Query: 1266 XXXXXXXXXXXXXXXXXXXXXXLANLSSKDGLFKVPSNGDFLKDYYS--GMSSAQLASLF 1323
                                  L N    DGLF+VPSNGDFLKDYY   G SS+QL  + 
Sbjct: 982  QAHSTAGNDAQNTVNANSQQSTLFN----DGLFRVPSNGDFLKDYYRVPGASSSQLNLML 1037

Query: 1324 VNGNTENALQK 1334
            +   +  + Q+
Sbjct: 1038 MGSGSSGSNQR 1048

 Score = 52.4 bits (124), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 12/72 (16%)

Query: 1512 YPFSPDLLQEDGMLTINTRSPRGPRRYWNNTASS------TDQPQIHKNNTQQQSQQLDD 1565
            + ++ D   ED  +T+ TR  RGPRR WN+T  +      +D+P+         + + D+
Sbjct: 1140 HTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPR------NAPASETDE 1193

Query: 1566 NINDLFKWQNSG 1577
            N+ DLF+WQNSG
Sbjct: 1194 NLQDLFRWQNSG 1205

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  446 bits (1147), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/495 (47%), Positives = 314/495 (63%), Gaps = 37/495 (7%)

Query: 598  ECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSISYKI 657
            E DE+I+ FF +W  +IPI +K EF + +  FK ++   E     D + +  +  ++YKI
Sbjct: 351  EMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDLKNSE----RDKLSS--NLKMNYKI 404

Query: 658  FACLLVTVVQMGLMTKVKRENLGRRH---KLNILMTYYDRALSHIITNPYFGSNSTSIXX 714
            F C+LV + QMGL+TK+K  N G+      L  +M YY + ++++  N +F   + SI  
Sbjct: 405  FGCILVLMCQMGLLTKIKATN-GKSSPNIHLKSIMAYYHQLIANLPINNFFQIATISIPQ 463

Query: 715  XXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERR 774
                        NVGDIS IYELRG+++S +QQLRLHRCPSAVL G   T++++ Q  RR
Sbjct: 464  LKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRCPSAVLSGSSLTMNKLDQSNRR 523

Query: 775  VLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVS-SDSDRQVNLAGQMISLEGKMSPFS 833
            +LFW +Y LD  +SLQLGVPRLLKD+EIECALP++  D +R        I LEG +SPFS
Sbjct: 524  ILFWTIYSLDALSSLQLGVPRLLKDYEIECALPITMEDKERD----KTKIKLEGTVSPFS 579

Query: 834  LSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTIN 893
            L++ RFSK+LGN+LD IFKR MT S+TK V+L+HENALD WR+ LP+ L F+L++ G+I+
Sbjct: 580  LAIFRFSKILGNILDMIFKRNMTESMTKSVSLIHENALDQWRYDLPEDLTFKLNIQGSID 639

Query: 894  MDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAI 953
            ++  +Q         NS   K+N I M  YF A SMIH+PVVA +P     +  KN    
Sbjct: 640  LNVMHQ--------GNSTPGKKNLILMFFYFFAVSMIHLPVVAARP-----LDVKN---- 682

Query: 954  SRQADRSSSSYILLQQATNTFLNVLTSM----RTAYLPLPINISRAKTRFGLFSARGSLE 1009
                DRSSSSYI LQ A NT LNVL  +    +  YLP+PIN+SR + R  L S+RG L+
Sbjct: 683  -AMPDRSSSSYIALQHAINTMLNVLELLNNQPKNYYLPVPINMSRLQIRSALISSRGMLD 741

Query: 1010 YTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXX 1069
            Y KGGALF DNK+LLL +IK LE DR L +PG +SWHSLKLFD+ I L +Q  N      
Sbjct: 742  YIKGGALFLDNKTLLLQVIKNLERDRTLDLPGVVSWHSLKLFDLTITLFIQNSNIKLEKL 801

Query: 1070 XXXXXXXISYYNKLI 1084
                    +YYNKL+
Sbjct: 802  DKILEKKSNYYNKLM 816

 Score =  135 bits (340), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/120 (55%), Positives = 89/120 (74%), Gaps = 9/120 (7%)

Query: 390 ISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGF 449
           ISFEQ++APGLSAVKAL +MANHEQS+QLATLVA++IPR+T+EILF+PQLL++I Q  GF
Sbjct: 216 ISFEQNEAPGLSAVKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNFGF 275

Query: 450 TSKQCLYTASVLASLKEIVP---------YQTSPELELLRSKSLWEIDDVDSFLSKGLRF 500
           TSK CLYT S+L+SLK  +P           T   L  L+  +LW+ DD+  F+++ L+ 
Sbjct: 276 TSKHCLYTVSLLSSLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYLKL 335

 Score =  110 bits (275), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 43/48 (89%), Positives = 46/48 (95%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R+AQACDRCRSKKTRCDGKRPQCSQCA VGFECKISDKL R++FPRGY
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGY 123

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257 bp,
            1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  451 bits (1159), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 251/538 (46%), Positives = 331/538 (61%), Gaps = 54/538 (10%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTP--EFFTSGDTIFAKRHK 651
            LS  E  E++HLFF  W + + I +   F  Y+  F E +     E   +  T   K H 
Sbjct: 387  LSLNEIKELLHLFFKFWSNQVSILNNDHFLLYFNNFVEVIKALPLELKKTNGT---KTHA 443

Query: 652  SISYKIFACLLVTVVQMGLMTKVKRENL------GRRHKLNILMTYYDRALSHIITNPYF 705
            + +++IFA  L+ ++QMGL+ KVKRE +       +  K   LM YY +  S I  NPYF
Sbjct: 444  TTNHQIFALKLLIMLQMGLLIKVKREKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYF 503

Query: 706  GSNSTSIXXXXXXXXXXXXX-XNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCT 764
             + ST+                NVGDI  IY LRG++VS +QQLRLHRCPSAVL      
Sbjct: 504  LNMSTTSLPSLQLLSLTSFYFLNVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNP 563

Query: 765  V-SRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQM- 822
            V  R +Q ERR+LFW VYY+DVFASLQLGVPRLLKD +IECALP+S D + +  LA +  
Sbjct: 564  VLQRFEQSERRLLFWAVYYIDVFASLQLGVPRLLKDFDIECALPIS-DVEFEDQLASENE 622

Query: 823  --------ISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTIS-ITKEVALVHENALDN 873
                    I L+G++S FSL +IRF+K+LGN+LDSIFKRGM    +T EVALVHENALDN
Sbjct: 623  KTKNKTKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDN 682

Query: 874  WRHGLPDGLRFQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFI------FMTLYFLAK 927
            WR+ LP+   FQ+ VNGT+N+D+   ++     N  +KF++++ I       +  YFLAK
Sbjct: 683  WRNQLPEMYYFQITVNGTVNLDD---IRANNSRNTEAKFDRKDIICFEKNVLLLFYFLAK 739

Query: 928  SMIHIPVVAGKP---PVDTSVQEKN------------------DPAISRQADRSSSSYIL 966
            SMIH+PV+A KP    VD S ++K+                  D  ++  A R+SSSYI+
Sbjct: 740  SMIHLPVIATKPLPKTVDNSTKKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYII 799

Query: 967  LQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLN 1026
            LQQATN  L +  S+ + YLPLP+N+SR   RF L  ARGSLEYTKGGALF DNK+LLL+
Sbjct: 800  LQQATNATLTLFQSINSVYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLD 859

Query: 1027 LIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXXXXXISYYNKLI 1084
             IK++E DR L +PG  SWH+LKLFDM INL+L+ PN             ++YYN+L+
Sbjct: 860  TIKDIENDRLLDLPGVASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLM 917

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 123/209 (58%), Gaps = 34/209 (16%)

Query: 287 LRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDNP 346
           L +SSTN+YLLN+  + Q Q                  + K+      +    +A S  P
Sbjct: 169 LNLSSTNIYLLNQTVNKQLQ------------------NGKIDTNRSDSTMGLLATS--P 208

Query: 347 AEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKAL 406
              QK+H+         V+ T    A P  T+     LNDPT+ISFEQ++APGL AVKAL
Sbjct: 209 PLPQKDHVCD------GVSCTNNLHAKPTSTS-----LNDPTAISFEQNEAPGLPAVKAL 257

Query: 407 STMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKE 466
            +M  H++S+QLATLV++SIPR+TEEILF+PQLL RI Q+ GF SKQCLYT S+L+SLK 
Sbjct: 258 KSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKN 317

Query: 467 IVPYQTSPELELLRSKSLWEIDDVDSFLS 495
            +P   +P+L L  + +  + +D   FL+
Sbjct: 318 RLP---APKLLLSSTSTKIKENDDSKFLN 343

 Score =  127 bits (320), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 67/99 (67%), Gaps = 7/99 (7%)

Query: 107 SATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           S TP STP+       YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL R+A
Sbjct: 54  SPTPLSTPI-------YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKA 106

Query: 167 FPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSK 205
           +P+GY                     CD+KE+Q+ LVS+
Sbjct: 107 YPKGYTESLEERVRELEAENKRLLALCDIKEQQINLVSQ 145

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score =  436 bits (1122), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/491 (46%), Positives = 311/491 (63%), Gaps = 24/491 (4%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSI 653
            LSF + D++ +L+F+ W +LIP+ ++ EF N +  FK    +   F  G+     R    
Sbjct: 398  LSFDDIDDLTNLYFNHWSNLIPVLNEEEFFNRYNNFKIQCQS---FIQGNQSNNLR---- 450

Query: 654  SYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIX 713
             YK F C L+ + QMGL+ K+K       + L  ++TYY +    +  NP +   +TSI 
Sbjct: 451  DYKFFGCFLMVMCQMGLLIKLKEH--KSNNSLFKILTYYHQLTYILPKNPVYDFATTSIK 508

Query: 714  XXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGER 773
                         N+G+I  IYELRG ++S A QLRLHRCPSAVL G G T+ +++Q  R
Sbjct: 509  SVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNR 568

Query: 774  RVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFS 833
            R+LFW +YYLDVF+SLQLGVPRLLKD+EIECALPV + +     + G  I LEG +S  S
Sbjct: 569  RLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPVDNTTTMDA-IDGTSIKLEGTVSQIS 627

Query: 834  LSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTIN 893
            L++ RF+KVLGN++DSIFKR M+ SI+++VAL+HENALDNWR  LP+  +F+LDVNGTIN
Sbjct: 628  LTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTIN 687

Query: 894  MDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAI 953
            +            ND    N +    +  YFLAK MIH+PV + K  ++  V E  +  I
Sbjct: 688  L------------NDLDTENSDTIFLIVFYFLAKCMIHLPVCSTKVDLEDKVTETGNDVI 735

Query: 954  SRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKG 1013
                DR S+SY+ LQQ+TNT LN L  +R  YLP+P N+SR  TRF L SA+GSL+Y KG
Sbjct: 736  YN--DRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKG 793

Query: 1014 GALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXX 1073
            G+LF DNK LLL+ ++++E +RKL +PG ISWHSLKL D+ +NL LQ  NT         
Sbjct: 794  GSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLL 853

Query: 1074 XXXISYYNKLI 1084
               ++YYNKL+
Sbjct: 854  QKKLNYYNKLM 864

 Score =  195 bits (496), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 143/423 (33%), Positives = 199/423 (47%), Gaps = 101/423 (23%)

Query: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 181
           +YRV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+SDKL R+A+PRGY          
Sbjct: 25  NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERVRE 84

