Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46158.844ON1067106746880.0
ABL122C8.844ON1043102430490.0
SAKL0D01364g8.844ON108297214510.0
KLTH0C03784g8.844ON99782714021e-176
Kwal_27.102398.844ON91495113851e-175
TDEL0B005408.844ON111569613121e-162
KAFR0A028508.844ON104280412891e-159
ZYRO0G14256g8.844ON125972512341e-149
KNAG0G034408.844ON105388612151e-148
CAGL0B02365g8.844ON105070911991e-146
NCAS0B002808.844ON108171111601e-140
TPHA0I002708.844ON103967911411e-138
KLLA0D01485g8.844ON115166111431e-137
Kpol_1068.58.844ON10325099621e-112
TBLA0B032808.844ON13622599131e-103
Suva_13.268.844ON11223968911e-102
NDAI0E002708.844ON11982728881e-101
YML117W (NAB6)8.844ON11344918646e-98
Smik_13.178.844ON11313208575e-97
Skud_13.248.844ON11283998522e-96
KAFR0B066906.183ON5332094393e-45
NCAS0H010406.183ON6292094329e-44
SAKL0A05280g6.183ON5822044263e-43
KLLA0E19031g6.183ON6522024268e-43
Ecym_22336.183ON5762024221e-42
AFL061C6.183ON5232024181e-42
Kpol_1002.696.183ON5902104212e-42
TBLA0B052106.183ON7102094252e-42
ZYRO0G08140g6.183ON6322094203e-42
KLTH0H04906g6.183ON5692044149e-42
Kwal_27.111586.183ON5672034131e-41
NDAI0F022606.183ON6802094153e-41
Suva_16.1236.183ON5962094113e-41
TDEL0G016206.183ON5842094104e-41
CAGL0C01419g6.183ON6392094124e-41
Smik_6.3906.183ON6252124107e-41
Skud_16.946.183ON6142094081e-40
YPL184C (MRN1)6.183ON6122124071e-40
KNAG0M004306.183ON4432093962e-40
TPHA0J022106.183ON5932134017e-40
Skud_2.3456.104ON664105940.021
SAKL0A07370g6.104ON49082910.040
Suva_4.4706.104ON66380900.058
Smik_2.3556.104ON73685900.065
YBR212W (NGR1)6.104ON67280890.077
KLTH0H06842g6.104ON547100840.30
TDEL0G036706.104ON61780772.0
TBLA0C018208.670ON39470735.5
TPHA0I028907.485ON42486726.3
TBLA0D028108.466ON30655726.4
AFR117C1.380ON115269729.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4615
         (1067 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...  1810   0.0  
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...  1179   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   563   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   544   e-176
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   538   e-175
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   509   e-162
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   501   e-159
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   479   e-149
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   472   e-148
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   466   e-146
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     451   e-140
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   444   e-138
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   444   e-137
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   375   e-112
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   356   e-103
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   347   e-102
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     346   e-101
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   337   6e-98
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   334   5e-97
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   332   2e-96
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   173   3e-45
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   171   9e-44
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   168   3e-43
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   168   8e-43
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   167   1e-42
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   165   1e-42
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   166   2e-42
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   168   2e-42
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   166   3e-42
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   164   9e-42
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   163   1e-41
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    164   3e-41
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   162   3e-41
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   162   4e-41
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   163   4e-41
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   162   7e-41
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   161   1e-40
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   161   1e-40
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   157   2e-40
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   159   7e-40
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    41   0.021
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    40   0.040
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    39   0.058
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    39   0.065
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    39   0.077
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    37   0.30 
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    34   2.0  
TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {O...    33   5.5  
TPHA0I02890 Chr9 complement(635136..636410) [1275 bp, 424 aa] {O...    32   6.3  
TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON...    32   6.4  
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    32   9.3  

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
            similar to Ashbya gossypii ABL122C
          Length = 1067

 Score = 1810 bits (4688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 902/1067 (84%), Positives = 902/1067 (84%)

Query: 1    MRQLGQQQQENHRKSSNSYMANNQRLGAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHH 60
            MRQLGQQQQENHRKSSNSYMANNQRLGAV                            IHH
Sbjct: 1    MRQLGQQQQENHRKSSNSYMANNQRLGAVDQDQKHGQEQDQEQEQDQDQDEQPRPQQIHH 60

Query: 61   QRFFPSGDVXXXXXXXXXMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGXXXXX 120
            QRFFPSGDV         MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQG     
Sbjct: 61   QRFFPSGDVASSLSAAASMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPS 120

Query: 121  XXXXXXXXXXFXXXXXXXXXXXXXXXXXXSFSLNHSEPYQVNFKILPKGKDEYMTRSLLF 180
                      F                  SFSLNHSEPYQVNFKILPKGKDEYMTRSLLF
Sbjct: 121  ASSHSNHSRSFLYYPQPPILKPIPPRRRKSFSLNHSEPYQVNFKILPKGKDEYMTRSLLF 180

Query: 181  SNLERQENFDIHNFLTNFIKFGPIESIYLLDDSHSILLSFLTKATCLDFYNNLLQRFSEF 240
            SNLERQENFDIHNFLTNFIKFGPIESIYLLDDSHSILLSFLTKATCLDFYNNLLQRFSEF
Sbjct: 181  SNLERQENFDIHNFLTNFIKFGPIESIYLLDDSHSILLSFLTKATCLDFYNNLLQRFSEF 240

Query: 241  KSKLHSTKLSVSFVCQDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIPW 300
            KSKLHSTKLSVSFVCQDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIPW
Sbjct: 241  KSKLHSTKLSVSFVCQDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIPW 300

Query: 301  LFFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISK 360
            LFFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISK
Sbjct: 301  LFFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISK 360

Query: 361  IQFVNVNGHSSDLSDEDAVAAANGLQREXXXXXXXXXXXXXXXXXDLVELFHSLDLALGI 420
            IQFVNVNGHSSDLSDEDAVAAANGLQRE                 DLVELFHSLDLALGI
Sbjct: 361  IQFVNVNGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISNSSDLVELFHSLDLALGI 420

Query: 421  ISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXXXXSNAMQG 480
            ISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMD          SNAMQG
Sbjct: 421  ISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDGGPNGGTPNGSNAMQG 480

Query: 481  VLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFM 540
            VLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFM
Sbjct: 481  VLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFM 540

Query: 541  DPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWI 600
            DPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWI
Sbjct: 541  DPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWI 600

Query: 601  HSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASR 660
            HSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASR
Sbjct: 601  HSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASR 660

Query: 661  NVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWV 720
            NVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWV
Sbjct: 661  NVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWV 720

Query: 721  NFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSR 780
            NFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSR
Sbjct: 721  NFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSR 780

Query: 781  FFKKIKKLNCTTKPNKRQQSKRGTXXXXXXXXXXXXXXTEKVPVSSKEPVCDEILGLNDD 840
            FFKKIKKLNCTTKPNKRQQSKRGT              TEKVPVSSKEPVCDEILGLNDD
Sbjct: 781  FFKKIKKLNCTTKPNKRQQSKRGTSSASSDDARKDDASTEKVPVSSKEPVCDEILGLNDD 840

Query: 841  NALAEGLGISLSSAYVNEYGDDISKRTNKKNRSKTETVEEDTGYTTSGSSDIDIIVAPPL 900
            NALAEGLGISLSSAYVNEYGDDISKRTNKKNRSKTETVEEDTGYTTSGSSDIDIIVAPPL
Sbjct: 841  NALAEGLGISLSSAYVNEYGDDISKRTNKKNRSKTETVEEDTGYTTSGSSDIDIIVAPPL 900

Query: 901  EHNKGKEGNSNHXXXXXXXXXXXXLQNXXXXXXXXXXXXHSQHYLAGSFELVNSNTYLDS 960
            EHNKGKEGNSNH            LQN            HSQHYLAGSFELVNSNTYLDS
Sbjct: 901  EHNKGKEGNSNHGKSKRKSQGGKRLQNGAQDGVGGGYGGHSQHYLAGSFELVNSNTYLDS 960

Query: 961  IPPLVPSPINQHFHDKSLCRGSAHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAKFS 1020
            IPPLVPSPINQHFHDKSLCRGSAHV                              QAKFS
Sbjct: 961  IPPLVPSPINQHFHDKSLCRGSAHVNDNNNALGGFNNYSYNCGGSNNGNRTRRRRQAKFS 1020

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVNANEP 1067
            KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVNANEP
Sbjct: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVNANEP 1067

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1024 (60%), Positives = 709/1024 (69%), Gaps = 42/1024 (4%)

Query: 62   RFFPSGDVXXXXXXXXXMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQ------- 114
            RFFP  +          MPPVPQTPFDPTYGASLLPSHMLMGSPF+STP+RPQ       
Sbjct: 41   RFFPGAE--GMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPST 98

Query: 115  -GXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXSFSLNHSEPYQVNFKILPKGKDEY 173
             G               F                  S +LNHSEPY +NFKILPKGKDEY
Sbjct: 99   PGHSSHSLHHAQSARSSFLYYPQPPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEY 158

Query: 174  MTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDSHSILLSFLTKATCLDFYNNL 233
            MTRSLL +NLE   + DIHNFL +F+KFGP+ESIYL+DD+HSILLSFLTKATCLDFYNNL
Sbjct: 159  MTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDNHSILLSFLTKATCLDFYNNL 218

Query: 234  LQRFSEFKSKLHSTKLSVSFVCQDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDL 293
            LQRFSEFK+KLHS KLSVSFVCQDE++WF+ LQMNVVTRG TRSL +EFED   EL  D 
Sbjct: 219  LQRFSEFKTKLHSPKLSVSFVCQDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDF 278

Query: 294  IHEKIPWLFFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQK 353
            +  K PWLF S RFV+ERIDL+NA    NQ+F  RY+++HFI ISMALEV+++LQQ SQK
Sbjct: 279  VRLKFPWLFCSQRFVLERIDLINATT-VNQHFGTRYMILHFISISMALEVDDFLQQPSQK 337

Query: 354  KQLGISKIQFVNVNGHSSDLSDEDAVAAANGLQREXXXXXXXXXXXXXXXXXDLVELFHS 413
            +QL IS+IQFVNVNGH S LSDE+A AAANGLQ++                 DL  LFHS
Sbjct: 338  RQLNISRIQFVNVNGHHSKLSDEEAAAAANGLQQDSRTSSVSSISLSISNTADLAALFHS 397

Query: 414  LDLALGIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXX- 472
            LDL+L  +SLQV+PSEYP PLIE H +HL S+TISRPSKTL  S SL+EMD         
Sbjct: 398  LDLSLDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNH 457

Query: 473  -XXSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVL-GTSQSLSLHNPND 530
               S+++ GVL ++DPSS G+TP ++P+ELN+NT +M GPM GQ++ G  Q +SLHNP+D
Sbjct: 458  HGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLHNPSD 517

Query: 531  NGGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVR 590
              G  PSYFMDPM GAPI Q LQRQYL G  Q  G NNRTVYIGNIHPRSKPEDICNVVR
Sbjct: 518  GNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIHPRSKPEDICNVVR 577

Query: 591  GGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 650
            GGILQ IKWI SKRICFVTFIE AAA+QFYANASLEPIVLHGNILRVGWGQPSGELPKNI
Sbjct: 578  GGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 637

Query: 651  ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQIN 710
            ALAVTIGASRNVYVSLPEYSFKEKYINNPEFK YHGKYKLP+EEQLRQDFTKYGQVEQIN
Sbjct: 638  ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQIN 697

Query: 711  YLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 770
            YL+DGHCCWVNFMNIAHAIRLVED NS  ++NLEKFHAQFDGRYKNLIIGYGKDRCGNVN
Sbjct: 698  YLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 757

Query: 771  KNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTXXXXXXXXXXXXXXTEKVPVSSKEPV 830
            KNL ANKNSRF+KKIKK + + K  K+ + + G                 ++  SSK   
Sbjct: 758  KNLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGIVNSDDLTKNNEVLPGVQM-NSSKNGG 816

Query: 831  CDEILGLNDDNALAEGLGISLSSA-------YVNEYGDDISKRTNKKNRSKTETVEEDTG 883
              E   L  D  LAEGLGISL+SA       + + Y D +            E  ++D G
Sbjct: 817  VGESQSLVGDQELAEGLGISLTSAQISPDTGHTHHYSDGVE--------EGDECDDDDAG 868

Query: 884  YTTSGSSDIDIIVAPPLEHNKGKEGNSNHXXXXXXXXXXXXLQNXXXXXXXXXXXXHSQH 943
            Y+TSGSSDIDIIVAPP E  + + G S+               +            ++Q 
Sbjct: 869  YSTSGSSDIDIIVAPPDEFKRRESGTSSGKHKKKSKSTRRNQHS-----NAASSASYNQQ 923

Query: 944  YLAGSFELVNSNTYLDSIPPLVPSPINQHFHDKSLCRGSAHVXXXXXXXXXXXXXXXXXX 1003
            Y  GS +  +S   LD+ PPL PS + QH  D    R   H                   
Sbjct: 924  YSLGSLDHTSSAGSLDAPPPLAPSSMQQHLAD----RRPRHT--PGRSTDSSASQYNSQT 977

Query: 1004 XXXXXXXXXXXXQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPL-GFYDV 1062
                        QAKFSKPIAGQDVMSQYLEQLHHSTFLY+TNILGATTV +PL G+YD 
Sbjct: 978  PTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDS 1037

Query: 1063 NANE 1066
            N NE
Sbjct: 1038 NGNE 1041

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/972 (38%), Positives = 515/972 (52%), Gaps = 165/972 (16%)

Query: 156  SEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL----- 210
            SEPY +NFKILPKG DEYMTRSLL SN+    +  +H+F+T F+KFGPIES+Y++     
Sbjct: 180  SEPYVINFKILPKGDDEYMTRSLLLSNV--NASIKLHDFITKFVKFGPIESVYVVPEEEE 237

Query: 211  ---------------------DDSHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKL 249
                                 +   SILLSFLTK TCLDFYNN+LQ+ S+FK  L+S  L
Sbjct: 238  EEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSL 297