Query: 182 XXXXXXXXXXXCDLKEEQLRLVSKYXXXXXXXXXXXXXXXXXXXXNRSSVNGAVNESASS 241
                      CDLKE+Q+ LV+KY                                 SS
Sbjct: 85  LEAENRRLLALCDLKEQQISLVAKY---------------------------------SS 111

Query: 242 TVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNK-- 299
              +I          + +  C  +      +DR     +  +   L +S TNLYLLN+  
Sbjct: 112 NKSNILPTDRCIIELNSDSDCTNNIKGELNKDRQNDVTTIPNSLPLNISQTNLYLLNQTQ 171

Query: 300 ---------KTSGQQQ-------LLLPGSANK-------------SEAFPIQPDSYKLQ- 329
                    K   Q Q          P  ANK             +   P++  +  L+ 
Sbjct: 172 KKAELNNGNKMFQQNQSNVSTSSSSSPFFANKLNSNGTIRSPESNTTVSPLESHTKNLKS 231

Query: 330 --QRSQSTASSHVADSDNPAEFQKEHLQP-RTLPNIPVASTAIPSAPPGVTAYSLANLND 386
             + + +T ++HV D     +  K H QP  T  N P + +   S  PG+ A        
Sbjct: 232 NIRNNNTTTTTHVCDGICCTD--KLHPQPVATNYNDPTSISFEQSEAPGLVA-------- 281

Query: 387 PTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQV 446
                            KAL ++ N E+++QLA LV++S+PR+TEEILF+PQLLA+I QV
Sbjct: 282 ----------------AKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLAKIRQV 325

Query: 447 HGFTSKQCLYTASVLASL-------KEIVPYQTSPELELLRSKSLWEIDDVDSFLSKGLR 499
           HGFTSKQCLYT S+L+SL       K       S    LL++ ++W+I+D++ F +  L+
Sbjct: 326 HGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDNSQNSLLLKNTNIWQINDLNVFFTDLLK 385

Query: 500 FSF 502
           F+ 
Sbjct: 386 FNI 388

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
            CAT8Zinc cluster transcriptional activator necessary for
            derepression of a variety of genes under non-fermentative
            growth conditions, active after diauxic shift, binds
            carbon source responsive elements
          Length = 1433

 Score =  434 bits (1116), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 248/538 (46%), Positives = 330/538 (61%), Gaps = 53/538 (9%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKE---NVSTPEFFTSGDTIFAKRH 650
            LS  E  E++HLFF  W + +PI +   F  Y+  F E   ++ST    T+  T   K  
Sbjct: 394  LSLTEIKELLHLFFKFWSNQVPILNNDHFLIYFNNFVEVVKHLSTENLETNNTT---KST 450

Query: 651  KSISYKIFACLLVTVVQMGLMTKVKRENLGR------RHKLNILMTYYDRALSHIITNPY 704
             + +++IFA  L+ ++QMGL+ K+K E +        + K   LM YY +    I  NPY
Sbjct: 451  VTTNHEIFALKLLMMLQMGLLVKIKMEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPY 510

Query: 705  FGSNSTSIXXXXXXXXXXX-XXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGC 763
            F + ST+                NVGDIS IY +RG++VS AQQLRLHRCPSAVL     
Sbjct: 511  FLNMSTTSLPSLQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSN 570

Query: 764  TV-SRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVS--------SDSDR 814
             V  + +Q ERR+LFW +YY+DVFASLQLGVPRLLKD +IECALP+S        S  + 
Sbjct: 571  PVLQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE 630

Query: 815  QVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTIS-ITKEVALVHENALDN 873
            + +   + I L+G++S FSL +IRF+K+LGN+LDSIFKRGM    IT EVALVHENALDN
Sbjct: 631  KADKKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDN 690

Query: 874  WRHGLPDGLRFQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFIF------MTLYFLAK 927
            WR+ LP+   FQ+ VNGT+N+DE          N  +KF+K++ I       +  YFLAK
Sbjct: 691  WRNQLPEMYYFQITVNGTVNLDEIRATNQR---NTETKFDKKDIILFEKKILLLFYFLAK 747

Query: 928  SMIHIPVVAGKP---PVDTSVQEKN------------------DPAISRQADRSSSSYIL 966
            SMIH+PV+A KP    VD + ++K                   D  ++  A R+SSSYI+
Sbjct: 748  SMIHLPVIATKPLPKNVDNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYII 807

Query: 967  LQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLN 1026
            LQQATN  L +  ++ + YLPLP+N+SR   RF L  ARGSLEYTKGGALF DNK+LLL+
Sbjct: 808  LQQATNATLTIFQAINSMYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLD 867

Query: 1027 LIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXXXXXISYYNKLI 1084
             IK++E DR L +PG  SWH+LKLFDM+INL+L+ PN             ++YYN+L+
Sbjct: 868  TIKDIENDRLLDLPGIASWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLM 925

 Score =  134 bits (337), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 61/86 (70%), Positives = 75/86 (87%)

Query: 384 LNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARI 443
           LNDPT+ISFEQD+APGL AVKAL +M  H++S+QLATLV++SIPR+TEEILF+PQLL RI
Sbjct: 236 LNDPTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRI 295

Query: 444 GQVHGFTSKQCLYTASVLASLKEIVP 469
            Q+ GF SKQCLYT S+L+SLK  +P
Sbjct: 296 RQIFGFNSKQCLYTVSLLSSLKNRLP 321

 Score =  129 bits (323), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 68/100 (68%), Gaps = 7/100 (7%)

Query: 106 ASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           AS TP STP+       YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL R+
Sbjct: 54  ASPTPLSTPI-------YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRK 106

Query: 166 AFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSK 205
           A+P+GY                     CD+KE+Q+ LVS+
Sbjct: 107 AYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQ 146

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  428 bits (1100), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/513 (41%), Positives = 316/513 (61%), Gaps = 34/513 (6%)

Query: 592  SGLSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHK 651
            S LS  E DE++ LFF  W   + + ++ EF  Y+  FK ++          +       
Sbjct: 457  SPLSSSEIDELLKLFFQNWSDFVLMINEKEFYQYYSVFKSDLQNNNISKMSLSTL----- 511

Query: 652  SISYKIFACLLVTVVQMGLMTKVK-------RENLGRRHKLNILMTYYDRALSHIITNPY 704
             ++YKIF  +++   QMGL++K+K        +N  +++ L  +M YY   ++ ++ N +
Sbjct: 512  -MNYKIFGLIILLFCQMGLLSKIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEF 570

Query: 705  FGSNSTSIXXXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCT 764
            F  ++ ++              ++G+ISNIYELR KV+S +QQLRLHRCPSAVL G    
Sbjct: 571  FKISNVTLQSLKLLSLILFYNLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLCGSTLK 630

Query: 765  VSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQM-- 822
            + +++Q  RR+LFW +YYLD+FASLQLGVPRLLKDHEIECALP+  D+D + +   Q   
Sbjct: 631  IHKLEQSNRRLLFWNIYYLDIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSA 690

Query: 823  ----------ISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALD 872
                      I LEG +S  SL +IR+S+++GN+LD IFKR MT S+TK +AL+H +ALD
Sbjct: 691  ATNAENDDNKIKLEGCVSHLSLVIIRYSQIVGNILDMIFKRNMTESMTKSIALIHIHALD 750

Query: 873  NWRHGLPDGLRFQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHI 932
            +WR+ LP  L+F L+VNG+I++  F  +  + LN +  +  ++  + + LYF   +MIH+
Sbjct: 751  DWRNTLPSNLKFDLNVNGSIDLSSF--IDQQNLNEEEQRTQQQKLLVIFLYFFGVNMIHM 808

Query: 933  PVVAGKP-PVDTSVQEKNDPAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPIN 991
            PVVA +P P+      +ND ++++  DRSSSSYI LQ ATNT LNVL  +   Y+PLPIN
Sbjct: 809  PVVASRPLPL-----VEND-SLNQIPDRSSSSYIALQHATNTMLNVLDLLSPTYVPLPIN 862

Query: 992  ISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLF 1051
            +SR   RF + SA G L++ KGG+LF +NK+LL  ++K +E DR L +PG ISWHSLKLF
Sbjct: 863  MSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFLDLPGVISWHSLKLF 922

Query: 1052 DMAINLILQPPNTXXXXXXXXXXXXISYYNKLI 1084
            D+ + L  Q  N              +YYN+L+
Sbjct: 923  DLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLM 955

 Score =  112 bits (280), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/130 (47%), Positives = 88/130 (67%), Gaps = 9/130 (6%)

Query: 382 ANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLA 441
            N N   SISFEQ++APGLS VKAL +M N E+++QLATLV+++IPR+TEEILF+PQ+LA
Sbjct: 297 TNSNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLATLVSLAIPRSTEEILFIPQILA 356

Query: 442 RIGQVHGFTSKQCLYTASVLASLKEIVPYQT---------SPELELLRSKSLWEIDDVDS 492
           ++ Q  GFTSK CLYT S+L+SLK  +             +  LE L++ +LW+ + +  
Sbjct: 357 KVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAASADNKNLETLKNTNLWKFNALFQ 416

Query: 493 FLSKGLRFSF 502
           F +  L+  F
Sbjct: 417 FFTAFLKLDF 426

 Score =  108 bits (270), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%)

Query: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           S R++QACDRCRSKKTRCDGKRPQCSQCA VGFECK+SDKL R+++PRGY
Sbjct: 101 SKRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPRGY 150

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  422 bits (1085), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 256/650 (39%), Positives = 355/650 (54%), Gaps = 91/650 (14%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSI 653
            L+  E DE++ L+F  W   IPIF++ EF++ ++ FK ++   +   +G +        +
Sbjct: 444  LALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLM--KLSKNGPSSL---ENIL 498

Query: 654  SYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIX 713
            + KIF CLL  + QMG++ K K     +  K   L++YY   +  +  N YFG  +TSI 
Sbjct: 499  NIKIFGCLLTVICQMGILIKYKNFK-NKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIK 557

Query: 714  XXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGER 773
                         N GDI  IY+LRG ++S AQQLRLHRCPSAVL G G  + R++QG R
Sbjct: 558  TVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNR 617

Query: 774  RVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFS 833
            R LFW +YYLDVF SLQLGVPRL+KDHEIECALP+SS+      + G  + LEG MS FS
Sbjct: 618  RTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFS 675

Query: 834  LSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTIN 893
            LSV+R +KVLGN+LDSIFKR M+ SIT++V  +HENALD+WR  LP   +F+L+ NG ++
Sbjct: 676  LSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVD 735

Query: 894  MDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAI 953
            ++  N                EN I + L+FL KSMI++P+ +    +  + + KND  +
Sbjct: 736  LEHLNH---------------ENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYM 780

Query: 954  SRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKG 1013
            + +   +S     LQQ+ N  L+V  ++   YLPLP+N SR  TRF L SA+GSLEY KG
Sbjct: 781  NHKVSHTS-----LQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKG 835

Query: 1014 GALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXX 1073
            G LF+DNK LLL++I+E+E DRKL +PG I WHSLKL D+A+NL L  P           
Sbjct: 836  GLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFL 895

Query: 1074 XXXISYYNKLIDHSVGMHASVITSAAIXXXXXXXXXXXXXXXXXXLHYKENKGNGAKRKP 1133
               I+YYNK+      M   +ITS                             +  KRK 
Sbjct: 896  QKKINYYNKI------MGKPLITSLP--------------------------SSKTKRKQ 923

Query: 1134 EIGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQ 1193
                  T N    ++VK E  ++++      +  L  +                    GQ
Sbjct: 924  SKEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKRE--------------------GQ 963