Query: 250  SVSFVCQDETNWFRLLQMNVVTRGVTRSLCIEFED-------QSMELTSDLIHEKIPWLF 302
            +++FV     +    ++ +V+ +G TRS+ +EF++       +S+E+ S+  +       
Sbjct: 298  TLNFVSLTSED----IRDDVLRKGATRSIALEFKNSFTTKQLESIEILSNASNS------ 347

Query: 303  FSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQ 362
               RFV+E+ID+VN  +P N+NFN  Y +IHFI ISMA+E   YL    +K  LGIS++ 
Sbjct: 348  ---RFVVEKIDIVNTESP-NKNFNTHYAIIHFISISMAVEASSYLLNWDEK--LGISRLF 401

Query: 363  FVNVNGHSSDLSDEDAVAAANGLQREXXXXXXXXXXXXXXXXXDLVELFHSLDLAL---- 418
            FV      S ++  D   +A   Q                     V +  +L+ A     
Sbjct: 402  FVT----DSIINKSDYFRSAPASQDASRSS---------------VSIDQTLEFATKKLQ 442

Query: 419  GII----SLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXXXX 474
            G++    +L + P  YP   IE H  HL S++IS+P  +  +++S V +           
Sbjct: 443  GLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSSSVSLQGNQNLTSSPV 502

Query: 475  SNAMQGVLLLSDPSSDGNTPSMLPNELNINTS-LMPGPMGGQVLGTSQSLSLHNPNDNGG 533
            +  M     L D S+      M+ + +   TS  +P P                      
Sbjct: 503  TQEM----YLHDTSNSTREDVMIQSSMASGTSNFVPPP---------------------- 536

Query: 534  AGPSYFMDPMSGAPINQALQRQYL----TGTGQVGGSNNRTVYIGNIHPRSKPEDICNVV 589
              P Y+MD     PI Q LQ+Q        +   GG  NRTVY+GNI+PRSKPEDICNVV
Sbjct: 537  --PHYYMDVTK--PIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVV 592

Query: 590  RGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKN 649
            RGGILQ+IK+   K +CFVTFIEAAAA+QF+ANAS+EPIVLHGN+L+VGWG   G+L ++
Sbjct: 593  RGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQS 652

Query: 650  IALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQI 709
            IALAVTIGASRNVYVSLPEY+FK+K+I +PEF+E+  KY+LPS+EQLRQDF+ +G++EQI
Sbjct: 653  IALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQI 712

Query: 710  NYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
            NYLDDGHCCWVNFMNI  AI+LVED N    +   KFH  +  RYK LIIGYGKDRCGNV
Sbjct: 713  NYLDDGHCCWVNFMNITSAIKLVEDANGADNK---KFHGSYQDRYKGLIIGYGKDRCGNV 769

Query: 770  NKNLTANKNSRFFKKIKKLNCTTKPNKR---------------QQSKRGTXXXXXXXXXX 814
            NKNL ANK SRFFKK+KK +   + +K+               Q +  G           
Sbjct: 770  NKNLVANKKSRFFKKVKKASYKIRMHKQNKAGGSNGQEPISSFQDNAFGICISPRGIESE 829

Query: 815  XXXXTEKVPVS---SKEPVCDEILGLNDDNALAEGLGISLSSAYVNE--YGDDISKRTNK 869
                   VP +    K P  + +L L + N + EGLGI  S     E   GDD       
Sbjct: 830  EVEALPDVPQNIEEEKNPQNNGLLKLANGNGIGEGLGIEFSPGLNKEGHEGDD------- 882

Query: 870  KNRSKTETVEEDTGY--------TTSGSSDIDIIVAPPLEHNKGKEGNSNHXXXXXXXXX 921
                K + ++++ G+         +S SSDIDIIV+ P + +  ++ +            
Sbjct: 883  ----KFDCIQQENGFDGKDEDESYSSDSSDIDIIVSAPEQSSAEEDDDKRSVTSYTNGHP 938

Query: 922  XXXLQNXXXXXXXXXXXXH--SQHYLAGSFELVNSNTYLDSIPPLVPSPINQHFHDKSLC 979
                +                +  Y    F  + S+T LD++PPL PS +++H+      
Sbjct: 939  TNKFKKEKSRTKLKRRPTSGLTDLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHY-----S 993

Query: 980  RGSAHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAKFSKPIAGQDVMSQYLEQLHHS 1039
              S+H                               + + SK I G  VM+QYL QL HS
Sbjct: 994  VASSH---SNNSYHNNGRHDASKKRHGGGKGNTHHGRHRKSKAIPGSQVMAQYLAQLQHS 1050

Query: 1040 TFLYSTNILGAT 1051
            TF+Y+ NILG T
Sbjct: 1051 TFMYAANILGVT 1062

 Score = 62.8 bits (151), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (90%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           MP  PQTPFD +YGA+LLPSH+LMGSPF+STP
Sbjct: 63  MPSAPQTPFDTSYGATLLPSHLLMGSPFISTP 94

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  544 bits (1402), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 338/827 (40%), Positives = 459/827 (55%), Gaps = 102/827 (12%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP----MRPQ--GXXXXXXXXXXXXXXXFX 132
           +PP PQTPFD +YG SLLPSH+LM SPF++TP      P   G               F 
Sbjct: 45  VPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAGGSRSSHAQSSYHTPNFG 104

Query: 133 XXXXXXXXXXXXXXXXXSFSLNHS-----EPYQVNFKILPK----GKDEYMTRSLLFSNL 183
                              S  H+       Y+V F ILP+    G DEYMTRSLLFSNL
Sbjct: 105 STQLRMPPPTEKRNFKHGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMTRSLLFSNL 164

Query: 184 ERQENFDIHNFLTNFIKFGPIESIYLLDDSH-SILLSFLTKATCLDFYNNLLQRFSEFKS 242
               +  +H+FLT F KF  +ES+YL+D    S+L+SFLTK TCLDFYN +LQ+ SEFK 
Sbjct: 165 --NPDTHLHDFLTKFEKFDRVESVYLVDSQQQSVLVSFLTKETCLDFYNGVLQKLSEFKK 222

Query: 243 KLHSTKLSVSFVCQDETNWFRLLQ---MNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIP 299
           +L S +L+++F    +      LQ   + V+  G TRSL +EF+D+ ++L   L+ + + 
Sbjct: 223 ELKSKELTLNFASLRDVKTGPTLQEIKIEVLRAGATRSLILEFQDK-VDLA--LLSKSLG 279

Query: 300 WLFFSH-RFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGI 358
           ++     R+V+E I++VNA    +++F   Y +IHFI I+MALE  EYL+  S K   G+
Sbjct: 280 FIVNEGPRYVVEAIEIVNAGR-SSKHFGPHYAIIHFISIAMALETVEYLKSQSNK-LAGL 337

Query: 359 SKIQFVNVNGHSSDLSDEDAVAAANGLQREXXXXXXXXXXXXXXXXXDLVELFHSLDLAL 418
            K ++VN    S     E    +++ L                     L         +L
Sbjct: 338 IKFRYVNTTSASGK--SEFQTLSSSQLNERALSNTSDSDISGGESVASLGSKLQ--QTSL 393

Query: 419 GIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXXXXSNAM 478
           G  +L V P++Y  PL+E   +HL  VTIS   K L S +SL ++               
Sbjct: 394 GEQTLVVDPTQYGRPLVEERSEHLPHVTIS---KALNSKSSLNDLTS------------- 437

Query: 479 QGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSY 538
                        NT S  P E+ +N        G  V       SL   N +G A P  
Sbjct: 438 -------------NTTSPQPQEVLVNDHEDSSSRGSMV-------SLKQANSHGPAYP-- 475

Query: 539 FMDPMSGAPINQALQR------------QYLTGTGQVGGSNNRTVYIGNIHPRSKPEDIC 586
              P+ G P    + +                 T   GG  NRTVYIGNI PRSK EDIC
Sbjct: 476 ---PIPGYPFYMNMSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDIC 532

Query: 587 NVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGEL 646
           NVVRGGILQ++K+I +K ICFVTFIEAA+A+QF+AN+++EPIVLHGN+L+VGWG  SG L
Sbjct: 533 NVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNL 592

Query: 647 PKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQV 706
           P++I+LAVTIGASRNVYVSLPE++FK+K+I +PE++E+  K++LPS+EQL +DF+ +G +
Sbjct: 593 PQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDI 652

Query: 707 EQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRC 766
           E +N+L+DGHCCW+NFMNI++AI+LVED N+    N + FH +F  RYK L IGYGKDRC
Sbjct: 653 ELVNFLEDGHCCWINFMNISNAIKLVEDANN---PNNDSFHEKFGNRYKGLFIGYGKDRC 709

Query: 767 GNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQ------------QSKRGTXXXXXXXXXX 814
           GNVNKNL ANKNS++FKK+KK +   +  K+Q            ++K             
Sbjct: 710 GNVNKNLVANKNSKYFKKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGI 769

Query: 815 XXXXTEKVPVSSKEPVC---DEILGLNDDNALAEGLGISLSSAYVNE 858
               T+ +   S E      DE+L L+D N    GLGISL+S+   E
Sbjct: 770 SVGDTQNLVRDSDEEQKLEEDELLRLSDLNNTGGGLGISLASSTGEE 816

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 51/117 (43%), Gaps = 18/117 (15%)

Query: 954  SNTYLDSIPPLVPSPINQHFHDKSL---CRGSAHVXXXXXXXXXXXXXXXXXXXXXXXXX 1010
            S+  LD++PPL PS +++ +   S     RGS                            
Sbjct: 886  SSASLDAVPPLAPSTLSRQYTATSKHNSRRGS-------RFGTTEKSSPRYNDIRSQDSK 938

Query: 1011 XXXXXQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILG---ATTVHDPLGFYDVNA 1064
                 + + SK I G DVM+QYL QL HSTF+Y+ NILG     TV     FYD N 
Sbjct: 939  KPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETV-----FYDENG 990

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  538 bits (1385), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 361/951 (37%), Positives = 503/951 (52%), Gaps = 156/951 (16%)

Query: 158  PYQVNFKILPKGK----DEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLD-D 212
            PY++ F ILP+      D++ TRSL FSNL    +  +H FL  F KF  IES+Y++D +
Sbjct: 62   PYKLTFNILPRNGNGDGDKFRTRSLYFSNL--NPDVRLHEFLATFHKFDRIESVYVVDRE 119

Query: 213  SHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVCQDETNWFRLLQ---MNV 269
              S+L+SFLTK TCLDFYN +LQ+ SEFK +L S +LS+SF    +      LQ     V
Sbjct: 120  QQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEV 179

Query: 270  VTRGVTRSLCIEFEDQSMELTSDLIHEKIPWLFFSH---RFVIERIDLVNAAAPKNQNFN 326
            +  G TRSL +EF+D+ ++  S L      + FF +   R+VIE I+ VN   P ++ F 
Sbjct: 180  LRAGATRSLGLEFKDE-IDFASLLKK----FDFFDNSGPRYVIESIETVNTDKP-SKYFG 233

Query: 327  NRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVN---VNGHS-------SDLSDE 376
            + Y ++HFI I+MA+E  EYL+     +  G++K+ +VN    +G S       S+LSD+
Sbjct: 234  SNYAIVHFISIAMAVETMEYLK-VQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQ 292

Query: 377  DAVAAANGLQREXXXXXXXXXXXXXXXXXDLVELFHSLDLALGIISLQ------VIPSEY 430
            + V                          D +  F  + L+ G +S++      V+PS+Y
Sbjct: 293  NDVEV-----------------------QDSISSFEDITLSEGSMSVENEKAFTVLPSQY 329

Query: 431  PVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXXXXSNAMQGVLLLSDPSSD 490
              P++E H+ H   +TIS   K L+S                           +S   S 
Sbjct: 330  GPPVVEEHNQHCSHITIS---KALSSK--------------------------VSRNGSS 360

Query: 491  GNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGP----SYFMDPMSGA 546
             +  S  P E+ ++ S  P      V       SL +    G   P     Y+MD MS  
Sbjct: 361  SSIASPQPQEVLVSNSEAPSSRNSIV-------SLLSARSQGPTYPVPGYHYYMD-MS-K 411

Query: 547  PINQALQRQYLTGTGQV-----GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIH 601
            P+ Q LQ+QY T T QV     GG+ NRTVYIGNI PRSK EDICNVVRGGILQ++K+I 
Sbjct: 412  PLGQTLQQQY-TATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIE 470

Query: 602  SKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRN 661
            +K ICFVTFIEAA+A+QF+AN+S+EPIVLHG++L+VGWG  SG LP++I+LAVTIGASRN
Sbjct: 471  AKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRN 530

Query: 662  VYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVN 721
            VYVSLPEY+FK+K+I +PE++ +  K+KLPS++QL  DF+ +G +E IN+L+DGHCCW+N
Sbjct: 531  VYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWIN 590

Query: 722  FMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRF 781
            FMNI++AI+LVED N+    N E FH +F+ RY+ L IGYGKDRCGNVNKNL +NKNS++
Sbjct: 591  FMNISNAIKLVEDANN---SNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKY 647

Query: 782  FKKIKKLNCTTKPNKRQ------QSKRGTXXXXXXXXXXXXXXTEKVPVSSKEPVCD--- 832
            FKK+KK +   +  ++Q      Q+K G                  V         D   
Sbjct: 648  FKKVKKASYNIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQ 707

Query: 833  -----EILGLNDDNALAEGLGISLSSAYVNEYGDDISKRTNKKNRSKTETVEEDTGYTTS 887
                 E+L L+  N+   GLGIS+S        +      NK            TG  +S
Sbjct: 708  KIEENELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNK------------TGSVSS 755

Query: 888  GSSDIDIIVAPPLEHNKGKEGNSNHXXXXXXXXXXXXLQNXXXXXXXXXXXXHSQHYLAG 947
            GSS++DI+V+ P         N++               N            H    +A 
Sbjct: 756  GSSEVDILVSAP------GSANTSQLEGGGPTQRTTAASNGKKERSSGVSKLHCFSEIAP 809