Query: 1194 KMESEIPVSMSATNAIAEAFQLDPVLHAT--PFSSTDLTSFL----NGEV 1237
               +E     S  +A  EA QLDP+L+A    FS TDL++F     NG+V
Sbjct: 964  GNTTE-----STQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDV 1008

 Score =  144 bits (363), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 96/131 (73%), Gaps = 11/131 (8%)

Query: 383 NLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLAR 442
           NLNDPTS+SFEQ++APGL A +A+  ++NHEQS+QLA LV++SIPR+TEEILF+PQLLA+
Sbjct: 299 NLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAK 358

Query: 443 IGQVHGFTSKQCLYTASVLASLKEIVP-----------YQTSPELELLRSKSLWEIDDVD 491
           I QV GFTSKQCLYT S+L+SLK+ +P            Q S   ++L S +LW ++++ 
Sbjct: 359 IRQVFGFTSKQCLYTVSLLSSLKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLS 418

Query: 492 SFLSKGLRFSF 502
           +F    L+ + 
Sbjct: 419 NFFQNVLKLNI 429

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 65/111 (58%), Gaps = 5/111 (4%)

Query: 95  VRGALSPTMVQASATP----GSTPLSSMTP-MSYRVAQACDRCRSKKTRCDGKRPQCSQC 149
           ++  LSP    +S+T     G+ PL S  P  + R +QACDRCR KK +CD KRPQCS C
Sbjct: 137 LKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSC 196

Query: 150 AAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQL 200
           A+VGFECK+SDKL+R +FPRGY                      DLKE+QL
Sbjct: 197 ASVGFECKLSDKLTRNSFPRGYTESLEERIRELESENRRLLAMNDLKEQQL 247

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] {ON}
            YMR280C (REAL)
          Length = 1433

 Score =  415 bits (1066), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 243/546 (44%), Positives = 321/546 (58%), Gaps = 49/546 (8%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSI 653
            LS  E  E++HLFF  W + +PI +   F  Y+  F E V           +      + 
Sbjct: 394  LSLTEIKELLHLFFKFWSNQVPILNNDHFLLYFNNFVEVVKDLSSANLKTNVTNTSIVTT 453

Query: 654  SYKIFACLLVTVVQMGLMTKVKRENLGR------RHKLNILMTYYDRALSHIITNPYFGS 707
            ++++FA  L  ++ MGL+ K+K E +          K   LM YY +    I  NPYF +
Sbjct: 454  NHELFALKLSMMLLMGLLVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLN 513

Query: 708  NSTSIXXXXXXXXXXX-XXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTV- 765
             ST+                NVGDIS IY +RG++VS AQQLRLHRCPSAVL      V 
Sbjct: 514  MSTTSLPSLQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVL 573

Query: 766  SRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQM--- 822
             + +Q ERR+LFW +YY+DVFASLQLGVPRLLKD +IECALP+S D + +  L  +    
Sbjct: 574  QKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPIS-DVEYKDQLFMENKKT 632

Query: 823  ------ISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTIS-ITKEVALVHENALDNWR 875
                  I L+G++S FSL +IRF+K+LGN+LDSIFKRGM    IT EVALVHENALDNWR
Sbjct: 633  NKKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWR 692

Query: 876  HGLPDGLRFQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFIF------MTLYFLAKSM 929
              LP    FQ+ VNGT+N+DE   ++     N  ++F K++ I       +  YFLAKSM
Sbjct: 693  SQLPKMYYFQITVNGTVNLDE---IRVNDSKNIETRFEKKDIILFEKKILLLFYFLAKSM 749

Query: 930  IHIPVVAGKP---PVDTSVQEK-----NDPAISRQAD-------------RSSSSYILLQ 968
            IH+PV+A KP    +D   ++K     ND   S   D             R+SSSYI+LQ
Sbjct: 750  IHLPVIATKPLPKNIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQ 809

Query: 969  QATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNLI 1028
            QATN  L +  ++   Y+PLP+N+SR   RF L  ARGSLEYTKGGALF DNK+LLL+ I
Sbjct: 810  QATNATLMIFQTINWMYIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTI 869

Query: 1029 KELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXXXXXISYYNKLIDHSV 1088
            K++E DR L +PGT SWH+LKL+DM INL+L+ PN             ++YYN+L+   +
Sbjct: 870  KDIENDRLLDLPGTASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPL 929

Query: 1089 GMHASV 1094
                S+
Sbjct: 930  ATTTSI 935

 Score =  135 bits (341), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 111/183 (60%), Gaps = 31/183 (16%)

Query: 287 LRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDNP 346
           L +SSTN+YLLN+  + Q Q                  + K+   + +T  + +A +  P
Sbjct: 170 LNLSSTNIYLLNQTVNKQLQ------------------NGKMDSDNSNTVMNSLAAA--P 209

Query: 347 AEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKAL 406
              QK+H+         ++ T      P  T+     LNDPT+ISFEQD+APGL AVKAL
Sbjct: 210 LPPQKDHVCD------GISCTNHLHVKPTSTS-----LNDPTAISFEQDEAPGLPAVKAL 258

Query: 407 STMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKE 466
             M  H++S+QLATLV++SIPR+TEEILF+PQLL RI Q+ GF SKQCLYT S+L+SLK 
Sbjct: 259 KLMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKN 318

Query: 467 IVP 469
            +P
Sbjct: 319 RLP 321

 Score =  127 bits (319), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 67/100 (67%), Gaps = 7/100 (7%)

Query: 106 ASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
            S TP STP+       YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL R+
Sbjct: 54  TSPTPLSTPI-------YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRK 106

Query: 166 AFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSK 205
           A+P+GY                     CD+KE+Q+ LVS+
Sbjct: 107 AYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQ 146

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] {ON}
            YMR280C (REAL)
          Length = 1432

 Score =  414 bits (1064), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 240/537 (44%), Positives = 323/537 (60%), Gaps = 51/537 (9%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSI 653
            LS  E  E++HLFF  W + +PI +   F  Y+  F E +      ++      K + + 
Sbjct: 393  LSLTEIKELLHLFFKFWSNQVPILNNDHFLLYFNNFVEIIKDFSLISTKANSTTKNNVTT 452

Query: 654  SYKIFACLLVTVVQMGLMTK---------VKRENLGRRHKLNILMTYYDRALSHIITNPY 704
            +++IF   L+ ++QMGL+ K         V R +  +  +L   M+YY +    I  NPY
Sbjct: 453  NHEIFTLKLLMMLQMGLLIKIKKDKIKDTVPRNSNAKYIRL---MSYYHQISLIIPKNPY 509

Query: 705  FGSNSTSIXXXXXXXXXXX-XXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGC 763
            F + ST+                NVGDIS IY +RG++VS AQQLRLHRCPSAVL     
Sbjct: 510  FLNMSTTSLPSLQLLSLASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSN 569

Query: 764  TV-SRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVS--------SDSDR 814
             V  + +Q ERR+LFW +YY+DVFASLQLGVPRLLKD +IECALP+S        S  + 
Sbjct: 570  PVLQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE 629

Query: 815  QVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTIS-ITKEVALVHENALDN 873
            ++    + I L+G++S FSL +IRF+K+LGN+LDSIFKRGM    I+ EVALVHENALDN
Sbjct: 630  KMKNKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDN 689

Query: 874  WRHGLPDGLRFQLDVNGTINMDEFN-----QLKHEYLNNDNSKFNKENFIFMTLYFLAKS 928
            WR+ LP+   F++ VNGT+N+DE        ++  +   D   F K+  I +  YFLAKS
Sbjct: 690  WRNQLPEMYYFKITVNGTVNLDEIRANNSRDIETPFETKDIILFEKK--ILLLFYFLAKS 747

Query: 929  MIHIPVVAGKP---PVDTSVQEKN------------------DPAISRQADRSSSSYILL 967
            MIH+PV+A KP    VD  +++K                   D  ++  A R+SSSYI+L
Sbjct: 748  MIHLPVIATKPLSKNVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIIL 807

Query: 968  QQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNL 1027
            QQATN  L +  S+   YLPLP+N+SR   RF L  ARGSLEYTKGGALF DNK+LLL+ 
Sbjct: 808  QQATNATLTIFQSINWMYLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDT 867

Query: 1028 IKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTXXXXXXXXXXXXISYYNKLI 1084
            IK++E DR L +PG  SWH+LKLFDM INL+L+ PN             ++YYN+L+
Sbjct: 868  IKDIENDRLLELPGIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLM 924

 Score =  132 bits (332), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 110/183 (60%), Gaps = 31/183 (16%)

Query: 287 LRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSDNP 346
           L +SSTN+YLLN+  + Q Q                  S K+   +   A   +A S +P
Sbjct: 169 LNLSSTNIYLLNQTVNKQLQ------------------SGKMDNDNSDAAIDSLAASPSP 210

Query: 347 AEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKAL 406
               K+H+         V+ T      P  T+     L+DPT+ISFEQ++APGL AVKAL
Sbjct: 211 PP--KDHVCD------GVSCTNRLHVKPTSTS-----LSDPTAISFEQNEAPGLPAVKAL 257

Query: 407 STMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKE 466
            +M  H++S+QLATLV++SIPR+TEEILF+PQLL RI Q+ GF SKQCLYT S+L+SLK 
Sbjct: 258 KSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKN 317

Query: 467 IVP 469
            +P
Sbjct: 318 RLP 320

 Score =  127 bits (319), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 69/104 (66%), Gaps = 7/104 (6%)

Query: 102 TMVQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           T+   S TP STP+       YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDK
Sbjct: 49  TVNTTSPTPLSTPI-------YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 101

Query: 162 LSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSK 205
           L R+A+P+GY                     CD+KE+Q+ LVS+
Sbjct: 102 LLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQ 145

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa] {ON}
            similar to uniprot|P39113 Saccharomyces cerevisiae
            YMR280c CAT8 transcription factor involved in
            gluconeogenesis
          Length = 1254

 Score =  372 bits (955), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 217/510 (42%), Positives = 304/510 (59%), Gaps = 42/510 (8%)

Query: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIF----AKR 649
            LS+ E   ++ ++F+ W + IPIF +  F    + FK  V        GD +F     ++
Sbjct: 342  LSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDK-----FGDRLFEVYKTEQ 396

Query: 650  HKSISYKIFACLLVTVVQMGLMTKVKR-----ENLGRRHKLNILMTYYDRALSHIITNPY 704
             K    KIFA +L  + QM L++++K+     + L  +   N L+ +Y++ +  I  + +
Sbjct: 397  IKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQN-LIAHYNQLIEKIHLDSF 455

Query: 705  FGSNSTS-IXXXXXXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHRCPSAVL-GGDG 762
            F   ST+ +              NVGDI  +Y+LRG V+S AQQLRLHRCPSAVL    G
Sbjct: 456  FQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASG 515

Query: 763  CTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQM 822
             T+ + +QGERR+LFW +YYLDVF SLQLGVPRL+KDHEIECALPVS + D Q       
Sbjct: 516  STMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQ------- 568

Query: 823  ISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGM-TISITKEVALVHENALDNWRHGLPDG 881
              LEG++S FSL+VIR++KVLGN+LDSIFKR M + + T+ +A VHE ALD W++ LP+ 
Sbjct: 569  --LEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEK 626

Query: 882  LRFQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGK--- 938
              F+L+ NG  N DE   +K    N++     K + +    YFLAK MIH+PV+A +   
Sbjct: 627  YGFRLEANGLFNFDELTVVK----NSEKDLIEKSSILL--FYFLAKCMIHLPVIATRSAS 680