Query: 948  SFELVNSNTYLDSIPPLVPSPINQHFHD--KSLCRGSAHVXXXXXXXXXXXXXXXXXXXX 1005
                  S   LD++PPL P+ +N H++   +   R + H                     
Sbjct: 810  RV----SKASLDAVPPLAPAALNCHYNSAPRRSARKNGHDHDSNPVSGSKSDIGSKSTQG 865

Query: 1006 XXXXXXXXXXQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDP 1056
                      QA     I G +VM+QYL QL HSTF+Y+ +ILG   V DP
Sbjct: 866  KSSKSRQRNAQA-----IPGSNVMAQYLAQLQHSTFMYAADILG---VDDP 908

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  509 bits (1312), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 297/696 (42%), Positives = 409/696 (58%), Gaps = 87/696 (12%)

Query: 157 EPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLD---DS 213
           +P+ + +++LPKG DE+ TRSLLF N++   + D+H+F+TNF  +GP+ES+YL     D 
Sbjct: 164 DPFILTYRVLPKGNDEFRTRSLLFENVDG--SIDLHSFVTNFTNYGPVESVYLFKSEGDH 221

Query: 214 HSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------------QDE 258
            SILLSF +KA CLDFYN++LQR SE+KS L S  L++SFV                +D+
Sbjct: 222 VSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDD 281

Query: 259 T--NWFRL-----LQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIPWLFFSH--RFVI 309
           +  + F +     L+ +V+ RG TRS+ I F+    +   +LI +K+ +L   +  R+V+
Sbjct: 282 SKPDAFNITAAGSLRYDVINRGATRSIMITFKTPCSK--DELIDKKLEFLKKENNTRYVL 339

Query: 310 ERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVNVNGH 369
           E IDLV A  P +++F   Y ++ F+ I MA+E+ +Y++  SQK  L ISK  F+++   
Sbjct: 340 ESIDLVTADEP-SKHFPQNYAVLTFLNIFMAVEILDYIRLHSQK--LDISKCFFISIQPQ 396

Query: 370 SSDLSDEDAVAAANGLQREXXX---XXXXXXXXXXXXXXDLVELFHSLD-LALGIIS--- 422
             D       +A+NG   E                     ++ L   +D +   + S   
Sbjct: 397 IPDGKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNS 456

Query: 423 ----LQVIPSEYPVPLIESHDDHLHSVTISRPSK-----TLTSSTSLVEMDXXXXXXXXX 473
               L+V  + Y  P  E H DHL +VT+S  +      T+ S   +   +         
Sbjct: 457 KKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMP 516

Query: 474 XSNAMQGVLLLSDPSSDGNTPSMLPNELNINT---SLMPGPMGGQVLGTSQSLSLHNPND 530
             N M     + D   D   PSM+P     NT     MP P               N   
Sbjct: 517 LPNDMNYAPSVQD--VDAVPPSMVPMSTMPNTPYGCYMPPP---------------NVRQ 559

Query: 531 NGGAGPSYFMDPMSGAPINQALQRQYLT----GTGQVGGSNNRTVYIGNIHPRSKPEDIC 586
           NG              PI Q+LQRQY T     +   GG  NRTVYIGNIHPRS+ EDIC
Sbjct: 560 NGNMT----------KPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDIC 609

Query: 587 NVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGEL 646
           NVVRGGILQN+K++  KRICFVTF+EA+AA+QFY NA ++PIVLHGN+L+VGWG  SG L
Sbjct: 610 NVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPL 669

Query: 647 PKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQV 706
           PK+IALAVT+GASRNVYVSLPE++FK+KYI +P+++EY+ K++LP EEQLR DF+ YG +
Sbjct: 670 PKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDI 729

Query: 707 EQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRC 766
           EQINYL+DGHCCWVNF NI+ AI+LVE+       N   F+    GRY  L+IGYGKDRC
Sbjct: 730 EQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGN---FYKMLGGRYDGLVIGYGKDRC 786

Query: 767 GNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802
           GNVNKN  A KNSRF+KK+KK +   + +K ++ +R
Sbjct: 787 GNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERR 822

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 10/48 (20%)

Query: 63  FFPSGDVXXXXXXXXXMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           ++P+G V             P TPFD  YG +LLPSH+LMGSPFVS+P
Sbjct: 47  YYPTGPVMN----------APPTPFDTAYGVTLLPSHLLMGSPFVSSP 84

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 31/45 (68%), Gaps = 1/45 (2%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVNAN 1065
            K I G DVM+QYL QL HSTF+Y+ NILGA+   D   + D NA+
Sbjct: 1071 KSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDN-NYLDENAD 1114

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  501 bits (1289), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 320/804 (39%), Positives = 448/804 (55%), Gaps = 103/804 (12%)

Query: 156 SEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL---DD 212
           +EP  +++ ILPKG D Y TRSLLF N++   N  +H+F+TNF+K   IESIYL+   +D
Sbjct: 178 TEPINISYVILPKGDDAYRTRSLLFENVDNAIN--LHSFITNFVKNNSIESIYLVPNKND 235

Query: 213 SHS--ILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVCQDETNWFR-----LL 265
           S++  I+LSFL++  CLDFYNN+LQR  EFK  L+S  L+++FV        R      L
Sbjct: 236 SNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSL 295

Query: 266 QMNVVTRGVTRSLCIEF---EDQSMELTSDLIHEKIPWLFF----SHRFVIERIDLVNAA 318
           + N+VTR  TRSL IE    E+ S+ L  + + EKI         + R+V+E IDLV + 
Sbjct: 296 EFNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLV-ST 354

Query: 319 APKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVNVNG--HSSDLSDE 376
              N+ F   Y ++ F+ I+MA+E+ +Y+Q  S K  L I K  FV +     ++ +++ 
Sbjct: 355 DKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSK--LNIGKCSFVTIQPLIENNVMNNS 412

Query: 377 DAVAAANGLQ-------------------REXXXXXXXXXXXXXXXXXDLVELFHSLD-L 416
            A+++A  +Q                    +                 +++ +   L  +
Sbjct: 413 SALSSATNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISIADKLKGI 472

Query: 417 ALGIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTL----TSSTSLVEMDXXXXXXXX 472
            L  ISL ++P +YP P      DHL +VTIS P++      T  T  + ++        
Sbjct: 473 KLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDMSPSFEG 532

Query: 473 XXSNAMQGVLLLSDPSSDGNTPSMLPNE---LNINTSLMPGPMGGQVLGTSQSLSLHNPN 529
                    +L  + +   NTP ++P++   ++ NT +   P                  
Sbjct: 533 IDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNS------------- 579

Query: 530 DNGGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVV 589
                    F+ P++ +  NQ L       +     + NRT+YIGNI+PRSK EDICNVV
Sbjct: 580 ---------FIHPITDSLENQ-LSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVV 629

Query: 590 RGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKN 649
           RGGILQ+IK+I SK ICFVTFIEAAAA+QFYANA ++PIVLHGN L++GWG  SG LPK+
Sbjct: 630 RGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKS 689

Query: 650 IALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQI 709
           IALAVTIGASRNVYVSLPE++FK+KYIN+PEFKEYH K+KLP  EQLR DF+ YG  EQI
Sbjct: 690 IALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQI 749

Query: 710 NYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
           NYL D HCCWVNFMNI+ AI+LVE+  +    + ++F+ +FD RY  L+I YGKDRCGN+
Sbjct: 750 NYLSDSHCCWVNFMNISSAIKLVEEATN----DFDRFNEKFDERYNGLVINYGKDRCGNI 805

Query: 770 NKNLTANKNSRFFK-------KIKKLNCTTKPNKRQQSKRGTXXXXXXXXXXXXXXTEKV 822
           NKNL A KNSRF+K       K+ KL       KR+   R                 E +
Sbjct: 806 NKNLIAGKNSRFYKIRQNHNFKLSKLE-----EKRRDHDRRENGFKHVYNDEETIYNESM 860

Query: 823 PVSSKEPVCDEILGLNDDNALA-EGLGISLSSAYVNEYGDDIS------KRTNKKNRSKT 875
              ++    +E    ND   L  + LGISL S   NE  DDI+      +  N+K+ +K 
Sbjct: 861 ETDNQH---NEESKENDGKFLQLDSLGISLESK--NEIADDINDALTVDQFENEKSITKN 915

Query: 876 ETVEEDTGYTTSGSSDIDIIVAPP 899
               E+T + +  SSDI++I+  P
Sbjct: 916 NGF-ENTSFHSDSSSDIELIINSP 938

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/35 (65%), Positives = 28/35 (80%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRP 113
           +P  P TPFD  YGA+LLPSH+LMGSPF+S+P  P
Sbjct: 70  LPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVP 104

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/29 (68%), Positives = 24/29 (82%)

Query: 1023 IAGQDVMSQYLEQLHHSTFLYSTNILGAT 1051
            I G DVM+QYL QL HSTF+Y+ NILGA+
Sbjct: 997  IPGSDVMAQYLAQLQHSTFMYAANILGAS 1025

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  479 bits (1234), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 279/725 (38%), Positives = 406/725 (56%), Gaps = 117/725 (16%)

Query: 157 EPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDD---- 212
           EP+ V +++LPKG DEY TRSLLF N+    + D+++F++ + ++GP+ESIY+  D    
Sbjct: 213 EPFVVTYRMLPKGDDEYRTRSLLFENV--NGSVDLYSFVSKYSRYGPVESIYMFKDRNDK 270

Query: 213 -SHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------------- 255
             HS+LLSFL++  CLD YN++LQR +EFK+ L S  L+VSFV                 
Sbjct: 271 TKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQND 330

Query: 256 ---------QDETNWFRL-------------------LQMNVVTRGVTRSLCIEFEDQSM 287
                     D+T+  +                    LQ ++V RG TRS+ +E + +  
Sbjct: 331 NSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390

Query: 288 ELTSDLIHEKIPWL--FFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEE 345
           +  + L+ +++ +L    + R+V+E I L+NA  P  ++F   Y ++ F+ ISMA+EV +
Sbjct: 391 K--TKLLDQELDFLSPANNQRYVLESIYLINAKEPF-KHFPKNYAILTFLNISMAVEVLD 447

Query: 346 YLQQASQKKQLGISKIQFVNVNGHSSDLSDEDAVAAANGLQREXXXXXXX---------- 395
           Y++  ++  +    K  FV+V+      SD   V  +N +                    
Sbjct: 448 YVRN-NETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIATNGDLGGY 506

Query: 396 XXXXXXXXXXDLVELFHSLDLALGIIS--------LQVIPSEYPVPLIESHDDHLHSVTI 447
                     + V  + SLD  +  +S        + V   EYP P      DHL + ++
Sbjct: 507 TSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFSDHLSNASV 566

Query: 448 SRPSKTLTSSTSLVEMDXXXXXXXXXXSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSL 507
              S   T  +S    +            +    L+   P  D   P+  P         
Sbjct: 567 LEASALDTQISSPHPQEVIVP--------SQDSPLVGGAPPLDAVHPAATP--------- 609

Query: 508 MPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFMDPMSG------APINQALQRQYLT--- 558
               +  QVL     +++     N G     +M+P          PI Q+LQ+Q+ T   
Sbjct: 610 ---ALSSQVLPLQPHMAM-----NSG----IYMEPFGRRNKTMIKPITQSLQKQFATSAE 657

Query: 559 -GTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAI 617
                 GG  NRTVYIGNIHPRSKPEDICNVVRGGILQ+I+++  K ICFVTFIEA+ A+
Sbjct: 658 VANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAV 717

Query: 618 QFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYIN 677
           QFY NA ++PIVLHGN+L+VGWG  SG LPK+++LAVT+GASRNVYVSLP+++FK+KYIN
Sbjct: 718 QFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYIN 777

Query: 678 NPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNS 737
           +P+++ Y  +YKLP+EEQLR DF ++G +EQIN+L DGHCCWVNFMNI+ AI+LVE+   
Sbjct: 778 DPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEE--- 834

Query: 738 LSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKR 797
           +   + E FH  FD RY+ LIIGYGKDRCGNVNKNL + KNSRF+KK+KK +   + ++ 
Sbjct: 835 IKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRM 894

Query: 798 QQSKR 802
           ++ ++
Sbjct: 895 EEERK 899

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 1/44 (2%)

Query: 1020 SKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVN 1063
            +K I G DVM+QYL QL HSTF+Y+ NILGAT   D + +Y+ N
Sbjct: 1214 AKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGD-VDYYEDN 1256

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 21/24 (87%)

Query: 87  FDPTYGASLLPSHMLMGSPFVSTP 110
           FD  YG +LLPSH+L+GSPFVS+P
Sbjct: 87  FDTAYGITLLPSHLLIGSPFVSSP 110

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
           Anc_8.844 YML117W
          Length = 1053

 Score =  472 bits (1215), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 316/886 (35%), Positives = 459/886 (51%), Gaps = 110/886 (12%)

Query: 85  TPFDPTYGASLLPSHMLMGSPFVSTPMRPQGXXXXXXXXXXXXXXXFXXXXXXXXXXXXX 144
           TPFD  YGA+LLPSH+LMGSPFVSTP  PQ                              
Sbjct: 92  TPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQRKGSHTGMANGTGSMNYYRTDPQI 151

Query: 145 XXXXXSFSLNHSEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPI 204
                        P+++++KILPKG D Y TRSLL  N++  +  D+H F++ F++   +
Sbjct: 152 INGLFQI------PFEISYKILPKGDDLYRTRSLLLGNID--DMVDLHTFVSKFVQNNSV 203

Query: 205 ESIYLLDDS-----HSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFV----- 254
           ES+Y+  +      +  LLSFL+   CL+FYNN+LQR  EFK +L ++ L +SFV     
Sbjct: 204 ESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQR 263

Query: 255 ------------CQDETNWFRLLQMNVVTR-GVTRSLCIEFEDQSMELTSD-LIHEKIPW 300
                         D+ +    L  ++  + G TRS+ IEF D+ + LT D L+++K+ +
Sbjct: 264 PTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKF 323

Query: 301 LF-FSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGIS 359
           L   ++R+++E I +        + F   Y +I F+ I MA+E+ +YL+     KQL ++
Sbjct: 324 LSEGNNRYILEHIAVFKTQH-GTKVFGKNYAIITFLSIPMAMEIMDYLKL--NIKQLHLT 380

Query: 360 KIQFVNVN-------------GHSSDLSDEDAVAAANGLQREX--------XXXXXXXXX 398
           K  +V V               H++D       +  N  + +                  
Sbjct: 381 KFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNNSMLSLVSSESST 440

Query: 399 XXXXXXXDLVELFHSLDLALGIISLQVIPSEYPVPLIESHDDHLHSVTISRP---SKTLT 455
                   LV    S++L    + L+V   +YP PL E   +H + +  S P   ++ + 
Sbjct: 441 SLADDVDGLVNKLKSIELQESTLKLRV--EDYPEPLFEQFSEHSNGIVQSLPVPQTRPIG 498

Query: 456 SSTSLVEMDXXXXXXXXXXSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQ 515
              S +              +     L L D +   + P++ P  +    S   GPM  Q
Sbjct: 499 GPQSSISTPRAFGAFPNDIGSPPASFLPL-DLNHSNSVPNLPPGFIPATPS---GPMSPQ 554

Query: 516 VLGTSQSLSLHNPNDNGGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGS-----NNRT 570
                Q L L++           F       PI  +L+ Q  T T QV  +     NNRT
Sbjct: 555 ----QQQLFLNSQRQQRDHAGGKF-----AHPITDSLESQMKTST-QVATAMGSDFNNRT 604

Query: 571 VYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVL 630
           +YIGNI+PRS+ EDICNVVRGGILQNIK+I +K ICF+TFIEA+AA+QFYANA ++PIVL
Sbjct: 605 IYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVL 664

Query: 631 HGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKL 690
           HGN L++GWG  +G LPK IALAVTIGASRNVY+SLPE +FK+KYI +P+FK YH  +KL
Sbjct: 665 HGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKL 724

Query: 691 PSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQF 750
           P++E LR+DF  YG +EQIN L+D HCCWVNFMNI+ AIRLVED ++      + F+  F
Sbjct: 725 PAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVEDAST----KQDHFNQLF 780

Query: 751 DGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTXXXXXX 810
           D RY+ L+I YGKDRCGN+N+NL A K S++ KK+KK     + ++ ++ +R        
Sbjct: 781 DHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKRRN------- 833

Query: 811 XXXXXXXXTEKVPVSSKEPVCDEILGLN------DDNALAEGLGISL----SSAYVNEYG 860
                    E V  +  E    +   +N       D    + LGIS+    S++ ++   
Sbjct: 834 ---QDAERREMVNGTIPEENPFDAFAINTGSAEKKDELSLDSLGISIMEVESASPISPVM 890

Query: 861 DDISKRTNKKNRSKTETVEEDTGYT--TSGSSDIDIIVAPPLEHNK 904
            D+   TN    S T+       YT  +  SSDI++I+ PP + N+
Sbjct: 891 GDLEDHTNG---SYTDAGIAPLNYTNNSGSSSDIELIINPPNDPNR 933

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%)

Query: 1020 SKPIAGQDVMSQYLEQLHHSTFLYSTNILGAT 1051
            ++ I G DVM+QYL QL HSTF+Y+ N+LGA+
Sbjct: 1012 ARTIPGSDVMAQYLAQLQHSTFMYAANVLGAS 1043

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  466 bits (1199), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 280/709 (39%), Positives = 397/709 (55%), Gaps = 107/709 (15%)

Query: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLD------ 211
           P  +N+++LP G D Y TRSLLF N+++ +   +  F+   I +  +ES+Y+        
Sbjct: 169 PISINYRVLPSGDDTYKTRSLLFENVQKNDEM-LSVFMRLIINYSQVESVYVFQQTDTPS 227

Query: 212 -------DSHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC--------- 255
                  D+  + LSFL++   LDFYNN LQR  +FK KL S KLSVSFV          
Sbjct: 228 KDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTDEDK 287

Query: 256 -----------QDETNWFR--------LLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHE 296
                       ++ N  R         L   + +   TRS+ IEF  Q   +  D + E
Sbjct: 288 DKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQ---VEQDALFE 344

Query: 297 KIPWL--FFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKK 354
           K+P+L    + R+++E +D+++A    + +F   Y+++ FI I MA+EV +YL+  +   
Sbjct: 345 KLPFLDDKDNKRYILEAVDIISAEDAAD-DFPANYVILTFINIKMAIEVLDYLK--ANLM 401

Query: 355 QLGISKIQFVNVNGHSSDLSDEDAVAAANGLQREXXXXXXXXXXXXXXXXXDLVELFHSL 414
              +++  FV++ G  S   +         +  E                  +     SL
Sbjct: 402 TYSVNECFFVSLPGCKSQ-RESSTTPVLGHISTEGSKSVSEVNLANGGNTVMIDRELESL 460

Query: 415 DLALGIISLQ-----VIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXX 469
              L  + L+     +I S+YP P I SHDDH+   T          + S+   D     
Sbjct: 461 SDELASLKLEEKCLKIIRSDYPKPEIRSHDDHIPGST----------NFSMYIFDDGM-- 508

Query: 470 XXXXXSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPN 529
                             + +GN+   L + L  ++S++  P    +  +   + L  PN
Sbjct: 509 ------------------NPEGNSGMYLHDNLTDHSSIIGSPFSNYIDPSISHVML--PN 548

Query: 530 DN----GGAGPSYF-MDPMSGAPIN-------QALQRQYLT----GTGQVGGSNNRTVYI 573
           +     G   P  F ++P+SG P N       Q+++ +  T         G ++NRTVYI
Sbjct: 549 NGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYI 608

Query: 574 GNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGN 633
           GNI+PRSK EDICNVVRGGILQN+K+I  KRICFVTFIEA+AA QF AN+ ++PIVLHGN
Sbjct: 609 GNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGN 668

Query: 634 ILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSE 693
            LRVGWG  SG LPK+IALAVT+GA+RNVYVSLPEY+FK+K+IN+P++KEYH +YKLPS+
Sbjct: 669 TLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQ 728

Query: 694 EQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGR 753
           EQLR+DFT YG++EQINYL D HCCWVNF+NIA AIRLVED N     N E+FH +F+ R
Sbjct: 729 EQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN---HNNGEEFHKKFNNR 785

Query: 754 YKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802
           Y+ LII YGKDRCGN+NKNL A K S+F+KK+KK +   +  K ++ ++
Sbjct: 786 YEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEEKRK 834

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 30/39 (76%), Gaps = 2/39 (5%)

Query: 1020 SKPIAGQDVMSQYLEQLHHSTFLYSTNILGAT--TVHDP 1056
            ++PI G DVM+QYL QL HSTF+Y+ NILGA+  T  DP
Sbjct: 1009 TRPIPGSDVMAQYLAQLQHSTFMYAANILGASVETEEDP 1047

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 26/33 (78%)

Query: 82  VPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQ 114
           VP TPFD  YGASLLPSH+LMGSP +ST   P+
Sbjct: 49  VPPTPFDTAYGASLLPSHLLMGSPMISTTNLPR 81

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  451 bits (1160), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 286/711 (40%), Positives = 403/711 (56%), Gaps = 97/711 (13%)

Query: 157 EPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL------ 210
           +P+++++KILP G D Y TRSLLF N+    + ++H F+T F++F PIES+YL+      
Sbjct: 175 QPFRMSYKILPSGDDAYRTRSLLFENV--VNSIELHTFMTEFVRFSPIESVYLINHHDSD 232

Query: 211 ---DDS--HSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC--------QD 257
              DD+   SILLSFLT+  CL FYNN+LQR  EFK+KL S  L +SFV         ++
Sbjct: 233 KPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENEEE 292

Query: 258 ETNWF--------RLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIPWLFFSH--RF 307
           ETN            +   +     TRS+ I+F++   E   +L  +K+ +L   +  R+
Sbjct: 293 ETNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSE--QELFDKKLKFLNQENNSRY 350

Query: 308 VIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVNVN 367
           ++E IDLVN    +N+ F   Y ++ FI I MA+E+ +YL+    +   GI    FV V 
Sbjct: 351 ILESIDLVNVTQTENE-FPKHYAILTFINILMAMEICDYLKIHGPR--YGIQDCMFVQVI 407

Query: 368 GH-------------SSDLSDEDAVAAANGLQREXXXXXXXXXXXXXXXXXDLVELFHSL 414
                          S D  + D   ++   Q++                 D V     L
Sbjct: 408 PKAVSCVSSKRASIISKDNDNNDETLSSQ--QKKNDILKNSSIISLPSAENDQVSDEEKL 465

Query: 415 D-LALGIIS-------LQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVE--MD 464
           D L+  + S       L V  + YP P   SHD+HL + T+S     L+SS++  E  + 
Sbjct: 466 DKLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNATLS-----LSSSSNPFEQQLP 520

Query: 465 XXXXXXXXXXSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLM-PGPMGGQVLGTSQSL 523
                     +N   G L    P++        PN  N+    + P P        + + 
Sbjct: 521 YSYEEDDDQRTNVRSGSL----PAN-----PQFPNMPNLPKGYISPNP------NMNYNT 565

Query: 524 SLHNPNDNGGAGPSYFMDPMSGA------PINQALQRQYLTGTGQV-----GGSNNRTVY 572
            L  PN      P++ M+           PI++ L+ Q+ T T QV       + NRT+Y
Sbjct: 566 PLMYPNGYFVNDPAFSMNNNYNNNTNYRNPISKTLE-QHATTTSQVVNSLGADAGNRTIY 624

Query: 573 IGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHG 632
           IGNI+ RSK EDICNVVRGGILQN+K+I  K ICF+TFIEA+AAI FYAN+ ++PIVLH 
Sbjct: 625 IGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHN 684

Query: 633 NILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPS 692
           + L++GWG     LPK +ALAVT+GASRNVYVSLPE++FK+K+IN+PE++EYH KYKLP 
Sbjct: 685 HTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQ 744

Query: 693 EEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDG 752
            +QLR DF+KYG +EQINYL D HCCWVNF+NI+ AIRLVED ++  +    KF  +F+ 
Sbjct: 745 ADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVE---SKFSEKFNN 801

Query: 753 RYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRG 803
           RY  LII YGKDRCGNVNK+L +NKNSRF+KK+K ++   K  + ++ ++ 
Sbjct: 802 RYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKA 852

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           +P VP TPFD  YGA+LLPSH+LMGSPFV+TP
Sbjct: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATP 106

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%)

Query: 1018 KFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052
            K ++ I G DVM+QYL QL HSTF+Y+ NILGA+ 
Sbjct: 1036 KEARVIPGSDVMAQYLAQLQHSTFMYAANILGASA 1070

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score =  444 bits (1141), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 263/679 (38%), Positives = 372/679 (54%), Gaps = 103/679 (15%)

Query: 159 YQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-------D 211
           Y+++++ILPKG D Y TRSLLF N+   E+ D+H F+  F+ +G IES+Y++       +
Sbjct: 210 YKISYQILPKGDDTYHTRSLLFENI--NESIDLHTFIEKFVNYGLIESVYVVPSYETHQN 267

Query: 212 DSHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------------- 255
              SILLSF +++ CLDFYN++LQ+ SE+K++L+S  L +SFV                 
Sbjct: 268 SVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKIS 327

Query: 256 ----QDETNW--FRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIPWLF--FSHRF 307
               ++ET++    L+Q  V   G TRSLCIEF D+ ++   D I   +P+L    + R+
Sbjct: 328 VESQKNETDFELTSLIQYQVANFGATRSLCIEF-DKRVDKIDDFIETYLPFLSSNANKRY 386

Query: 308 VIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQL------GISKI 361
           +IE + +VN     N+ F   Y+++ F+ ISM +EV  Y++  +  K +         + 
Sbjct: 387 IIESLYIVNNNGKDNE-FPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRT 445

Query: 362 QFVNVNGHSSDLSDEDAVAAANGLQREXXXXXXXXXXXX---XXXXXDLVELFHSL-DLA 417
           +    N +   LS +      N    E                    + +E+ + L +L 
Sbjct: 446 KHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELE 505

Query: 418 LGIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXXXXSNA 477
           +   +  +  S Y  P IE   +HL +V+ISR                            
Sbjct: 506 IQTHTFNLDISNYSNPHIEIRAEHLPNVSISR---------------------------- 537

Query: 478 MQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLH-----NPNDNG 532
                   DP    N     P          P      +  T+  LS H       ND  
Sbjct: 538 --------DPMIYANPIYQSP----------PSGYMENMWTTTPFLSSHIVHEEYANDRV 579

Query: 533 GAGPSYFMDPMSGAPINQALQRQYLTGTGQV----GGSNNRTVYIGNIHPRSKPEDICNV 588
                ++ + +   P+ Q LQ Q+ T         GG  NRT++IGNI+PRSK EDICNV
Sbjct: 580 DYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNV 639

Query: 589 VRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPK 648
            RGGI+Q +K+I  K ICFV FI+  AA QFYAN+ ++PI+LH N L++GWG   G LPK
Sbjct: 640 TRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPK 699

Query: 649 NIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQ 708
            I LAVT GASRNVYVSLPE++FK+KYIN+P +KEYH KY LPSE+QLR+DF+K+G++EQ
Sbjct: 700 AIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQ 759

Query: 709 INYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGN 768
           IN+L D HCCW+NF NI  AI+LVE   +    N   FH ++  RYK LIIGYGKDRCGN
Sbjct: 760 INFLKDKHCCWINFTNIRSAIKLVELVKNEDNNN---FHERYKNRYKGLIIGYGKDRCGN 816

Query: 769 VNKNLTANKNSRFFKKIKK 787
           VNK+L +NKNSR+F+K+KK
Sbjct: 817 VNKSLVSNKNSRYFRKVKK 835

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 31/43 (72%), Gaps = 2/43 (4%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYDVN 1063
            K I G DVMSQYL Q+ HSTF+Y+ N+L A ++ +P  FYD N
Sbjct: 992  KIIPGSDVMSQYLAQVQHSTFMYAANVLNA-SIEEP-EFYDEN 1032