Query: 939  ------PPVDTSVQEKNDPAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINI 992
                  P   +   E    + ++   R   SYIL+Q+A +T L V+      YLP PINI
Sbjct: 681  LEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINI 740

Query: 993  SRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFD 1052
            SR K RF L +A  ++EY KGG+L+ + K+LL NLI +LE++RKL +PG ISWHSLKL D
Sbjct: 741  SRTKARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLD 800

Query: 1053 MAINLILQPPNTXXXXXXXXXXXXISYYNK 1082
            MA+ L+LQ P T            I++YN+
Sbjct: 801  MALMLLLQSPTTKMEKLDKLVQKKINHYNR 830

 Score =  114 bits (285), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 3/131 (2%)

Query: 388 TSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVH 447
           T +SFEQ+ APGL AVKAL++MA  E+S+QLA LV++++PR+TEEILF+PQL+A I +  
Sbjct: 199 TDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTF 258

Query: 448 GFTSKQCLYTASVLASLKEIVPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATS 507
           GF+SKQ LYT S+L+SLK+ +P   S   +   S + +  +D   F  + L+F     T 
Sbjct: 259 GFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETE 318

Query: 508 AE---NNNEEP 515
            E   N NE P
Sbjct: 319 TENGSNRNESP 329

 Score =  106 bits (265), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (81%), Gaps = 7/65 (10%)

Query: 107 SATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           + + GSTP       +YRVAQACDRCR KKT+CDGK PQCSQCA VGFECKISD+L+R++
Sbjct: 45  TGSRGSTP-------TYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97

Query: 167 FPRGY 171
           FPRGY
Sbjct: 98  FPRGY 102

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 92.8 bits (229), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 39/70 (55%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 102 TMVQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           T+V+ S    S  LS+      R++QACDRCR KK +CDG +P CSQC  V F CK SDK
Sbjct: 77  TLVKTSVNIDSNFLSN------RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDK 130

Query: 162 LSRRAFPRGY 171
           L+RR FPRGY
Sbjct: 131 LTRRGFPRGY 140

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 42/61 (68%)

Query: 111 GSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 170
           G +  +++T  S R A ACDRCR KK +CDG +P CS CA + F CK SDKLSRR  P+G
Sbjct: 28  GQSSSNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKG 87

Query: 171 Y 171
           Y
Sbjct: 88  Y 88

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (68%)

Query: 111 GSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 170
           G +  +++T  S R A ACDRCR KK +CDG +P CS C+ + F CK SDKLSRR  P+G
Sbjct: 28  GQSTSNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKG 87

Query: 171 Y 171
           Y
Sbjct: 88  Y 88

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R +QACDRCR KK +CDG RP C+ C  +G++CK SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 85.5 bits (210), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 38/56 (67%)

Query: 116 SSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           ++ T  S R A ACDRCR KK RCDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 33  NATTDFSVRKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 85.1 bits (209), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           +RV+QACDRCR KK +CDG++P+CS C  + F C IS KLSRR  P+GY
Sbjct: 10  FRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R +QACDRCR KK +CDG +P CSQC  V F C+ SD+L+RR FPRGY
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 36/48 (75%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R +QACDRCR KK +CDG +P CS C  +G+ C  SDKL+RR FPRGY
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 40/51 (78%)

Query: 121 MSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           ++ R++QACDRCR KK +CDG +P C+ C+ + F CK SD+L+RR FP+GY
Sbjct: 76  INIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R++QACDRCR KK +CDG +P C+ C  +GF C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGY 71

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R +QACDRCR KK +CDG +P C+ C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 111 GSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 170
           G +  +++   S R A ACDRCR KK +CDG +P CS C  + F CK SDKLSRR  P+G
Sbjct: 28  GPSTANAVPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKG 87

Query: 171 Y 171
           Y
Sbjct: 88  Y 88

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R++QACDRCR KK +CDG +P C  C+ + F C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGY 71

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R + ACDRCR KK RCDG +P CSQC+   F C  SDKL+RR FP+GY
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           +T    R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKLSRR  P+GY
Sbjct: 18  LTRTKKRHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R  QACDRCR KK +CD  +P CSQC    F+CK +DKL+RR F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 36/51 (70%)

Query: 121 MSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + +R  QACDRCR KK +CDG +P C+ CA + F CK S KLSRR  P+GY
Sbjct: 20  VKFRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 114 PLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           PL+++ P   R +QACDRCR KK +CDG  P C+ C  + F C+ + KLSRR  P+GY
Sbjct: 87  PLATI-PTGRRHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           QACDRCR KK +CD + P C+ C   G  C+ +++L RR F +GY
Sbjct: 43  QACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           M P + +  QACD CR KK +C  ++P+C++C   G+EC  S K  R    R +
Sbjct: 1   MIPSTEKSEQACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC  C+ ++ RCDG  PQC  C   G +C   DK++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 7/128 (5%)

Query: 761 DGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAG 820
           +  T++ I+   R+ +F+ +Y LDV+ +  +G+PR L + + +  LP+   SD  +   G
Sbjct: 461 NNTTLNPIEIEMRKRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPIEI-SDECITENG 519

Query: 821 QMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTI-----SITKEVALVHENALDNWR 875
            +   EG+    S+S+  +   L  +L  I +R  +I     SIT+   +  EN L  W 
Sbjct: 520 YLSEQEGQQLS-SISIANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWA 578

Query: 876 HGLPDGLR 883
             LP  L+
Sbjct: 579 DSLPHELK 586

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG+ P C  C    ++C
Sbjct: 67  RVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           RV +ACD CR KK +CDG++P C  C    +EC  +   +RR
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 76/163 (46%), Gaps = 14/163 (8%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRC-PSAVLG-GDGCTVSRIQQGERRVLFWGVYYLDVFAS 788
           +S  Y   G  +  A +  LHR  P+  +G G     + I+   R+ LF+ +Y LD++ +
Sbjct: 394 LSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDIYVN 453

Query: 789 LQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVI--RFSKVLGNV 846
             LG+PR +  ++ + +LP     +   N+    I  + + +  S + I  + +K++  +
Sbjct: 454 AMLGLPRSISPNDFDQSLPFDLSDE---NITKDEIFFDRQNNVLSSAGIANQHTKLMM-I 509

Query: 847 LDSIFKRGMTISITKEVALVH------ENALDNWRHGLPDGLR 883
            DSI      I  T +  + H      E  L++W + LP  L+
Sbjct: 510 FDSIITELYPIKKTSKFFISHDSITNFELKLNHWLNNLPIELK 552

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%)

Query: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           YR   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 14  YRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 114 PLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           P SS+  +S  +A AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 29  PSSSILGISRSIA-ACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 116 SSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           SS  P   RV +ACD CR KK +CDG++P C  C    + C
Sbjct: 23  SSQQPKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +SN Y   G  +  A +  LHR     +      ++ +    R+ +F+ +Y  D++ +  
Sbjct: 486 LSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLDIEMRKRVFYTIYKCDLYLNSM 541

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLE-GKMSPFSLS--VIRFSKVLGNVL 847
           LG+P+ L   + +  LPV   SD  +   G     + G++S  +++    +   +L ++ 
Sbjct: 542 LGLPKSLSSADFDQVLPVEL-SDENITEEGYFPDKQNGEVSSAAIANYHTKLMLILADIT 600

Query: 848 DSIF--KRGMTISITKEVALVHENALDNWRHGLPDGLR 883
             ++  K+   I ++ E     E  L+NW   LP  L+
Sbjct: 601 KELYPNKKSNNI-VSHETVTQLEMRLENWIQSLPQQLK 637

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           +TP   RV +AC  CR KK RCDGK P CS CA     C+ ++     A PR +
Sbjct: 21  LTPTRLRVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTNT----ARPRSH 69

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 73/164 (44%), Gaps = 21/164 (12%)

Query: 729 GDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFAS 788
           GD+   Y   G  +  A +  LHR PS  L G     + I+   ++ LFW +Y +D++ +
Sbjct: 257 GDLKACYYYIGIALRIAIRENLHRKPS--LTGP----TAIEDETKKRLFWSIYKVDIYMN 310

Query: 789 LQLGVPRLLKDHEIECALPVSSDSDRQV------NLAGQMIS---LEGKMSPFSLSVIRF 839
             LG+P  L +  I+  LP   D ++ V      N    +IS   +  + +   L +++ 
Sbjct: 311 CTLGLPASLNESFIDQELPYDVDDEKIVSDGVIFNENSNIISSCGMNNEHTKLILIMLKI 370

Query: 840 SKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLR 883
            + L ++   I K      I   V L  E+ L  W + LP  L+
Sbjct: 371 YRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQLK 408

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           MTP+   V QACD CR +K RC  + P+CS+C    +EC  S K  R    R
Sbjct: 1   MTPI---VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDGK+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 25/41 (60%)

Query: 773 RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSD 813
           R+ LF+ +Y +D++ +  LG+PR +   + +  LP+  + D
Sbjct: 461 RKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDD 501

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           R   AC+RCR+KKT+CD   P C++CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           QACD CR KK +C   +P C +CA  G+ C  S K  R    R +
Sbjct: 19  QACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           YR++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 47  YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 58/123 (47%), Gaps = 5/123 (4%)

Query: 765 VSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMIS 824
           ++ I+   ++ LF+ VY +D++ +  LG+PR L+  + +  LP+   SD  +   G    
Sbjct: 364 INPIELEMKKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIEL-SDENITAEGYFYE 422

Query: 825 LE-GKMSPFSLS--VIRFSKVLGNVLDSIFKRGMTIS-ITKEVALVHENALDNWRHGLPD 880
            + G++S  ++S    +   V   ++  ++    T + I+ E     E  L  W   LP 
Sbjct: 423 RQKGELSSIAISNQHTKLIMVFDTIVSELYPLKKTNNMISHETVTRLEAKLTEWVDNLPV 482

Query: 881 GLR 883
            LR
Sbjct: 483 ELR 485

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           + QACD CR KK +C  + P+CS+C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 37.0 bits (84), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 8/135 (5%)

Query: 773 RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPF 832
           R+ LF+ +Y LD++ +  LG+PR +   + +  LP+   SD  +   G +   +  +   
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIEL-SDENITEHGYLPENQNGVLSS 466

Query: 833 SLSVIRFSKVLGNVLDSIFKRGMTIS-----ITKEVALVHENALDNWRHGLPDGLRFQLD 887
           +    + +K+L  +L+SI +    I      I+ E     E  L  W   LP  L   L+
Sbjct: 467 TGIANQHTKLLM-ILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTELVPNLE 525

Query: 888 VNGTINMDEFNQLKH 902
            N     +  N+L H
Sbjct: 526 -NIPAKYERANKLLH 539

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           +  ACD CR KK RC  + P+C++C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 114 PLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           P  SM     RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 12  PEKSMQLPRKRVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 164
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 16/159 (10%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +  LHR       G     + I+   R+ LF+ +Y LD++ +  
Sbjct: 394 LSTCYSYIGVAMRSALREGLHR-----QVGPNSGFNPIEIEMRKRLFYTIYKLDIYVNAM 448

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVI--RFSKVLGNVLD 848
           LG+PR +  ++ +  LP+    +   N+  Q    E +    S + I    +K+L  +LD
Sbjct: 449 LGLPRSISANDFDQTLPLELSDE---NITEQGYFPENQNGVLSSTGIANEHTKLLM-ILD 504

Query: 849 SIFKRGMTIS-----ITKEVALVHENALDNWRHGLPDGL 882
           +I      I      I+ E     E  L NW   LP+ L
Sbjct: 505 AIVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPNEL 543