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (80%)

Query: 87  FDPTYGASLLPSHMLMGSPFVSTPMR 112
           FD  YG +LLPSH+LM SPFVSTP +
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPNK 137

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  444 bits (1143), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 265/661 (40%), Positives = 367/661 (55%), Gaps = 77/661 (11%)

Query: 214 HSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFV-CQDETNWFRLLQMNVVTR 272
            S LLSF TK +CLDFYNNLLQR++E K+ + S +L+++FV  QD+  W   L+MNV++ 
Sbjct: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMANLKMNVISL 384

Query: 273 GVTRSLCIEFEDQSMELTSDLIHEKIPWLFFSHRFVIERIDLVNAAAPKNQNFNNRYLLI 332
           G TRSL +EF D S  +TSD I + +P+L  S ++V+  +D+V     + +NF   Y L+
Sbjct: 385 GATRSLYVEFADDS--VTSDTIWDTLPFLKNSGKYVVIDVDVVTTDE-RRKNFGLHYCLL 441

Query: 333 HFICISMALEVEEYLQQASQKKQLGISKIQFVNVNGHSSDLSDEDAVAAANGLQREXXXX 392
           HF+ ++MALEV+E L+   +     +S++ FV    +S+D       ++A  L++E    
Sbjct: 442 HFLSVTMALEVKELLETGDE----AVSRVSFV-TPANSADKEMRRRRSSAISLKQEASPQ 496

Query: 393 XXXXXXXXXXXXXDL----------------VELFHSLDLALGIISLQVIPSEYPVPLIE 436
                        ++                  ++   D  L   +L V  SEY  P++ 
Sbjct: 497 MFSTDSRSRSRSSNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVN 556

Query: 437 SHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXXXXSNAMQGVLLLSDPSSDGNTPSM 496
             D HL+S +IS+P+      +                SN    +  LS  S D     M
Sbjct: 557 EFDHHLNSWSISKPTTLYMHESGTTNF---------SSSNLSDDIDPLSISSHDPVPQQM 607

Query: 497 LPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFMDPMSGAPINQALQRQY 556
           L NE                                     Y M+P+    I Q +Q QY
Sbjct: 608 LLNEY-----------------------------------PYIMEPLMPPQITQTIQNQY 632

Query: 557 LTGTGQV-GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAA 615
                 V  G  +RTVYIGNI+PRSK EDICNVVRGGILQ+IKW+  KRICFVTFIE AA
Sbjct: 633 SKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAA 692

Query: 616 AIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKY 675
           A+QFYAN +LEPI+LHGN+L+VGWGQ  G LPKNIALAVT+GASRNVYVSLP+ +FK+K+
Sbjct: 693 AVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKF 752

Query: 676 INNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDC 735
           IN+P+FKEY  +YK+P+  QL+ DF  YG +EQ+N+  DGHCCW+NFMNI+ AI+LVE+ 
Sbjct: 753 INDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEY 812

Query: 736 NSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPN 795
            S ++ NL  FH + +GRY  LIIGYGKDRCGN+N+NL  NKN +     +         
Sbjct: 813 -SDTKDNL--FHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGKGSNHNRNSQNNNTSR 869

Query: 796 KRQQSKRGTXXXXXXXXXXXXXXTEKVPVSS---KEPVCDE-ILGLNDDNALAEGLGISL 851
             +Q K+                     +++     P+ ++  L L  D   +EGLGIS+
Sbjct: 870 GHRQRKQSATFSNASNIDLKHSSVANASIANGKLDRPMDNKNFLSLGVDADFSEGLGISI 929

Query: 852 S 852
           S
Sbjct: 930 S 930

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/41 (70%), Positives = 35/41 (85%), Gaps = 3/41 (7%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYD 1061
            KPIAG DVM++YLEQLHH+TF+Y+ NILGAT   DP+ FYD
Sbjct: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGAT--QDPV-FYD 1147

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 82  VPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           +PQTPFDP YG +LLPSH+L+GSPFV+TP
Sbjct: 68  IPQTPFDPVYGITLLPSHLLVGSPFVNTP 96

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 160 QVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDD 212
           Q  + ILPKG D Y +RSLLF+N+  +   DI  FL    K  PIESIYL+ D
Sbjct: 216 QFQYSILPKGNDTYRSRSLLFTNVNSE--LDIVEFLQKVAKNYPIESIYLIKD 266

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  375 bits (962), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 219/509 (43%), Positives = 296/509 (58%), Gaps = 66/509 (12%)

Query: 564  GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANA 623
            GG+ NRTVYIGNI+PRSK EDICNVVRGG LQ IK+   K ICFVTFIEAA+A QFYAN+
Sbjct: 576  GGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANS 635

Query: 624  SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKE 683
             ++PI+LH N LRVGWG  SG LPK+I+LAVT+GASRNVYVSLPEY+FK+K+IN+PE+KE
Sbjct: 636  FIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKE 695

Query: 684  YHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNL 743
            YH KY LP+EE+LR+DF+ +G++EQ+N+L+DGHCCW+NFMNI  AI+LVE  N  S    
Sbjct: 696  YHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVN--SSNGG 753

Query: 744  EKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTK----PNKRQQ 799
            + FH ++  RYK LIIGYGKDRCGNVNK+L + KNS+F++K+KK +   +      +R+Q
Sbjct: 754  KTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEERKQ 813

Query: 800  SKRGTXXXXXXXXXXXXXXTEKVPVSSKEPVCDEILGLNDDNALAEGLGISLSSAYVNEY 859
             ++                 E  P  ++    +  + L       +GLG+SLS       
Sbjct: 814  EEKNKISNKSINLNSFGIQVE-TPSQNESEQEEPKISL-------DGLGMSLS------- 858

Query: 860  GDDISKRTNKKNRSKTETVEEDTGYTTSGSSDIDIIVAPPLEHNKGKEGNSNHXXXXXXX 919
                      K  S+   ++E     +  S+DI++I+ PP+  N   +GN N        
Sbjct: 859  ----------KPNSENHDLKETDDSDSDISTDIELIIDPPVREN--TKGNKNKK------ 900

Query: 920  XXXXXLQNXXXXXXXXXXXXHSQHYLAGSFELVN----SNTYLDSIPPLVPSPINQHFHD 975
                  QN            H ++ +  +    N    S T L+S PPL P+ +++ F  
Sbjct: 901  ------QN------------HRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQ- 941

Query: 976  KSLCRGSAHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAKFSKPIAGQDVMSQYLEQ 1035
            KS  + S+ +                              + K  K + G DVMSQYL Q
Sbjct: 942  KSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNK--KLLPGSDVMSQYLAQ 999

Query: 1036 LHHSTFLYSTNILGATTVHDPLGFYDVNA 1064
            L HSTF+Y+ NILGA++  D   FYD N 
Sbjct: 1000 LQHSTFMYAANILGASS--DEPEFYDENV 1026

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 147/264 (55%), Gaps = 53/264 (20%)

Query: 151 FSLNHSEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL 210
           F  N    + +++K+LPKG DEY TRSLLF N+++  + D+H F+  F+ FGPIES+YL+
Sbjct: 243 FQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDK--SVDLHCFIKKFVNFGPIESVYLI 300

Query: 211 DD-------------------------------SHSILLSFLTKATCLDFYNNLLQRFSE 239
           +                                + SILLSFL++  CLDFYN++LQR SE
Sbjct: 301 NSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSE 360

Query: 240 FKSKLHSTKLSVSFVC---------QDETNWFR-----LLQMNVVTRGVTRSLCIEFEDQ 285
           FK++L+S  L++SFV           DE + F       L+ +++ RG TRS+ +EF +Q
Sbjct: 361 FKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEF-NQ 419

Query: 286 SMELTSDLIHEKIPWLFF--SHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEV 343
            +      ++ K+ +L    + R++IE +D++NAA  ++ N     +++ F+ ISM ++V
Sbjct: 420 PITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAE-RDANLPKNTVILTFLNISMTVDV 478

Query: 344 EEYLQQASQKKQLGISKIQFVNVN 367
            + ++   ++K  GISK  FV  N
Sbjct: 479 MDRIRL--ERKDSGISKCVFVTFN 500

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (77%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQ 114
           +P  P TPFD  YGASLLPSH+LMGSPFVSTP   Q
Sbjct: 118 IPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQ 153

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  356 bits (913), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 165/259 (63%), Positives = 205/259 (79%), Gaps = 7/259 (2%)

Query: 548  INQALQRQYLTGTGQV----GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSK 603
            + Q L+  + T T       GG  NRTVYIGNI+PRSKPED+CNVVRGGILQ I ++  K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 604  RICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVY 663
             ICFVTFIEA  A QF+ANA ++PIVLHGNIL+VGWG  SG LPK+I+LAVTIGA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 664  VSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFM 723
            VSLPE++FK+K+INNP++++YH  YKLP+E QLR+DF++YG++EQINYL+DGHCCW+NFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 724  NIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFK 783
            NI  AI LVE+ N   + +  +FH +FDGRY  LIIGYGKDRCGNVNKNL A KNS+FFK
Sbjct: 981  NINSAITLVEEVN---EDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFK 1037

Query: 784  KIKKLNCTTKPNKRQQSKR 802
            K+KK     K  K ++ +R
Sbjct: 1038 KVKKPAYQIKLKKIEEERR 1056

 Score =  105 bits (262), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 71/103 (68%), Gaps = 7/103 (6%)

Query: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-----DD 212
           P  V++KILPKG DE+ TRSLL  N+   ++ D    + NFI FGPIES+YL+       
Sbjct: 260 PLVVSYKILPKGTDEFRTRSLLLENI--NQSIDTRTLVKNFINFGPIESVYLIKLNPGSK 317

Query: 213 SHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC 255
            +SILLSF+++  CLDFYNN+LQR  EFK++L S  L++SFV 
Sbjct: 318 YNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVI 360

 Score = 62.8 bits (151), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (90%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           +P  P TPFDP+YGA+LLPSH+LMGSPFVSTP
Sbjct: 101 IPSAPPTPFDPSYGATLLPSHLLMGSPFVSTP 132

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 28/41 (68%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYD 1061
            K I G DVMSQYL QL HSTF+Y+ NILG +   + + + D
Sbjct: 1316 KTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGD 1356

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  347 bits (891), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/396 (47%), Positives = 248/396 (62%), Gaps = 58/396 (14%)

Query: 423 LQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXXXXXXXXXXSNAMQGVL 482
           L+V   +YP P+I  H  HL ++ IS   KT+ +S    +                    
Sbjct: 532 LEVTCHDYPTPVINEHSAHLSNIKIS---KTVDNSRQFTQ-------------------- 568

Query: 483 LLSDPSSDGNTPSMLP-NE--LNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYF 539
                    + PS LP NE     +++   G +  Q L T+ S    NP  N    P+  
Sbjct: 569 ---------DIPSPLPLNEHMFMTDSNQSNGTIVSQQLITAPSPQSPNPQMNQRVLPN-- 617

Query: 540 MDPMSGAPINQALQRQYLTGTGQVGGS-----NNRTVYIGNIHPRSKPEDICNVVRGGIL 594
                  PI Q+L+ Q    + +V  S      NRT+YIGNI+PRS+ EDICNVVRGGIL
Sbjct: 618 -------PITQSLE-QNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGIL 669

Query: 595 QNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAV 654
           QNIK+I  KRICFVTFIEAA+A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAV
Sbjct: 670 QNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAV 729

Query: 655 TIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDD 714
           TIGASRNVYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQINYL D
Sbjct: 730 TIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSD 789

Query: 715 GHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK--------FHAQFDGRYKNLIIGYGKDRC 766
            HCCW+NFMNI+ AI LVE+ N     + +            +FDGRYK L+I YGKDRC
Sbjct: 790 SHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRC 849

Query: 767 GNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802
           GN+NKNL A KNSRF+KK+K+ +   + +K ++ +R
Sbjct: 850 GNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR 885

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/251 (36%), Positives = 141/251 (56%), Gaps = 48/251 (19%)

Query: 157 EPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDSH-- 214
           +P+++N+KILP G D Y TRSLL  N++  ++ D+H+ + NF+K   +ES Y++      
Sbjct: 197 KPFRINYKILPAGDDAYRTRSLLIENVD--DSADLHSLVKNFVKSNALESAYIVGSKETD 254

Query: 215 ----------SILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC--------- 255
                     SIL+SFLT+  CL+FYNN+LQR SEFK+ L S  L++ FVC         
Sbjct: 255 NLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLP 314

Query: 256 ---QDE---------------TNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEK 297
              +DE               T     L  +V  +  TRS+ IEF  +S    ++L  EK
Sbjct: 315 TPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEF--KSPLEKAELFKEK 372

Query: 298 IPWLFFS--HRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQ 355
           + +L  S   R+++E ID+V+   P NQ F   Y+++ F+ I MA+EV +YL++ S  K+
Sbjct: 373 LQFLDRSKNKRYILESIDIVDTDVPSNQ-FPENYVVLTFLNIFMAIEVLDYLKKYS--KK 429

Query: 356 LGISKIQFVNV 366
           LGISK  +V++
Sbjct: 430 LGISKCFYVSL 440

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (87%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           +P VP TPFD  YGASLLPSH+LMGSPFVS+P
Sbjct: 60  LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+ 
Sbjct: 1083 RTIPGSDVMAQYLAQVQHSTFMYAANILGASA 1114

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  346 bits (888), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 211/272 (77%), Gaps = 9/272 (3%)

Query: 536 PSYFMDPMSGAPINQALQRQYLTGTGQVGGS-----NNRTVYIGNIHPRSKPEDICNVVR 590
           P++  DP +  PI + L+ ++ T + QV  S      NRT+YIGN++PRSK ED+CNVVR
Sbjct: 692 PTFNTDP-TMYPIVRTLEDKFNT-SAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVR 749

Query: 591 GGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 650
           GGILQ+IK I SKRICFVTFIEA+AA+QFYAN+ ++P++LHGN L++GWG     L K+I
Sbjct: 750 GGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSI 809

Query: 651 ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQIN 710
           ALAVTIGASRNVYVSLPE++FK+K++N+PE+KE+H KYKLPSE+QLR DF KYG +EQIN
Sbjct: 810 ALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQIN 869

Query: 711 YLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 770
           YL D HCCWVNFMNI  AI+LVED N+  + N   F  +F+ RY  LII YGKDRCGNVN
Sbjct: 870 YLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNT--FSKKFNHRYDGLIINYGKDRCGNVN 927

Query: 771 KNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802
           +NL +NKNSR ++K+KK +   K  + Q+ +R
Sbjct: 928 RNLISNKNSRHYRKVKKFSDNYKLRQLQEKRR 959

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/404 (26%), Positives = 168/404 (41%), Gaps = 122/404 (30%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVS------------------------TPMRPQ 114
           +P  P TPFD  YGA+LLPSH+LMGSP+VS                        TP R  
Sbjct: 79  LPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNRKS 138

Query: 115 GXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXSFSLNH--SEPYQVNFKILPKGKDE 172
                           F                      N    +P+ +++K+LP G D 
Sbjct: 139 FSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDA 198

Query: 173 YMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDS--------------HSILL 218
           Y TRSLLFSN+    + D+H+F+ +F+++  IESIYL+ ++               SILL
Sbjct: 199 YRTRSLLFSNVA--SSIDLHSFIYDFVQYSSIESIYLISNTDDEKDQDNENDKNKRSILL 256

Query: 219 SFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC----------------------- 255
           SFL++  CL FYNN+LQR +EFK+ L S  L+++FV                        
Sbjct: 257 SFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQI 316

Query: 256 --------------QDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIPWL 301
                         ++  N    L+ +++    TR + IE + +  + T  L+++ + +L
Sbjct: 317 QENENDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTKCDKET--LLNKHLSFL 374

Query: 302 FFSH---RFVIERIDLVN--------------AAAPKNQN-------------------- 324
             +    R+++E IDL N               A  +N+N                    
Sbjct: 375 IDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSK 434

Query: 325 --FNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVNV 366
             F N Y ++ FI I MA+E+ +YL+    K   GI+   +V +
Sbjct: 435 RTFPNHYAVLSFINIYMAMELRDYLKLNGLKH--GITNASYVQI 476

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 1017 AKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYD 1061
             K  + I G DVM+QYL QL HSTF+Y+ NILG +   +   +YD
Sbjct: 1151 GKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDN--TYYD 1193

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score =  337 bits (864), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 208/491 (42%), Positives = 273/491 (55%), Gaps = 83/491 (16%)

Query: 423 LQVIPSEYPVPLIESHDDHLHSVTISRP-------SKTLTSSTSLVEMDXXXXXXXXXXS 475
           L++   +Y  P IE H  HL +V IS+        S+ + S   L E            S
Sbjct: 541 LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNE------HMFMNDS 594

Query: 476 NAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDNGGAG 535
           N   G ++   P     TPS +   L +N  ++P P+       +QSL   N N +    
Sbjct: 595 NQSNGAII---PQQLIATPSPVSPNLQMNQRVLPNPI-------TQSLE-QNFNVSAKVA 643

Query: 536 PSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQ 595
            S   D                     +G   NRT+YIGNI+PRSK EDICNVVRGGILQ
Sbjct: 644 SSMGSD---------------------IG---NRTIYIGNINPRSKAEDICNVVRGGILQ 679

Query: 596 NIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVT 655
           +IK+I  K+ICFVTFIEA +A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK I+LAVT
Sbjct: 680 SIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVT 739

Query: 656 IGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDG 715
           IGASRNVYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQINYL D 
Sbjct: 740 IGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDS 799

Query: 716 HCCWVNFMNIAHAIRLVEDCNSLSQRNLEK--------FHAQFDGRYKNLIIGYGKDRCG 767
           HCCW+NFMNI+ AI LVE+ N  S    E            +F GRYK L+I YGKDRCG
Sbjct: 800 HCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCG 859

Query: 768 NVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTXXXXXXXXXXXXXXTEKVPVSSK 827
           N+NKNL A KNSRF+KK+K+ +   + +K ++ +R                     +  K
Sbjct: 860 NINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNE------------------IDEK 901

Query: 828 EPVCDEILGLNDDNALAEGLGISLSSAYVNEYGDD-ISKRTNKKNRSKTETVEEDTGYTT 886
           E   D+ L L       E LGISL +   N  G+   +  T  +N S+ E  E + G  T
Sbjct: 902 EKAFDKPLNL-------ESLGISLDAHKDNGGGETGTANNTGHENESELE-AENENGNET 953

Query: 887 SGSSDIDIIVA 897
                + + VA
Sbjct: 954 GSFGGLGLAVA 964

 Score =  151 bits (382), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 140/250 (56%), Gaps = 48/250 (19%)

Query: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-----DD 212
           P+ +N+K+LP G D Y TRSLL  N++   + D+H+ + NF+K   +ES YL+     DD
Sbjct: 196 PFCINYKVLPTGDDAYRTRSLLIENVDH--SIDLHSIVKNFVKSNTLESAYLIEGGKSDD 253

Query: 213 SH-------SILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------- 255
           S        SIL+SFLTK  CL+FYNN+LQR SEFK+ L S  L++ FVC          
Sbjct: 254 SKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPT 313

Query: 256 -------------QDETNWFRL----LQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKI 298
                         D TN   +    L  N+  +  TRS+ IEF  +S    SDL  +K+
Sbjct: 314 FIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEF--KSPVEKSDLFKKKL 371

Query: 299 PWLFFS--HRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQL 356
            +L  S   R+++E IDLVN   P NQ F   Y ++ F+ ISMA+EV +YL++ S  K L
Sbjct: 372 QFLDRSKNKRYILESIDLVNTDVPSNQ-FPENYAVLTFLNISMAIEVLDYLKKYS--KNL 428

Query: 357 GISKIQFVNV 366
           GISK  +V++
Sbjct: 429 GISKCFYVSL 438

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 28/37 (75%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQG 115
           +P +P TPFD  YGASL PSH+LMGSPFVS+P    G
Sbjct: 60  LPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSG 96

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+ 
Sbjct: 1095 RTIPGSDVMAQYLAQVQHSTFMYAANILGASA 1126

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  334 bits (857), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 169/320 (52%), Positives = 216/320 (67%), Gaps = 39/320 (12%)

Query: 547 PINQALQRQYLTGTGQVGGS-----NNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIH 601
           PI Q+L+ Q    + +V  S      NRT+YIGNI+PRS+ EDICNVVRGGILQ+IK++ 
Sbjct: 625 PITQSLE-QNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMP 683

Query: 602 SKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRN 661
            KRICFVTFIEA +A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAVTIGASRN
Sbjct: 684 EKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 743

Query: 662 VYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVN 721
           VYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQINYL D HCCW+N
Sbjct: 744 VYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 803

Query: 722 FMNIAHAIRLVEDCNSLSQRNLE--------KFHAQFDGRYKNLIIGYGKDRCGNVNKNL 773
           FMNI+ AI LVE+ N  S  + E            +F GRY+ L+I YGKDRCGN+NKNL
Sbjct: 804 FMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNL 863

Query: 774 TANKNSRFFKKIKKLNCTTKPNKRQQSKRGTXXXXXXXXXXXXXXTEKVPVSSKEPVCDE 833
            A KNSRF+KK+K+ +   + +K ++ +R                        KE   D+
Sbjct: 864 VAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEN------------------DKKERAFDK 905

Query: 834 ILGLNDDNALAEGLGISLSS 853
            L L       E LGISL S
Sbjct: 906 ALNL-------ESLGISLDS 918

 Score =  142 bits (359), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 146/250 (58%), Gaps = 48/250 (19%)

Query: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-----DD 212
           P+++N+KILP G D Y TRSLL  N++R    D+H+ + NF+K   +ES Y++     DD
Sbjct: 195 PFRINYKILPTGDDAYRTRSLLIENVDRST--DLHSIVKNFVKSNTLESTYIIGNEKSDD 252

Query: 213 -------SHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------- 255
                  + SIL+SFLT++ CL+FYNN+LQR SEFK+ L S  L++ FVC          
Sbjct: 253 LKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLST 312

Query: 256 --QDETNWFRLLQMNVV---------------TRGVTRSLCIEFEDQSMELTSDLIHEKI 298
             +D+     + Q+++                 +  TRS+ +EF  +S   +++L ++K+
Sbjct: 313 FIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEF--KSPLKSTELFNKKL 370

Query: 299 PWLFFSH--RFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQL 356
            +L  S+  R+++E ID+VN   P NQ F   Y ++ F+ I MA+EV +YL++ S  K+L
Sbjct: 371 QFLDRSNNKRYILESIDIVNTDVPSNQ-FPENYAVLTFLNIFMAIEVLDYLKKYS--KKL 427

Query: 357 GISKIQFVNV 366
           GISK  +V++
Sbjct: 428 GISKCFYVSL 437

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           +P +P TPFD  YGASLLPSH+LMGSPFVS+P
Sbjct: 60  LPNIPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (80%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGAT 1051
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+
Sbjct: 1092 RTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1122

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  332 bits (852), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 243/399 (60%), Gaps = 50/399 (12%)

Query: 416 LALGIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDXX----XXXXX 471
           + L   SL++   +Y  P I  H  HL ++ IS   KT+ +S    +             
Sbjct: 531 IELDGTSLEITSHDYSTPTINEHSTHLSNIKIS---KTVENSRHFPQDIPSPLPLNEQMF 587

Query: 472 XXXSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNPNDN 531
              SN   G ++   P      PS L + L IN  ++P  +       +QSL   N N +
Sbjct: 588 MNDSNQSNGAVI---PQQLIAAPSPLSSNLQINQRVLPNAI-------TQSLE-QNFNVS 636

Query: 532 GGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRG 591
                S   D                     VG   NRT+YIGNI+PRS+ EDICNVVRG
Sbjct: 637 AKVASSMGSD---------------------VG---NRTIYIGNINPRSRAEDICNVVRG 672

Query: 592 GILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIA 651
           GILQ+IK+I  KRI FVTFIEA +A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+
Sbjct: 673 GILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSIS 732

Query: 652 LAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINY 711
           LAVTIGASRNVYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQINY
Sbjct: 733 LAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINY 792

Query: 712 LDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLE--------KFHAQFDGRYKNLIIGYGK 763
           L D HCCW+NFMNI+ AI LVE+ N  S  + +            +FDGRYK L+I YGK
Sbjct: 793 LSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGK 852

Query: 764 DRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802
           DRCGN+NKNL A KNSRF+KK+K+ +   + +K ++ +R
Sbjct: 853 DRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR 891

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 137/250 (54%), Gaps = 48/250 (19%)

Query: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDSH--- 214
           P+++N+KILP G D Y TRSLL  N++R    D+H+ + NF+KF  +ES Y +D+     
Sbjct: 195 PFRINYKILPTGDDAYRTRSLLIENVDRST--DLHSLVKNFVKFNTLESAYFVDNDKNDD 252

Query: 215 ---------SILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------- 255
                    S+L+SFLT++ CL+FYNN+LQR SEFK  L S  L++ FVC          
Sbjct: 253 LEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLST 312

Query: 256 -----------------QDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKI 298
                             D       L  +V  +  TRS+ IEF+  ++E T +L  +++
Sbjct: 313 FVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFK-SALEKT-ELFRKRL 370

Query: 299 PWLFFS--HRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQL 356
            +L  S   R+++E IDLVN   P NQ F   Y ++ F+ I MA+EV +YL++ S  K L
Sbjct: 371 QFLDESKNKRYILESIDLVNTDVPSNQ-FPENYAVLTFLNIFMAVEVLDYLKKFS--KSL 427

Query: 357 GISKIQFVNV 366
            ISK  +V++
Sbjct: 428 EISKCFYVSL 437

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (87%)

Query: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110
           +P VP TPFD  YGASLLPSH+LMGSPFVS+P
Sbjct: 60  LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+ 
Sbjct: 1089 RTIPGSDVMAQYLAQVQHSTFMYAANILGASA 1120

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  173 bits (439), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 127/209 (60%), Gaps = 31/209 (14%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RT+Y+GN+    K E+ICNVVRGG+LQNIK +  +  CF+TFI+  AA QFY
Sbjct: 348 GGPNNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFY 407

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL  + +  N  +VGWG+ SG L   +ALA++ GASRN+Y+   ++  K +Y N   
Sbjct: 408 AMSSLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN--- 464

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
                       EE LR+ F ++G+VEQIN+L +  CC+VNF NI HAI  ++   SL +
Sbjct: 465 ------------EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLPE 512

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                        +++L I +GKDRCGN+
Sbjct: 513 -------------FEDLKINFGKDRCGNI 528

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 113/204 (55%), Gaps = 31/204 (15%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI      +++ + VR G+++++K + +K   F++FI+   A+ F+++A L+ +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVT-IGASRNVYVSLPEYSFKEKYINNPEFKEYHGK 687
            + G  +++GWG+ S  +   +A  +T  GA+RNVY+                  + +  
Sbjct: 188 NIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG-----------------QLNDD 229

Query: 688 YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFH 747
             + +E++L +D  K+G+++ I +L +    +V+F +I+ AI +V++ + L++       
Sbjct: 230 PTITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSKLNE------- 282

Query: 748 AQFDGRYKNLIIGYGKDRCGNVNK 771
                +YKN  I YGKDRC  + K
Sbjct: 283 -----KYKNKRIFYGKDRCAFITK 301

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  171 bits (432), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 133/209 (63%), Gaps = 27/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+GN+    K E+ICNVVRGG+LQ++K +  + +CFVTFI+  AA QFY
Sbjct: 440 GGPNNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFY 499

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL  + +     +VGWG+ SG LP  +ALAV+ GASRNVY+     +F++  + +P 
Sbjct: 500 AMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP- 556

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
                   ++ +E+ LR+ F +YG+VEQIN+L + +CC++NF NI++AI  ++   S   
Sbjct: 557 --------RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIKS--- 605