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 16/159 (10%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +   HR  S+  G      S I+   R+ LF+ +Y LDV+ +  
Sbjct: 365 LSTCYTYIGVAMRSALRAGFHRKLSSSSG-----FSPIEIEMRKRLFYTIYKLDVYINAM 419

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVI-----RFSKVLGN 845
           LG+PR +   + +  LP+   SD  +     +   E + S  S + I     +   +L  
Sbjct: 420 LGLPRSISPDDFDQTLPLDL-SDENITEVAYLP--ENQHSVLSSTGISNEHTKLFLILNE 476

Query: 846 VLDSIF--KRGMTISITKEVALVHENALDNWRHGLPDGL 882
           ++  ++  K+   I I+ E     E  L NW   LP  L
Sbjct: 477 IISELYPIKKTSNI-ISHETVTSLELKLRNWLDSLPKEL 514

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%)

Query: 116 SSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           SS T  + +   AC RCRSKK +CD K P C +CA +   C   D  + +  PR Y
Sbjct: 28  SSSTFNTSKSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 38.1 bits (87), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 67/159 (42%), Gaps = 16/159 (10%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +   HR  S   G      S I+   R+ LF+ +Y LDV+ +  
Sbjct: 362 LSTCYTYIGVAMRSALRAGFHRKLSPNSG-----FSPIEIEMRKRLFYTIYKLDVYINAM 416

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVI-----RFSKVLGN 845
           LG+PR +   + +  LP+   SD  +     +   E + S  S + I     +   +L  
Sbjct: 417 LGLPRSISPDDFDQTLPLDL-SDENITEVAYLP--ENQHSVLSSTGISNEHTKLFLILNE 473

Query: 846 VLDSIF--KRGMTISITKEVALVHENALDNWRHGLPDGL 882
           ++  ++  K+   I I+ E     E  L NW   LP  L
Sbjct: 474 IISELYPIKKTSNI-ISHETVTSLELKLRNWLDSLPKEL 511

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 37.0 bits (84), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 5/127 (3%)

Query: 760 GDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLA 819
           G     S I+   R+ LF+ +Y LDV+ +  LG+PR +   + +  LP+    +     A
Sbjct: 387 GTNSGFSPIEIEMRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITETA 446

Query: 820 GQMISLEGKMSPFSLS--VIRFSKVLGNVLDSIF--KRGMTISITKEVALVHENALDNWR 875
               +    +S   +S    +   +L  ++  ++  K+   I I+ E     E  L NW 
Sbjct: 447 YLPENQNAVLSSTGISNEHTKLFLILNEIISELYPIKKTSNI-ISHETVTSLELKLRNWL 505

Query: 876 HGLPDGL 882
             LP  L
Sbjct: 506 DSLPKEL 512

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 66/156 (42%), Gaps = 10/156 (6%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +   HR  SA  G      + I+   R+ LF+ +Y LDV+ +  
Sbjct: 362 LSTCYTYIGVAMRSALRAGFHRKLSANSG-----FTPIEIEMRKRLFYTIYKLDVYINAM 416

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLS--VIRFSKVLGNVLD 848
           LG+PR +   + +  LP+    +    +A    +    +S   +S    +   +L  ++ 
Sbjct: 417 LGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSSTGISNEHTKLFLILNEIIS 476

Query: 849 SIF--KRGMTISITKEVALVHENALDNWRHGLPDGL 882
            ++  K+   I I+ E     E  L NW   LP  L
Sbjct: 477 ELYPIKKTNNI-ISHETVTSLELKLRNWLDSLPKEL 511

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           QACD CR KK +C  ++P+C++C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           Q CD CR KK +C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 8   QVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 164
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 38.5 bits (88), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 19/121 (15%)

Query: 773 RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEG---KM 829
           R+ LF+ +Y LDV+ +  LG+P  L   + +  LP        ++L  + ++ +G     
Sbjct: 404 RKRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELP--------LDLPDEALTEQGINYDQ 455

Query: 830 SPFSLSV-------IRFSKVLGNVLDSIFK-RGMTISITKEVALVHENALDNWRHGLPDG 881
           +P+SLS         +   +LG++L  ++  + + I I+ +     E  L  W   LP  
Sbjct: 456 NPYSLSSTGIANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMWLEELPRE 515

Query: 882 L 882
           L
Sbjct: 516 L 516

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 164
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 54

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 69/156 (44%), Gaps = 10/156 (6%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +  LHR  S   G      S I+   R+ LF+ +Y LDV+ +  
Sbjct: 348 LSTCYAYIGVAMRSALREGLHRSVSPDSG-----FSPIEIEMRKRLFYTIYKLDVYVNAM 402

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMI-SLEGKMSPFSLS--VIRFSKVLGNVL 847
           LG+PR +  ++ +  LP+   SD  +   G    + +GK+S   ++    +   +L  ++
Sbjct: 403 LGLPRSISSNDFDQTLPIEL-SDENITEEGYFPENQKGKLSSAEIANQHTKLIMILNVIV 461

Query: 848 DSIFK-RGMTISITKEVALVHENALDNWRHGLPDGL 882
             ++  R     I  EV    E  L  W  GLP  L
Sbjct: 462 GELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL 497

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 39.3 bits (90), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 69/156 (44%), Gaps = 9/156 (5%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +  +HR     L  D  + + I+   R+ LF+ +Y +DV+ +  
Sbjct: 310 LSTCYTYIGVAMRNALREGMHRN----LNADTHSYNPIEIEMRKRLFYTIYKMDVYVNTM 365

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKM---SPFSLSVIRFSKVLGNVL 847
           LG+PR +   + + ALP +  +D  +   G     +G +   +  +    +   +L N++
Sbjct: 366 LGLPRSVSQRDFDQALP-AELTDEFITKDGLHFEKQGNVLSSAGIANQHTKLIMILDNIV 424

Query: 848 DSIFKRGMTIS-ITKEVALVHENALDNWRHGLPDGL 882
             ++    T + I+ +V    E  L  W   LP  L
Sbjct: 425 AELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 67/156 (42%), Gaps = 9/156 (5%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +  +HR     L  D    S I+   R+ LF+ +Y +DV+ +  
Sbjct: 341 LSTCYTYIGVAMRNALREGMHRN----LNTDTHGYSPIEIEMRKRLFYTIYKMDVYVNTM 396

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKM---SPFSLSVIRFSKVLGNVL 847
           LG+PR +   + + ALP    +D  +   G     +G +   +  +    +   +L N++
Sbjct: 397 LGLPRSVSQRDFDQALPAEL-TDEYITEDGLHPEKQGDVLSSAGIANQHTKLIMILDNIV 455

Query: 848 DSIFKRGMTIS-ITKEVALVHENALDNWRHGLPDGL 882
             ++    T + I+ +V    E  L  W   LP  L
Sbjct: 456 AELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPEL 491

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 72/156 (46%), Gaps = 9/156 (5%)

Query: 731 ISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQ 790
           +S  Y   G  +  A +  LHR  +  +G  G T   I+   R+ LF+ +Y +D++ +  
Sbjct: 296 LSTCYAYIGVAMRSALREGLHR--NLTMGAPGFTPIEIEM--RKRLFFTIYKMDIYLNTM 351

Query: 791 LGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEG-KMSPFSLS--VIRFSKVLGNVL 847
           LG+PR +   + + + P+  D D  +   G     +G ++S   ++    +   +L N++
Sbjct: 352 LGLPRAISQRDFDQSFPLEID-DEYITEDGIYPERQGDELSSAGIANQHTKLIMILDNIV 410

Query: 848 DSIFKRGMTIS-ITKEVALVHENALDNWRHGLPDGL 882
             ++    T + I+ EV    E  L  W + LP  L
Sbjct: 411 SELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL 446

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCRSKKT+CD K P C +C  +   C   D  +    PR Y
Sbjct: 45  ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 7/116 (6%)

Query: 773 RRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPF 832
           R+ LF+ +Y LDV+ +  LG+PR +   + +  LP+    +     A      +G +S  
Sbjct: 431 RKRLFYTIYKLDVYVNAMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLS-- 488

Query: 833 SLSVIRFSKVLGNVLDSIFKRGMTIS-----ITKEVALVHENALDNWRHGLPDGLR 883
           S  +      L  +LD+I ++   I      I+ E     E  L +W + LP  L+
Sbjct: 489 STGIANCHTRLIMILDTIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLPAELK 544

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 114 PLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           P S++  +S  +A AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 35  PTSAIMGISRSIA-ACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 114 PLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           P S++  +S  +A AC RCR +K +CD K P CS+C      C   D  + R  PR Y
Sbjct: 24  PTSAIMGISRSIA-ACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KKTRCD   +RP CS C  +G  C       +R   +GY
Sbjct: 30  KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGY 79

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           + QACD CR KK +C  ++P+CS+C    +EC  S K  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           + P   RV++ACD CR +K RCDG++P C  C    + C
Sbjct: 21  LQPKRLRVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 33.1 bits (74), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 6/113 (5%)

Query: 776 LFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLS 835
           LFW +Y +DV+ +  LG+PR + + +++  LP   D DR  +L G      GK+S   ++
Sbjct: 396 LFWTIYKMDVYMNCILGLPRSISEEDVDQDLPQDLDDDRITDL-GIEPQPAGKISSCGMN 454

Query: 836 -----VIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLR 883
                +I     +   L  +       ++  E     EN L NW   LP  LR
Sbjct: 455 NQHTKLIVIMNHIHCKLSPLKNDAPPATLLLESVHELENELQNWTLQLPLQLR 507

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           V QACD CR KK RC  + P+C++C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR KK +CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFP 168
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK--ISDKLSRRAFP 168
           R++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 27  RLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 111 GSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160
           GS   + +  +  RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 4   GSRSSAELPTIKRRVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 111 GSTPLSSMTPMSYRVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFP 168
           G+T  ++ T    +V++ACD+CR KK +CD     P CS C  VG  C       +R   
Sbjct: 18  GTTYSTTETKKRSKVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPS 77

Query: 169 RGY 171
           +GY
Sbjct: 78  KGY 80

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           + + +ACD CR KK +C   RP+C +C   G++C  S ++ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 124 RVAQACDRCRSKKTRCDG----KRPQCSQCAAVGFEC 156
           RVA+ACDRCR +K +CD     K  +CS C   G EC
Sbjct: 118 RVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           + QACD CR KK +C    P+C QC    + C  S K+ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 119 TPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           T M  RV++ACD CR+KK RC+G+ P C  C      C  +  + RR
Sbjct: 71  TVMRKRVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 108 ATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160
           A+PGST L        RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 2   ASPGSTALPHK---RQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 10  RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           RV +AC+ C+ +K +CDG +P C+ C   G ECK      RR + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R++  C  CR  KTRCD ++P C++C  +  EC + D +++++ PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + QACD CR KK RC  ++P C +C      C  S +  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 164
           R++  C  CR  KT+CD ++P CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           + P   RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 17  LRPKRLRVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 729 GDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFAS 788
           G++   Y   G  +  A    LHR  S+++G      + I+   ++ LFW VY +D++ +
Sbjct: 203 GNLKRCYSYMGIALRAAIAEGLHR-KSSLMGP-----TPIEDESKKRLFWTVYKVDIYMN 256

Query: 789 LQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMS 830
             +G+P+ +    +   LP   D D  +   G +    GK+S
Sbjct: 257 CIMGLPQSISQKTVNMELPKDLD-DENITNQGCIDQPWGKLS 297

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKR 43

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160
           +V QACD CR +K +C GK+P CS C A   +C  S+
Sbjct: 18  KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 100 SPTMVQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           +PT+     +PG      +T    R++  C  CR  KT+C+  +P CS+C  +G  C
Sbjct: 50  NPTITSPITSPGH-----ITKKRNRISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R++  C  CR  KT+CD ++P+CS+C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECSRCIKHGLKC-VYD-VSKQPAPR 104

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 11  RVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR KK +CD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

 Score = 33.1 bits (74), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 766 SRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAG 820
           S ++Q  R+ LF+ +Y ++VF +  LG+P  L   + + +LP+   SD+ ++ +G
Sbjct: 355 SPLEQEMRKRLFYTLYKMEVFVNTMLGLPSSLSKDDYDQSLPLEI-SDKYISDSG 408

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 104 VQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 159
           ++  A+    P   +T  S +V++ACD CR +K +C GK+P CS C A    C+ S
Sbjct: 3   LENKASVPHMPPKRVTKSSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           R+  +C  CR +K +CD KRP C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 9/38 (23%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCA---------AVGFE 155
           ++C+ CR +K RCDGKRP+CS C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R+ +ACD CR KK +CD + P C  C    +EC
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 61/140 (43%), Gaps = 4/140 (2%)

Query: 744 FAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIE 803
           F Q LR        +     T+SR +    R L+W VY  +   S + G+P    D+ I 
Sbjct: 484 FGQALRTCLILGLHVDSQSDTLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTIS 543

Query: 804 CALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEV 863
            ALP   D +         +  + ++    ++++   K+   +L  +++R    +I   +
Sbjct: 544 TALPADIDDETIEEKNSHYVFRKAELISNCVTIV---KINAQILSKLYQRQPETNIIITL 600

Query: 864 ALVHENALDNWRHGLPDGLR 883
            +V +  L+ WR+ L D L+
Sbjct: 601 KVVIKQLLE-WRNNLSDSLQ 619

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 106 ASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           + + PG       +    +V +ACD CR +K +C+G +P C  C   G EC  +D  S +
Sbjct: 8   SKSNPGEVKAQKPSTRRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTK 66

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           R +  C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           QACD CR KK +C  + P CS C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 86/220 (39%), Gaps = 40/220 (18%)

Query: 597 QECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSISYK 656
           Q  DE +  +F ++++  PI D+S F                       +AK+    S K
Sbjct: 205 QIMDEYVEAYFGQFHAAFPIVDESYF--------------------RLCYAKKIIPTSEK 244

Query: 657 IFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIXXXX 716
            +  LL  V+ +G  + V  ++       NI + YY  A  H+ ++  F + S S+    
Sbjct: 245 AWQTLLYAVLALGSWSVVGEDS-------NIDIEYYKSAKYHLCSS-VFETGSHSLLASL 296

Query: 717 XXXXXXXXXXNVGDISNIYELRGKVVSFAQQLRLHR--CPSAVLGGDGCTVSRIQQGERR 774
                     N  + S  +   G   S A  L LHR    SA     G  +       RR
Sbjct: 297 VLLSNYTQKRNKPNTS--WNYLGLAASMAISLGLHREMRDSARTDNSGLEI-------RR 347

Query: 775 VLFWGVYYLDVFASLQLGVP-RLLKDHEIECALPVSSDSD 813
            ++W +Y  D   ++  G P +L K  +++  LP + D +
Sbjct: 348 RMWWVLYGYDCSMAMTFGRPGQLPKLPDVDILLPSNLDKN 387

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 159
           +V++ACD CR +K +C G+RP C+ C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 aa]
           {ON} YKL015W (REAL)
          Length = 981

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 61/140 (43%), Gaps = 4/140 (2%)

Query: 744 FAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIE 803
           F Q LR        +     T+SR +    R L+W VY  +   S + G+P    D+ I 
Sbjct: 483 FGQGLRTCLILGLHVDSQSDTLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTIS 542

Query: 804 CALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEV 863
            ALP   D ++  +     +    ++    ++++   K+   +L  +++R    +I   +
Sbjct: 543 TALPADIDDEKPEHKDNHYVFRRAELISNCVTIV---KINAQILSKLYQRQPETNIIITL 599

Query: 864 ALVHENALDNWRHGLPDGLR 883
            +V +  L  WR+ L D L+
Sbjct: 600 KVVIKQLLQ-WRNNLSDFLQ 618

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 120 PMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           P   +    C  CRS+K +CD  RP C +C   GFEC
Sbjct: 11  PRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R++  C  CR  KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKC-VYD-VSKQPAPR 104

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 62/140 (44%), Gaps = 4/140 (2%)

Query: 744 FAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIE 803
           F Q LR        +     T+++ +    R L+W VY  +   S + G+P    D+ I 
Sbjct: 481 FGQALRTCLILGLHVDSQSDTLTKYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTIS 540

Query: 804 CALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEV 863
            ALP   D +       Q +  + ++    ++++   K+   +L  +++R    +I   +
Sbjct: 541 TALPADIDDETIEGKNNQYVFRKAELISNCVTIV---KINAQILSKLYQRQPETNIIITL 597

Query: 864 ALVHENALDNWRHGLPDGLR 883
            +V +  L+ WR+ L D L+
Sbjct: 598 KVVIKQLLE-WRNNLSDSLQ 616

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 11/63 (17%)

Query: 105 QASATPGSTPL------SSMTPMSY--RVAQACDRCRSKKTRCDGKRP---QCSQCAAVG 153
           + S  PG+TP+        +    Y  R  +ACD CR +K RCD   P   +CS C    
Sbjct: 9   ENSQLPGTTPMIDYGMAMELLQQHYKRRSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFK 68

Query: 154 FEC 156
            EC
Sbjct: 69  VEC 71

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 104 VQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KI 158
           V    T  +  ++S   +  RV++ACD CR +K RCD   PQ   CS C      C  K 
Sbjct: 108 VMMEHTSSNDLIASSKNLKKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKH 167

Query: 159 SDKLSRR 165
            D++ R+
Sbjct: 168 RDEILRK 174

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           R++  C +CR  KTRCD ++P C++C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R++  C  CR  KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCIKHGLKC-VYD-VSKQPAPR 104

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDKLSRRAFP 168
           +V ++C  CR +K +CD K+P+CS CAA    EC   +K +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160
           RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 6   RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 23  RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 124 RVAQACDRCRSKKTRCDGKRP----QCSQCAAVGFEC 156
           RV++ACD CR +K +CD KR     +CS C     EC
Sbjct: 248 RVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           QACD CR KK +C    P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R++  C  CR  KT+CD ++P+CS+CA    +C + D   +RA PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRA-PR 70

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           YR++  C  CR  K +CD ++P CS+C+    EC
Sbjct: 34  YRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 744 FAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIE 803
            AQ++ L R P++  G    T+ +     RR+LFW ++ LD   SL   +P L+K  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQ----SRRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 804 CALPV 808
            ALPV
Sbjct: 444 TALPV 448

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R+   C  CR  KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RILFVCQACRKSKTKCDREKPECGRCVKHGLKC-VYD-VSKQPAPR 104

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 124 RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 156
           R A+AC+ CR +KT+CD   P   +CS C+  G +C
Sbjct: 173 RAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           R++  C  CR  KT+CD ++P CS+C   G  C + D  S++A
Sbjct: 18  RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 120 PMSY---------RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           PM Y         R++  C  CR +K +CD +RP C QCA  G  C + D + R+  PR
Sbjct: 7   PMEYSVGKVQKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD ++P+CS+CA    +C
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC 59

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R++  C  CR  KT+CD ++P+C +C   G  C + D + ++A PR
Sbjct: 55  RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VYD-VEKQAAPR 98

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
           Anc_8.879 YML099C
          Length = 953

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           M P   +    C  CRS+K +CD +RP CS+C     +C
Sbjct: 1   MKPRRAKTFTGCWTCRSRKVKCDLRRPNCSRCERSELQC 39

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           +V++ACD CR +K +C+GK P C+ C     EC  S +
Sbjct: 41  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 68/183 (37%), Gaps = 45/183 (24%)

Query: 735 YELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGE---RRVLFWGVYYLDVFASLQL 791
           Y +    V FAQ + LH            T  R+   E   RR+L+W  Y  D F SL+L
Sbjct: 518 YSIFATAVRFAQDMSLHNLD---------TYKRLSYKECLKRRILWWHCYTTDKFLSLKL 568

Query: 792 GVPRLLKDHEIECALPVSSDSDRQVNLAGQMI---------------------SLEGKMS 830
             P L+ + +    + V +D    V + GQ++                      LE   S
Sbjct: 569 CKPSLINERD----MTVLTDESYVVLIKGQLLPQVGTDREAIDQITTIEEALRKLEEHCS 624

Query: 831 PFSLSVIRFSKVLGNVLDSIFK--------RGMTISITKEVALVHENALDNWRHGLPDGL 882
              + +  ++  L  +   I+         +G T     +  L  +N+L +W   LP  +
Sbjct: 625 FLPVFISYYTTKLARISSKIYYSFFTPTSLKGQTFDTMIDRVLEIKNSLSDWEKYLPGSI 684

Query: 883 RFQ 885
           R +
Sbjct: 685 RLE 687

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 99  LSPTMVQASATPGST---PLSSMTPMSYRVAQACDRCRSKKTRCDGKRP---QCSQCAAV 152
           L+ T+   + +P  T   PL        RV++ACD CR +K +CD  +P   +CS C   
Sbjct: 106 LAHTITSHTESPAFTSISPLDVSGAPKKRVSKACDHCRKRKIKCDDVKPRTGKCSNCTKF 165

Query: 153 GFEC 156
             EC
Sbjct: 166 NAEC 169

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256w HAP1 transcription factor
          Length = 1355

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 103 MVQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           M   +  PG+ P         R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 1   MSTTTTIPGAAPKKKRN----RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 125 RVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 75/172 (43%), Gaps = 22/172 (12%)

Query: 768 IQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEG 827
           I+   ++ LFW VY +D++ +  LG+PR L +  I   LP   D D ++   G +    G
Sbjct: 340 IEDETKKRLFWSVYKVDLYMNCILGLPRTLSESAINQELPRDVD-DEKITTKGILAQDWG 398

Query: 828 KMSPFSLS--VIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLR-- 883
           K+S   ++    +   V+  + +S++        T    +  ++ L+ W   LP  L+  
Sbjct: 399 KISSCGMNNQHTKLMLVMARIHESLYPVLKWDQATYVNIINLQDKLNEWFIELPMQLKPD 458

Query: 884 FQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVV 935
           +Q           FN+ +  Y       + K N +    Y LAK +++ P +
Sbjct: 459 YQF----------FNEEERNY-------YLKPNKLLYLDYLLAKIILYKPFI 493

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           ++ +AC  CR +K +CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 104 VQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 157
           V   AT  ST  + + P+ ++V  AC  C+ +K RCDG+ P C+ C     +C+
Sbjct: 13  VSVLATEPST--NQLEPVRHKVKHACSSCKERKVRCDGQSP-CASCINARVKCE 63

 Score = 39.7 bits (91), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 54/119 (45%), Gaps = 4/119 (3%)

Query: 768 IQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEG 827
           ++Q   + LFW +Y  D++ +  LG+P  L +  I+   P   D DR +     ++   G
Sbjct: 308 LEQETIKKLFWTIYKTDIYMNCILGLPNSLDESLIDQEFPSDIDDDRILE-NRLLVQPSG 366