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                     +  +++L I +GKDRCGNV
Sbjct: 606 ----------NPHFEDLKINFGKDRCGNV 624

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 106/203 (52%), Gaps = 23/203 (11%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI      +++ + VR G+++++K I  K   F++F++ ++A+ F+++A L+ +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKY 688
            + G  +++GWG+P+   P   A  +   A+RNV++     +  +     P         
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI-------- 325

Query: 689 KLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHA 748
              +E +LR+D   +G++E +  + +    +V+F +I  AI+ V +  S+          
Sbjct: 326 ---TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSM---------- 372

Query: 749 QFDGRYKNLIIGYGKDRCGNVNK 771
             +  Y+N  I YGKDRC  + K
Sbjct: 373 --NPYYENKKIAYGKDRCAFITK 393

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 127/204 (62%), Gaps = 28/204 (13%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           NRTVY+GN+    K E+ICN VRGG+LQ++K +  + +CFVTFI+  AA QFYA +SL  
Sbjct: 400 NRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLHG 459

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGK 687
           + +H    ++GWG+ SG LP  +ALAV+ GASRN+YV   +++  ++             
Sbjct: 460 LTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE-----------TG 508

Query: 688 YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVE--DCNSLSQRNLEK 745
             + +E+ LR+ F ++G+VEQIN+L + +CC++NF NI++AI  ++   CN         
Sbjct: 509 ETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCNPY------- 561

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNV 769
                   +KNL + +GKDRCGNV
Sbjct: 562 --------FKNLKVNFGKDRCGNV 577

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 110/206 (53%), Gaps = 23/206 (11%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI P    + + + VR G+++ +K +  +   F++F++ ++A+ F+++A L+ +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHG-- 686
            + G  ++VGWG+P+   P   A   + GA+RNVY+         +   +P+     G  
Sbjct: 221 NIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIG--------RLNTDPQLAPQFGTD 272

Query: 687 -KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745
              ++ SEE+LR+D   +G++E I  + D    +V+F +I  AI++V +           
Sbjct: 273 PNEEIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL---------- 322

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNVNK 771
             A  +  Y N  I YGKDRC  + K
Sbjct: 323 --ASVNPYYTNKKIFYGKDRCAFITK 346

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  168 bits (426), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 127/202 (62%), Gaps = 24/202 (11%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           NRTVY+GN+    K E+ICN +RGG+LQNIK ++ + +CFVTFI+  AA QFYA +SL  
Sbjct: 471 NRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLHG 530

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGK 687
           + +H    ++GWG+ SG LP  IALAV+ GASRN+Y  L   +F+E      + K+    
Sbjct: 531 LTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIY--LGNINFEE------DAKQEESV 582

Query: 688 YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFH 747
           +   +E+ LR  F ++G VEQIN+L + +CC++NF NI++AI  ++   S          
Sbjct: 583 F---AEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKS---------- 629

Query: 748 AQFDGRYKNLIIGYGKDRCGNV 769
              +  + NL I +GKDRCGNV
Sbjct: 630 ---NPHFNNLKINFGKDRCGNV 648

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 106/206 (51%), Gaps = 23/206 (11%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI      + + + VR G+++ +K +  K   FV+F++   A+ F+++A L+ +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHG-- 686
            + G  +++GWG+P    P   A     GA+RNVY+         K   N +  E  G  
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIG--------KLNTNKDSCEKWGAD 344

Query: 687 -KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745
            K  L ++E+L  D +++G++E I  ++D    +V+F +I  AI+ V +  S+       
Sbjct: 345 PKEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGSI------- 397

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNVNK 771
                D  Y N  + YGKDRC  + K
Sbjct: 398 -----DPYYSNKKVFYGKDRCAFITK 418

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  167 bits (422), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 126/202 (62%), Gaps = 24/202 (11%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           NRT+Y+GN+    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFYA +SL  
Sbjct: 394 NRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLHG 453

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGK 687
           + +H    ++GWG+ SG LP  +ALAV+ GASRN+Y+   ++   ++ +  P F      
Sbjct: 454 LTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF------ 506

Query: 688 YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFH 747
               +E  LR  F ++G+VEQIN+L + +CC++NF NI+ AI  ++   S+         
Sbjct: 507 ----TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT------- 555

Query: 748 AQFDGRYKNLIIGYGKDRCGNV 769
                 +K+L I +GKDRCGNV
Sbjct: 556 ------FKDLKINFGKDRCGNV 571

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 115/224 (51%), Gaps = 23/224 (10%)

Query: 551 ALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTF 610
           A+Q   ++       + +RTVY+GN+ P     ++ + VR G+++++K +  K   F++F
Sbjct: 138 AVQSSRMSNPKDFTSAPSRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISF 197

Query: 611 IEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYS 670
           ++  +A+ F+++A L+ + +    +++GWG+P+   P   A     GA+RNVY+      
Sbjct: 198 VDENSALLFHSDAILKRLNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLG----- 252

Query: 671 FKEKYINNPEFKEYHGK---YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAH 727
              K   NP+     G     +  +EE+LR D   +G+VE +  + +    +V+F +I  
Sbjct: 253 ---KLNTNPKMCAQWGADPNEETITEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFS 309

Query: 728 AIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 771
           AI++V +       N+  ++AQ         I YGKDRC  + K
Sbjct: 310 AIKVVANL-----ANVNPYYAQKK-------IFYGKDRCAFITK 341

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  165 bits (418), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 126/202 (62%), Gaps = 24/202 (11%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           NRT+Y+GN+    K E+ICN VRGG+LQ+IK +  + +CFVTFI+  AA QFYA +SL  
Sbjct: 341 NRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLHG 400

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGK 687
           + +H    ++GWG+ SG LP  +ALAV+ GASRN+Y+   +++  +K            +
Sbjct: 401 LTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKK-----------SQ 449

Query: 688 YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFH 747
           + + +E  LR  F ++G+VEQIN+L + +CC++NF NI+ AI  ++   S+         
Sbjct: 450 HPIFTEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT------- 502

Query: 748 AQFDGRYKNLIIGYGKDRCGNV 769
                 +K+L I +GKDRCGNV
Sbjct: 503 ------FKDLKINFGKDRCGNV 518

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 110/207 (53%), Gaps = 23/207 (11%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           +RTVY+GN+ P    +++ + VR G+++ +K +  K   F++F+E  +A+ F+++A L+ 
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHG- 686
           + +    +++GWG+P+   P   A     GA+RNVY+         K   N +     G 
Sbjct: 162 LNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIG--------KLNTNKDICAQWGV 213

Query: 687 --KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLE 744
               ++ +EE+LR D + +G+VE +  + +    +V+F +I  AI++V +       N+ 
Sbjct: 214 DPNEEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANL-----ANIN 268

Query: 745 KFHAQFDGRYKNLIIGYGKDRCGNVNK 771
            ++AQ         I YGKDRC  + K
Sbjct: 269 PYYAQKK-------IFYGKDRCAFITK 288

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/210 (42%), Positives = 130/210 (61%), Gaps = 29/210 (13%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+GN+    K E+ICN VR G+LQ++K +  + +CFVTFI+  AA QFY
Sbjct: 401 GGPNNLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFY 460

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL  ++L     +VGWG+ SG LP  IALAV+ GASRNV            YI N +
Sbjct: 461 AMSSLHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNV------------YIGNID 508

Query: 681 FKEYHGK-YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLS 739
           F+E   +  ++ +E+ LR+ F +YG+VEQIN+L   +CC++N+ NI++AI  ++   S  
Sbjct: 509 FEEDSKRNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKS-- 566

Query: 740 QRNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                      +  +K+L I +GKDRCGN+
Sbjct: 567 -----------NPYFKDLKINFGKDRCGNI 585

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 112/204 (54%), Gaps = 19/204 (9%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI      +++ + VR G+++++K +  K   F++F++ ++A+ F+++A L+ +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVS-LPEYSFKEKYINNPEFKEYHGK 687
            + G  +++GWG+P+   P       T GA+RNVY+  L   +   + +N P+  E    
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE---- 284

Query: 688 YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFH 747
             + +EE+L  D   YG ++ +  + +    +++F +I  AI++V   N+L+  N     
Sbjct: 285 --IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVV---NNLAASNR---- 335

Query: 748 AQFDGRYKNLIIGYGKDRCGNVNK 771
                 Y+N  I YGKDRC  + K
Sbjct: 336 -----YYQNRKIFYGKDRCAFITK 354

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  168 bits (425), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 126/209 (60%), Gaps = 26/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+GN+    K ++ICN VRGG+LQ+IK +  + +CFVTFI+  AA QFY
Sbjct: 520 GGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFY 579

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL  + +     +VGWG+ SG LP  IALAV+ GASRNVY+   ++    K  N P 
Sbjct: 580 AMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPI 639

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
           F          +E  LR  F +YG VEQIN+L + +CC++NF NI++AI  +E   +   
Sbjct: 640 F----------TELSLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKN--- 686

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                     +  +K+L I +GKDRCGN+
Sbjct: 687 ----------NPDFKDLKINFGKDRCGNI 705

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 132/264 (50%), Gaps = 32/264 (12%)

Query: 527 NPNDNGGAGPSYFMDPMSGAPI---NQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPE 583
           N  DN    P Y M  ++ A I   N ++Q   L      G + +RTVY+GNI      +
Sbjct: 223 NNGDNMRDEPPYMMASVAAATIANPNTSIQTSTLPNNNTFGNTPSRTVYLGNIPSDLSVK 282

Query: 584 DICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPS 643
           D+ + VR G+++NIK +  K   F++F++ ++A+ F+++A L+ + + G  +++GWG+P+
Sbjct: 283 DLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRLNIGGRDIKIGWGKPT 342

Query: 644 GELPKNIALAVTIGASRNVYVS----------------LPEYSFKEKYINNPEFKEYHGK 687
              P      VT GA+RNVY+                     S      ++ E K+    
Sbjct: 343 PIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPSNNTSDDLEKKKNIDD 402

Query: 688 YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFH 747
             L +EE+LR+D   YG+++ +  + D    +V+  +I  AI++V   N+L+Q N     
Sbjct: 403 SPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVV---NNLAQTN----- 453

Query: 748 AQFDGRYKNLIIGYGKDRCGNVNK 771
                 Y+N  I YGKDRC  + K
Sbjct: 454 ----PYYQNKRIFYGKDRCAFITK 473

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 125/209 (59%), Gaps = 27/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+GN+    K E+ICNVVRGG+LQN+K +  + +CFVTFI+  AA QFY
Sbjct: 443 GGPNNLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFY 502

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL  I +     RVGWG+  G L   +ALAV+ GASRNVYV    +    K   +P 
Sbjct: 503 AMSSLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKR-EDPI 561

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
           F          +E  LR  F ++G+VEQINYL + +CC+VN+ NI++AI  ++       
Sbjct: 562 F----------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKI----- 606

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
               K H  F    K+L I +GKDRCGNV
Sbjct: 607 ----KGHPVF----KDLKINFGKDRCGNV 627

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 118/226 (52%), Gaps = 30/226 (13%)

Query: 556 YLTGTGQVGGSNN------RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVT 609
           Y+    Q+G + N      +TVY+GN       +++ + VR G++++++ +  K   FV+
Sbjct: 191 YMPSIPQLGSNRNFNNAPSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVS 250

Query: 610 FIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYV----S 665
           F++ +AA+ F+++A L+ + + G  +++GWG+P+   P          A+RNVY+    +
Sbjct: 251 FVDESAALLFHSDAILKRLHIDGRDIKIGWGKPTPIDPVVATAVANDNATRNVYIGQLNT 310

Query: 666 LPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNI 725
            P+ S +   ++  E         + +E++LR D  ++G+++ I  +++    +V+F +I
Sbjct: 311 GPKLSSQVSPVDVTE--------PVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASI 362

Query: 726 AHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 771
            +AI+ V +             A  +  Y+N  I YGKDRC  + K
Sbjct: 363 LNAIKAVANL------------ANINPYYRNKKIFYGKDRCAFITK 396

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  164 bits (414), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 124/204 (60%), Gaps = 28/204 (13%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           NRT+Y+GN+    K E+ICN VRGG+LQ+IK +  + +CFVTFI+  AA Q YA  SL  
Sbjct: 387 NRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLHG 446

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGK 687
           + +H    ++GWG+ SG L   +ALAV+ GASRN+            Y+ N +FK    +
Sbjct: 447 LTIHNKRCKIGWGKHSGALSNALALAVSHGASRNI------------YLGNIDFKA-DSE 493

Query: 688 YKLP--SEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745
             +P  +E+ LR+ F +YG+VEQIN+L +  CC+VNF NI++AI  ++   S  Q     
Sbjct: 494 RDVPVFTEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSNEQ----- 548

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNV 769
                   +K+L I +GKDRCGNV
Sbjct: 549 --------FKDLKINFGKDRCGNV 564

 Score =  102 bits (255), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 110/206 (53%), Gaps = 21/206 (10%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           +RTVY+GNI P  +  ++ + VR G++++++ +  K   F++F++ ++A+ F+++A L+ 
Sbjct: 147 SRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKR 206

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSL--PEYSFKEKYINNPEFKEYH 685
           + + G  ++VGWG+P+   P   A     GA+RNVY+     +     ++  +P      
Sbjct: 207 LNIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP------ 260

Query: 686 GKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745
            +  + +EE+LR D   YG++E +  + +    +V+F +I  AI++V             
Sbjct: 261 -RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------- 309

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNVNK 771
             A  +  Y N  I YGKDRC  V K
Sbjct: 310 --ATVNPYYSNKKIFYGKDRCAFVTK 333

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  163 bits (413), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 126/203 (62%), Gaps = 26/203 (12%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           NRT+Y+GN+    K E+ICNVVRGG+LQ+IK +  + +CFVTFI+  AA Q YA ASL  
Sbjct: 385 NRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLHG 444

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFK-EYHG 686
           + +H    ++GWG+ SG L   +ALAV+ GASRN+            Y+ N +FK +   
Sbjct: 445 LTIHNKRCKIGWGKHSGALSNALALAVSHGASRNI------------YLGNIDFKADSET 492