Query: 828 KMSPFSLS--VIRFSKVLGNVLDSIFKRGMTI-SITKEVALVHENALDNWRHGLPDGLR 883
           K+S   ++    +   ++ N    ++   +T+ SI+       E  L NW   LP  L+
Sbjct: 367 KLSSVGMNNEHTKLILIMNNAHKILYPMSLTVTSISHSEISKLEGELSNWLERLPFQLK 425

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           ACD CR ++ +CDGK+P C +C    FEC     L +R
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKR 43

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160
           +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
           Anc_1.128 YJL206C
          Length = 663

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 768 IQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQ--MISL 825
           I+   ++ LFW +Y ++ + +  LG P  L D  I+  +P+  D DR   L  Q  + + 
Sbjct: 316 IEDEVKKRLFWSIYKMNAYLTSLLGFPTTLSDTLIDQEIPLDIDDDRITVLGIQEPLGTT 375

Query: 826 EGKMSPFSLSVI-----RFSKVLGNVLD--SIFKRGMTIS---ITKEVALVHENALDNWR 875
            G  +  S   +     R   VL +V +  S F  G T+S     +E     E  +++WR
Sbjct: 376 AGDTTRISSCGMNNEHTRLMTVLSHVYEYTSTFTLGATLSQVDTIREHISSLEREIESWR 435

Query: 876 HGLPDGLRF 884
             LP+ LR 
Sbjct: 436 RDLPEPLRL 444

 Score = 39.7 bits (91), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV  AC  CR KK +CDG+ P CS C    ++C
Sbjct: 30  RVRTACSMCRRKKRKCDGRVP-CSFCTKNHYQC 61

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query: 764 TVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALP--VSSDSDRQVNLAGQ 821
           T+SR +   RR L+W VY  +   S + G+P    D+ I   LP  ++   D  + LA  
Sbjct: 630 TLSRCEVEHRRRLWWTVYMFERMLSSKAGLPLSFTDNTISTELPSNINCAQDNDI-LAKY 688

Query: 822 MISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDG 881
              +E      S+ +++ +   G +L  +++R  + +I   +  + +  L NW+  +P+ 
Sbjct: 689 YYYVEAAYIGESVKIVQIN---GQILSKLYQRQPSSNILPILKDILKQLL-NWKSNVPES 744

Query: 882 LRFQLDVN 889
           L  Q+D N
Sbjct: 745 L--QVDFN 750

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160
           ++ +AC RCR +  +C G  P C +C      CK S+
Sbjct: 54  KITRACIRCRERHIKCPGNDP-CQKCLEANHICKFSE 89

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KISDKLSRR 165
           RVA+ACD CR +K +CD   PQ   CS C      C  ++ D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 40  RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           RV +AC  CR +K +C+GK P C  C + G+ C   DK
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDK 51

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 20  RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 120 PMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           P   +    C  CRS+K +CD +RP C +C   G EC
Sbjct: 12  PRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 98  ALSPTMVQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGF 154
           A+ P    A  TP    L + T  ++R   +C  CR +K RC+   K+PQ C++CA +  
Sbjct: 2   AVPPAPHAALHTPHDDALPAAT--NHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNL 59

Query: 155 ECKI 158
           +C I
Sbjct: 60  KCNI 63

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 157
           R    C  CRS+K +CD ++PQC +C     +C+
Sbjct: 11  RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 24  KLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 76/164 (46%), Gaps = 21/164 (12%)

Query: 729 GDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFAS 788
            ++   Y   G  +  A +  LHR  S+++G      + IQ   ++ LFW VY LD++ +
Sbjct: 303 ANLKACYSFIGIALRAALKEGLHR-RSSIVGP-----TPIQDETKKRLFWSVYKLDLYMN 356

Query: 789 LQLGVPRLLKDHEIECALPVSSDSDRQVNLAG------QMIS---LEGKMSPFSLSVIRF 839
             LG P  + + +I+   P+  D D  ++  G      + IS   +  K +   L + R 
Sbjct: 357 CILGFPSGIDESDIDQEFPLDVD-DENISTIGIKFQDWRTISSCGMNNKHTKLILIMSRI 415

Query: 840 SKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLR 883
            K++ ++     +     S T+ V+L   + LDNW   LPD L+
Sbjct: 416 YKLMYSLRRKPLEED---SRTQIVSL--NDQLDNWYAQLPDILK 454

 Score = 39.3 bits (90), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 157
           + P   R  +AC  CR +K RC G  P C  C    +ECK
Sbjct: 36  LKPTKGRAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 97/212 (45%), Gaps = 22/212 (10%)

Query: 729 GDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFAS 788
            ++   Y   G  +  A +  LHR  S++ G        IQ   ++ LFW VY LD++ +
Sbjct: 324 ANLKACYSFIGIALRAALKEGLHR-KSSITGPTA-----IQDETKKRLFWSVYKLDLYMN 377

Query: 789 LQLGVPRLLKDHEIECALPVSSDSDRQVNLAG------QMISLEGKMSPFSLSVIRFSKV 842
             LG P  + + +I+   P+  D D  ++  G      +MIS  G  +  +  ++  S++
Sbjct: 378 CILGFPSGIDESDIDQEFPLDVD-DENISTMGIKFQDWRMISSCGMNNEHTKLILIMSRI 436

Query: 843 LGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFNQLKH 902
              ++ S+ ++ +      ++  +++  L+NW   LPD L+    V+  I  +   QL  
Sbjct: 437 Y-KLMYSLRRKPLEEDSRLQIVSLNDQ-LENWYAQLPDILK----VDKIIYREP--QLPL 488

Query: 903 EYLNNDNSK-FNKENFIFMTLYFLAKSMIHIP 933
               +DNS  + K   +    + L+K +++ P
Sbjct: 489 HICASDNSSPYTKPKKLLYLDFLLSKIVLYKP 520

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD ++P C++C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 43.5 bits (101), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 159
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 43.5 bits (101), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R++  C  CR  K +CD ++P+C++C   G +C   ++  R+  PR
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 aa]
           {ON} YKL015W (REAL)
          Length = 985

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 59/140 (42%), Gaps = 4/140 (2%)

Query: 744 FAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIE 803
           F Q LR        +     T+SR +    R L+W VY  +   S + G+P    D+ I 
Sbjct: 486 FGQALRTCLILGLHVDSQSDTLSRFEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTIS 545

Query: 804 CALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEV 863
             LP   D     +     +  + ++    ++++   K+   +L  +++R    +I   +
Sbjct: 546 TELPADIDDKSSRSKNNHYVFRKAELISNCVTIV---KINAQILSKLYQRQPETNIMITL 602

Query: 864 ALVHENALDNWRHGLPDGLR 883
            +V +  L  WR+ L D L+
Sbjct: 603 KVVIKQLLQ-WRNNLSDFLQ 621

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 170
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 43.5 bits (101), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 126 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFP 168
           +++C  CR +K RCD K P C+ C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 170
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KK +CD K  R  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSFERVPLKRGPSKGY 91

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.654
           YKL015W
          Length = 818

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 62/146 (42%), Gaps = 4/146 (2%)

Query: 744 FAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIE 803
           F Q LR        +     ++ R +    R L+W VY  +   S + G+P    D+ I 
Sbjct: 384 FGQALRTCLILGLHVDSQSDSIDRFKLEHHRRLWWTVYMFERMLSSKAGLPLSFTDNTIS 443

Query: 804 CALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRGMTISITKEV 863
             LP   D     N     I  + +   +  S ++  +V  N+L  +++R    +I   +
Sbjct: 444 TELPNDFDMSNPPNECEHYIFPKAE---YISSCVKIVRVNANILSQLYQRQPKHNILPVL 500

Query: 864 ALVHENALDNWRHGLPDGLRFQLDVN 889
             + +N L +WR+ L D L+   ++N
Sbjct: 501 QKIMKN-LSSWRNELSDNLQVDFNLN 525

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISD 160
           +V ++C  CR +K +CD KRP C+ C   G  EC  +D
Sbjct: 85  KVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 120 PMSYRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 156
           P   RV++ACDRCR +K +CD   P   +CS C      C
Sbjct: 25  PAKKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 102 TMVQASATPGSTPLSS--MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 159
           T V+A++T    P     +   S +V +ACD CR +K +C GK P C+ C A    C  S
Sbjct: 34  TTVKATSTSLHVPTKEKKIRKPSNKVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYS 92

Query: 160 DKLSRR 165
            +  R+
Sbjct: 93  TQRGRK 98

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 66  RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 114 PLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           P++       R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 23  PITKQKRKRNRIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 159
           +V++ACD CR KK +C G  P C  C   G EC  S
Sbjct: 50  KVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVYS 84

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDK 161
           RV ++C  CR +K++CD  +P CS C   G  EC+  D+
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
           finger transcription factor involved in the complex
           regulation of gene expression in response to levels of
           heme and oxygen; the S288C sequence differs from other
           strain backgrounds due to a Ty1 insertion in the carboxy
           terminus
          Length = 1502

 Score = 43.1 bits (100), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 13/66 (19%)

Query: 100 SPTMVQASATPGSTPLSSMTPMSY------------RVAQACDRCRSKKTRCDGKRPQCS 147
           SP M  A+ TPG+   S+  P+              R+  +C  CR +K +CD  RP C 
Sbjct: 24  SPNMHTAT-TPGANTSSNSPPLHMSSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQ 82

Query: 148 QCAAVG 153
           QC   G
Sbjct: 83  QCTKTG 88

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR256W
           (HAP1)
          Length = 1152

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 112 STPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           S+P +S      RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 2   SSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 156
           +V+++C  CR ++ +CD  RP+CS C + G  EC
Sbjct: 14  KVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 162
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           RV +AC+ C+ +K +CDG RP C  C+    EC+   K + R   R
Sbjct: 41  RVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNRRKKR 85

>Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {ON}
           YOR363C (REAL)
          Length = 995

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 14/71 (19%)

Query: 100 SPTMVQASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 159
           SPTM++A+                R++  C  CR  KT+CD ++P+C +C      C I 
Sbjct: 8   SPTMIRANKKRN------------RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IY 54

Query: 160 DKLSRRAFPRG 170
           D ++R+  PR 
Sbjct: 55  D-VARQPAPRN 64

>SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
           Mutants are defective in Ty1 Enhancer- mediated
           Activation Ty1 enhancer activator and to YLR098C
           uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
           Zinc- finger protein with Zn[2]-Cys[6] fungal-type
           binuclear cluster domain DNA-binding transcriptional
           activator or CHA1
          Length = 701

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 106 ASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK-LSR 164
            S  P   P      M  R   AC  CR ++ +CD   P CS C  +  +C ++++ L +
Sbjct: 32  TSEEPFPDPADKQIKMGERKRLACSNCRRRRKKCDLNYP-CSSCVRLRLQCNVNEEDLRK 90

Query: 165 RAFPRGY 171
           + +  GY
Sbjct: 91  KRYSTGY 97

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 22  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           +C RCR  K +C  + P+CS C A  + C+   +L RR+
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.7 bits (99), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 47  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 42.7 bits (99), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCDG--KRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KK +CD    R  C+ C   G +C       +R   +GY
Sbjct: 58  KASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRGPSKGY 107

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 42.7 bits (99), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD ++P C++C      C
Sbjct: 41  RISFVCQECRKAKTKCDKEKPACTRCVKQNLAC 73

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
            CD C+ ++ +CD  +P C +CA +  EC  +    RR
Sbjct: 33  GCDNCKRRRVKCDEGKPFCQKCANMRLECVFTPPQPRR 70

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           S+RV++AC+ CR +K +C+G +P CS+C      C
Sbjct: 17  SHRVSRACNSCRKRKVKCNGVQP-CSKCITSNLRC 50

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           V QACD CR +K +C    P+C++C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 100 SPTMVQASATPGSTPLSSMTPMSYRVA---QACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           +  M Q S  P       +T  +Y +    QAC  CR +K +C+G RP CS C   G EC
Sbjct: 19  AKCMAQDSRPPQVMATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRP-CSSCKTNGLEC 77

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
            CD C+ ++ +CD  +P C +C  +  EC  S    R+A
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA 95

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC 156
           RV++ACD CR +K RCD   PQ   CS C      C
Sbjct: 131 RVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVC 166

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           R  Q CDRCR  K +C G   QC+ C      C     L RR  P+
Sbjct: 38  RRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMATLKRRRKPK 83

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 39.7 bits (91), Expect = 0.011,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 125 VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           V QACD CR ++ +CDGK P C +C      C     L +R 
Sbjct: 37  VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPLRKRG 77

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV  +C  CR +K +CD  RP C QC   G
Sbjct: 61  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 739 GKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLK 798
            ++   AQ+L+L   P  V G     ++ +Q   RR++FW ++ LD   SLQ  +P LL+
Sbjct: 274 AQLARLAQRLQLTADPEYVPGSR--EMADVQ--FRRIIFWQIFQLDTLTSLQNRLPPLLR 329

Query: 799 DHEIECALPVSSDSDRQVN 817
            +E E +LP   D   ++N
Sbjct: 330 YNECETSLPSEFDEGGKLN 348

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 117 SMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK-LSRRAFPR 169
           S T    RV +ACD C+ +K +CDG  P CS C     +C    +  + R  PR
Sbjct: 4   STTKQRLRVQKACDICKRRKVKCDGLSP-CSNCIRHNVDCTYDYRTFASRKKPR 56

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
           to Ashbya gossypii AFR117C
          Length = 1198

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           R+  +C  CR +K RCD  +P C+QC   G
Sbjct: 14  RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 880

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
           Y+++  C  CR  KT+CD K+P C++C  +   C I D L  +  PR
Sbjct: 15  YKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYD-LEYQPLPR 59

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KK +CD K  R  C+ C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSFERVPLKRGPSKGY 91

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 160
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KK +CD    R  C+ C  +G  C       +R   +GY
Sbjct: 50  KASRACDQCRRKKIKCDYNDMRNICTNCQRIGERCSFERVPLKRGPTKGY 99

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 16/77 (20%)

Query: 100 SPTMVQASATPGSTPLSSMTPMSYR---------------VAQACDRCRSKKTRCDGKRP 144
           S T+ + S T G+  L + +   YR               + + C  CR KK +CD +RP
Sbjct: 38  SNTISRPSTTTGNCNLRNGSQKHYRQRASQISGTRKKRKTIIKTCLFCREKKLKCDKRRP 97

Query: 145 QCSQCAAVGF-ECKISD 160
            CS C A  F EC   D
Sbjct: 98  LCSSCIARNFTECVYVD 114

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
           Anc_1.380
          Length = 1478

 Score = 42.4 bits (98), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV  +C  CR +K +CD  RP C QC   G
Sbjct: 38  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 67

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 156
           + C  CR +K RCD  RP CS C A GF EC
Sbjct: 23  RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KK +CD   ++  CS C   G +C       +R   +GY
Sbjct: 70  KASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPSKGY 119

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           QACD CR ++ +CDGKRP CS C     +C
Sbjct: 11  QACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {ON}
           YOR363C (REAL)
          Length = 1002

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 107 SATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           + TP  T ++S+     R++  C  CR  KT+CD ++P+C +C      C I D ++R+ 
Sbjct: 4   NGTPSPT-MNSIGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQK 60

Query: 167 FPRG 170
            PR 
Sbjct: 61  APRN 64

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYLCECTFTTR 74

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 728 VGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFA 787
           + +I    ++    V F  ++ L R    V G D     R     RR L+W  YY +   
Sbjct: 480 LAEIYGFEKVLNVAVHFVSRVGLSRWEFYV-GLDEAFAER-----RRSLWWKAYYFEKTL 533

Query: 788 SLQLGVPRLLKDHEIECALP 807
           + +LG P  + D +I C LP
Sbjct: 534 ASKLGYPSNIDDSKINCLLP 553

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQ--CSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KK +CD K  +  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGPSKGY 91

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 10  RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1.380
           YLR256W
          Length = 1429

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 155
           R+  +C  CR +K +CD   P C+QC   G +
Sbjct: 40  RIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQ 71

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 844

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
            CD C+ ++ +CD  +P C +C  +  EC
Sbjct: 53  GCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
           (REAL)
          Length = 831

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK--LSRRAFPRGY 171
           R+   C +C+  K +CD  RP CS+C     ECK  D   LS +    G+
Sbjct: 10  RLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYEDSADLSSKVIASGF 59

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDKLS 163
           ++C  CR +K +CD  +P CS C A  F EC  SD ++
Sbjct: 33  KSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAIN 70

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1244

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFECKI--SDKLSRR 165
           AC  CR K+ +CD +RP CS C   G EC    +DK ++R
Sbjct: 16  ACQNCRIKRRKCDMERP-CSNCLKYGIECITVNNDKRTKR 54

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 bp,
           1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
           YML099C
          Length = 835

 Score = 42.0 bits (97), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 128 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
            C  CRS+K +CD +RP C +C   G +C
Sbjct: 27  GCWTCRSRKVKCDLQRPNCGRCEKSGLDC 55

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 126 AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 166
           A +C RCR  K +C  +RP C+ C   G  C    +  RR+
Sbjct: 40  AYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 94/214 (43%), Gaps = 26/214 (12%)

Query: 729 GDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFAS 788
            ++   Y   G  +  A +  LHR  S+++G      + I+   ++ LFW VY LD++ +
Sbjct: 315 ANLKACYSFIGIALRAALKDGLHR-KSSIVGP-----TPIEDETKKRLFWSVYKLDLYMN 368

Query: 789 LQLGVPRLLKDHEIECALPVSSDSDRQVNLAG------QMIS---LEGKMSPFSLSVIRF 839
             LG P  + + +I+   P+  D D  ++  G      + IS   +  K +   L + R 
Sbjct: 369 CILGFPSGIDESDIDQEFPLDVD-DENISTTGIKFQDWRTISSCGMNNKHTKLILIMSRI 427

Query: 840 SKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFNQ 899
            K++ ++     +    + I   V+L   + LD+W   LPD L+       TI   +   
Sbjct: 428 YKLMYSLRRKPLEEDSRLQI---VSL--NDQLDDWYTQLPDTLKV-----DTIRYHQPQP 477

Query: 900 LKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIP 933
                 N+ NS ++K   +    + L+K +++ P
Sbjct: 478 PLSICTNDRNSSYSKPKKLLYLDFLLSKIVLYKP 511

 Score = 40.8 bits (94), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 157
           + P   R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 47  LKPTRGRAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQ--CSQCAAVGFECKISDKLSRRAFPRGY 171
           + ++ACD+CR KK +CD K  +  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGLCSNCQRNGDRCSFERVPLKRGPSKGY 91

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
           (REAL)
          Length = 473

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 165
           QACD CR ++ +CDGK+P C++C     +C     L +R
Sbjct: 11  QACDCCRVRRVKCDGKKP-CNRCLQHDLKCTYLQPLRKR 48

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1237

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
           to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
           weakly similar to YAL051W uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 975

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           R++  C  CR  KT+CD ++P+C +C     +C
Sbjct: 30  RISFVCQACRKNKTKCDREKPRCGRCVKYHLKC 62

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON} 
          Length = 881

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           S R    C  C+S+K RC+  RP CS+C  +G  C
Sbjct: 28  SKRTVSVCIPCKSQKLRCNKARPICSRCQRLGKHC 62

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 120 PMSYRVAQACDRCRSKKTRCDG---KRPQCSQCAAVGFECKISDKLSRR 165
           P   R ++ACD CR +K +CD    +  +CS C     EC  S++  R+
Sbjct: 94  PPKKRASKACDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKRK 142

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 77/161 (47%), Gaps = 15/161 (9%)

Query: 729 GDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLDVFAS 788
            ++   Y   G  +  A +  LHR  S+++G      + IQ   ++ LFW VY LD++ +
Sbjct: 291 ANLKACYSFIGIALRAALKEGLHR-KSSIVGP-----TPIQDETKKRLFWSVYKLDLYMN 344

Query: 789 LQLGVPRLLKDHEIECALPVSSDSDRQVNLAG------QMISLEGKMSPFSLSVIRFSKV 842
             LG P  + + +I+   P+  D D  ++  G      + IS  G  +  +  ++  S++
Sbjct: 345 CILGFPSGIDESDIDQEFPLDVD-DENISTMGIKFQDWRTISSCGMNNKHTKLILIMSRI 403

Query: 843 LGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLR 883
              ++ S+ ++ +      ++  +++  L+NW   LPD L+
Sbjct: 404 Y-KLMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLPDILK 442

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 118 MTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 157
           + P   R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 23  LKPTRGRAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {ON}
           
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           +V +AC  CR +K +C G  P CS CAA   EC
Sbjct: 12  KVVKACLNCRRRKIKCTGTFP-CSNCAAYQCEC 43

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 41.6 bits (96), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 21/43 (48%)

Query: 127 QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 169
             CD C+ ++ +CD  +P C +C  +   C  +    RR+  R
Sbjct: 62  NGCDNCKRRRVKCDESKPHCQKCVNMQLHCVYTPPQPRRSKGR 104

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 875

 Score = 41.6 bits (96), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 156
           +++  C  CR  KT+CD  +P CS+CA +G  C
Sbjct: 19  KLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIR023W
           (DAL81)
          Length = 1010

 Score = 41.6 bits (96), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 77/190 (40%), Gaps = 54/190 (28%)

Query: 733 NIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRI---QQGERRVLFWGVYYLDVFAS- 788
           N + L  +VV+ A+ L L         G  C   R+   ++G RR L W V+Y D + S 
Sbjct: 449 NNWILCSEVVALAEDLGL---------GIDCKDWRLPSWERGLRRRLAWAVWYQDKWISM 499

Query: 789 -------LQLG---VPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSV-- 836
                  L LG   + ++L D +     PV S+S  + N         GK +P ++SV  
Sbjct: 500 LEARYSHLILGRNWLVKMLSDQDFSANSPVISNSQEKSNANIGT----GKTAPSNISVLD 555

Query: 837 ------------------IRFSKVLGNVLDSIFKRGMTISITKEVALVHENA------LD 872
                             +  S +LG +LD+ +  G  IS T ++  V + A      L 
Sbjct: 556 LSPTDEDFNNGKLLFRQMVSLSIILGEILDTFYTLG-AISTTTKIEQVLKLAKPLQLKLR 614

Query: 873 NWRHGLPDGL 882
            W H LP  L
Sbjct: 615 EWYHSLPSKL 624

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} similar
           to uniprot|P32862 Saccharomyces cerevisiae YKL038w RGT1
          Length = 1287

 Score = 41.6 bits (96), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 125 VAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRG 170
           V++ACD+CR KK +CD   +R  C+ C   G  CK      +R   +G
Sbjct: 12  VSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKFERVPLKRGPSKG 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 136,734,497
Number of extensions: 5395992
Number of successful extensions: 15667
Number of sequences better than 10.0: 665
Number of HSP's gapped: 16034
Number of HSP's successfully gapped: 773
Length of query: 1577
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1454
Effective length of database: 39,377,481
Effective search space: 57254857374
Effective search space used: 57254857374
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 73 (32.7 bits)