Query: 687 KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKF 746
           ++ + +E+ LR  F ++G+VEQIN+L + +CC+VNF NI++AI  ++   +  Q      
Sbjct: 493 EHPIFTEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNNPQ------ 546

Query: 747 HAQFDGRYKNLIIGYGKDRCGNV 769
                  + +L I +GKDRCGNV
Sbjct: 547 -------FSDLKINFGKDRCGNV 562

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 112/206 (54%), Gaps = 21/206 (10%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           +RTVY+GNI P  +   + + VR G++++I+ +  K   F++F++ ++A+ F+++A L+ 
Sbjct: 145 SRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKR 204

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSL--PEYSFKEKYINNPEFKEYH 685
           + + G  +++GWG+P+   P   +     GA+RNVY+     + SF  +   +P      
Sbjct: 205 LNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADP------ 258

Query: 686 GKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745
            + ++ +E++LR D + YG++E +  + +    +V+F +I  AI++V             
Sbjct: 259 -RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL---------- 307

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNVNK 771
             A  +  Y N  I YGKDRC  + K
Sbjct: 308 --AAVNPYYANKKIFYGKDRCAFITK 331

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  164 bits (415), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 132/209 (63%), Gaps = 27/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RT+Y+GN+    + E+ICNVVRGG+LQ++K +  + +CFVTFI+  AA QF+
Sbjct: 491 GGPNNLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFF 550

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL  + +     +VGWG+ SG L   +ALAV+ GASRN+Y+   +++  +K  +NP 
Sbjct: 551 AMSSLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFATDKKR-DNPI 609

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
           F          +E+ LR+ F+ YG++EQIN+L + +CC++NF NI++AI  ++   S   
Sbjct: 610 F----------TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKS--- 656

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                     +  +K+L I +GKDRCGN+
Sbjct: 657 ----------NPVFKDLKINFGKDRCGNI 675

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 110/235 (46%), Gaps = 44/235 (18%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI      +++ + VR G+++++K I  K   F++F++  +A+ F+++A L+ +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVS-LPEYSF---KEKYINNPEFKEY 684
            ++G  +++GWG+ +   P      +  GA+RNV++  L   SF   K K    P  + +
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 685 HGKYKLP----------------------------SEEQLRQDFTKYGQVEQINYLDDGH 716
                +                             S+ +LR+D   +G ++ I  ++D  
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 717 CCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 771
             +++F +I  AI+ V + NS++              Y    I YGKDRC  + K
Sbjct: 402 IAFIHFASITSAIKCVHNLNSMND------------YYSTKKIFYGKDRCAFITK 444

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  162 bits (411), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 127/209 (60%), Gaps = 27/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFY
Sbjct: 407 GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 466

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV      F    +N+  
Sbjct: 467 AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDFASDSLNDE- 523

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
                   ++ +E  LR  F +YG+VEQIN+L + +CC++N+ NI++AI  ++   S   
Sbjct: 524 --------RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS--- 572

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                     +  +K+L I +GKDRCGNV
Sbjct: 573 ----------NPYFKDLKINFGKDRCGNV 591

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 111/203 (54%), Gaps = 27/203 (13%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GN+ P    +++ + VR G+++++K I  K   F++F++ +AA+ F+++A L+ +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKY 688
            +    +++GWG+P+   P   A   T GA+RNVY+       +E ++            
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL------------ 292

Query: 689 KLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHA 748
              SEEQLR D  +YG+++ I  + +    +++F +I +AI++V +   L  RN      
Sbjct: 293 ---SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTN---LPIRN------ 340

Query: 749 QFDGRYKNLIIGYGKDRCGNVNK 771
                Y+N  I YGKDRC  + K
Sbjct: 341 ---PYYQNKRIFYGKDRCAFITK 360

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  162 bits (410), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 126/209 (60%), Gaps = 27/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+GN+    K E+ICNVVRGGILQ IK +  + +CFVTFI+  AA QFY
Sbjct: 395 GGPNNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFY 454

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL  I +     RVGWG+  G LP  IALAV+ GASRNVY+   ++ +++     P 
Sbjct: 455 AMSSLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPI 513

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
           F          + + LR+ F +YG+VEQ+N+L + +C +VN+ NI++AI  ++   S   
Sbjct: 514 F----------TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKS--- 560

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                     +  +KNL I +GKDRCG +
Sbjct: 561 ----------NPLFKNLKINFGKDRCGTI 579

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 110/205 (53%), Gaps = 21/205 (10%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           +TVY+GNI P     ++ + VR G+++ +K +  K   F+TF++ +AA+ F+++A L+ +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSL--PEYSFKEKYINNPEFKEYHG 686
            + G  +++GWG+ +   P       + GA+RNVY+ L   +     +   +P  ++   
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKI-- 280

Query: 687 KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKF 746
                +EE+LR D  ++G+++ +  +++    +++F +I  A+++V +            
Sbjct: 281 -----TEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL----------- 324

Query: 747 HAQFDGRYKNLIIGYGKDRCGNVNK 771
            A  +  Y+N  I YGKDRC  + K
Sbjct: 325 -AGINPYYENKKIYYGKDRCAFITK 348

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  163 bits (412), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 91/209 (43%), Positives = 123/209 (58%), Gaps = 27/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+GN+    K E+ICN VRGG+LQ+IK +  + +CFVTFI+  AA QFY
Sbjct: 450 GGPNNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFY 509

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL    +     +VGWG+ SG LP  +ALAV+ GASRNVY+   ++    K    P 
Sbjct: 510 AMSSLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSKK-EQPI 568

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
           F          +E  LR  F +YG+VEQIN+L +  CC++NF NI +AI  ++   S   
Sbjct: 569 F----------NETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKS--- 615

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                     +  +K+L I +GKDRCGNV
Sbjct: 616 ----------NPHFKSLKINFGKDRCGNV 634

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 110/203 (54%), Gaps = 23/203 (11%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI P    +++ + VR G+++  K +  K   F++F+E ++A+ F+++A L+ +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKY 688
            +    ++VGWG+P+   P   +  +  GA+RNVY+         K    P         
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEPL-------- 335

Query: 689 KLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHA 748
              +EE+LR+D  +YG+++ I  + +    +V+F +IA AI++V   ++L+Q+N      
Sbjct: 336 ---TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVV---STLAQKN------ 383

Query: 749 QFDGRYKNLIIGYGKDRCGNVNK 771
                Y+   I YGKDRC  + K
Sbjct: 384 ---PFYQEKKIFYGKDRCAFITK 403

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  162 bits (410), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 129/212 (60%), Gaps = 33/212 (15%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFY
Sbjct: 436 GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 495

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEY---SFKEKYIN 677
           A +SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV   ++   S +++   
Sbjct: 496 AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFVSDSLRDE--- 552

Query: 678 NPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNS 737
                      ++ +E  LR  F +YG+VEQIN+L + +CC+VN+ NI++AI  ++   S
Sbjct: 553 -----------RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKS 601

Query: 738 LSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                        +  +K+L I +GKDRCGNV
Sbjct: 602 -------------NPYFKDLKINFGKDRCGNV 620

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 111/203 (54%), Gaps = 27/203 (13%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GN+ P    +++ + VR G+++++K I  K   F++F++ +AA+ F+++A L+ +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKY 688
            +    +++GWG+P+   P   A   T GA+RNVY+       +E ++            
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL------------ 321

Query: 689 KLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHA 748
              SEEQLR D  +YG+++ I  + +    +++F +I +AI++V +   L  RN      
Sbjct: 322 ---SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTN---LPIRN------ 369

Query: 749 QFDGRYKNLIIGYGKDRCGNVNK 771
                Y+N  I YGKDRC  + K
Sbjct: 370 ---PYYQNKRIFYGKDRCAFITK 389

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  161 bits (408), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 129/209 (61%), Gaps = 27/209 (12%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFY
Sbjct: 425 GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 484

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A +SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV          Y+++  
Sbjct: 485 AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDYVSDSV 538

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
             E     ++ +E +LR  F +YG+VEQIN+L + +CC++N+ NI++AI  ++   S   
Sbjct: 539 RDE-----RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS--- 590

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                     +  +K+L I +GKDRCGNV
Sbjct: 591 ----------NPYFKDLKINFGKDRCGNV 609

 Score =  106 bits (265), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 113/206 (54%), Gaps = 27/206 (13%)

Query: 566 SNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASL 625
           + +RTVY+GN+ P    +++ + VR G+++++K I  K   F++F++ +AA+ F+++A L
Sbjct: 200 AQSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAIL 259

Query: 626 EPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYH 685
           + + +    +++GWG+P+   P   A   T GA+RNVY+       +E ++         
Sbjct: 260 KRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL--------- 310

Query: 686 GKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745
                 S EQLR D  +YG+++ I  + +    +++F +I +AI++V +   L  RNL  
Sbjct: 311 ------SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTN---LPIRNL-- 359

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNVNK 771
                   Y+N  I YGKDRC  + K
Sbjct: 360 -------YYQNKRIFYGKDRCAFITK 378

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/212 (41%), Positives = 129/212 (60%), Gaps = 33/212 (15%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFY
Sbjct: 423 GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 482

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEY---SFKEKYIN 677
           A +SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV   ++   S +++   
Sbjct: 483 AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFVGDSLRDE--- 539

Query: 678 NPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNS 737
                      ++ +E  LR  F +YG+VEQIN+L + +CC++N+ NI++AI  ++   S
Sbjct: 540 -----------RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS 588

Query: 738 LSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                        +  +K+L I +GKDRCGNV
Sbjct: 589 -------------NPYFKDLKINFGKDRCGNV 607

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 111/203 (54%), Gaps = 27/203 (13%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GN+ P    +++ + VR G+++++K I  K   FV+FI+ +AA+ F+++A L+ +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKY 688
            +    +++GWG+P+   P   A   T GA+RNVY+       +E ++            
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 308

Query: 689 KLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHA 748
              SEEQLR D  +YG+++ I  + +    +++F +I +AI++V +   L  RN      
Sbjct: 309 ---SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTN---LPIRN------ 356

Query: 749 QFDGRYKNLIIGYGKDRCGNVNK 771
                Y+N  I YGKDRC  + K
Sbjct: 357 ---PYYQNKRIFYGKDRCAFITK 376

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  157 bits (396), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 119/209 (56%), Gaps = 29/209 (13%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GG NN   RT+Y+GN+  R + E++CNVVRGG+LQ++K++  + +CFVTF +  AA QFY
Sbjct: 257 GGPNNLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFY 316

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPE 680
           A ASL  + +     ++GWG+ SG LP ++A A++ GASRNVY       F      +P 
Sbjct: 317 AMASLHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPA 369

Query: 681 FKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQ 740
             E+        E  LRQ  + +G++EQ+N + +  C +VNF N+  AI  VE      Q
Sbjct: 370 VAEFF------EERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVKKWPQ 423

Query: 741 RNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
                        ++ L + YGKDRCGNV
Sbjct: 424 -------------FQQLKVNYGKDRCGNV 439

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 103/216 (47%), Gaps = 35/216 (16%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEP 627
           +RTVY+GNI P     ++ + V+ G++++ +   +K   FV+F++  +A+ F+++A L  
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 628 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYV-SLPEYSFKEKYINNPEFKEYHG 686
           + +    +++GW   +   P       + GA+RNVY+ +LP+                  
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV---------------- 141

Query: 687 KYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKF 746
                S  +L +D + YG+++ +  L      +V+  +I  AI  V         NL++ 
Sbjct: 142 -----SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVA--------NLQRD 188

Query: 747 HAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFF 782
           +  +  R     + +GKDRC  V K L  ++ ++F 
Sbjct: 189 NKIYSDRR----VSFGKDRCAYVTK-LQQSRAAQFL 219

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  159 bits (401), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 126/213 (59%), Gaps = 35/213 (16%)

Query: 564 GGSNN---RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFY 620
           GGSNN   RTVY+GN+    + EDICN +R G+LQNIK +  + +CFVTFI+  +A QFY
Sbjct: 407 GGSNNLGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFY 466

Query: 621 ANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSF----KEKYI 676
           A +S+   VL     +VGWG+ SG L   + LAV+ GASRNVY+   +++     +E+Y 
Sbjct: 467 AMSSIYGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTADGTKRERYF 526

Query: 677 NNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCN 736
                          ++  LR+ F++YG+VEQIN+L   +CC+VN+ NI +AI  ++   
Sbjct: 527 ---------------TDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIK 571

Query: 737 SLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNV 769
           +             +  +KNL I +GKDRCGN+
Sbjct: 572 N-------------NPTFKNLKINFGKDRCGNI 591

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 123/238 (51%), Gaps = 22/238 (9%)

Query: 569 RTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPI 628
           RTVY+GNI P     D+ + VR G+++ +K +  K   F++F++  +++ F+++A L+ +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 629 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGK- 687
            + G  +++GWG+PS   P       T GA+RN+++     +   K  +N +   YHG  
Sbjct: 228 NIDGKDIKIGWGKPSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDN-DATIYHGSD 286

Query: 688 --YKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEK 745
               + +EE+LR+D  +YG ++ I    +    +V+F +I  AI++V   N+LS  N   
Sbjct: 287 DFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVV---NNLSNSN--- 340

Query: 746 FHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRG 803
                   Y    I YGKDRC  + K  T   N+  F  I     T+K N  +Q+  G
Sbjct: 341 ------PYYSKKKIYYGKDRCAFITK--TQKHNAAQFLGIP----TSKANSLEQTNSG 386

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 12/105 (11%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRG-GILQNIKWIHSKRICFVTF---IEAAAAIQFYANA 623
           N TV++G + P++    + ++ +  G + N++  + K   FV F   I+A A+IQ     
Sbjct: 358 NTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 412

Query: 624 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIG---ASRNVYVS 665
            L+  ++ G+ +R+ WG+PS    K  +  +  G   +S NV  S
Sbjct: 413 GLQGFIVGGSPIRLSWGRPSSSNAKAASTVMGTGQYLSSNNVRAS 457

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 9/82 (10%)

Query: 568 NRTVYIGNIHPR-SKPEDICNVVRGGILQNIKWIHSKRICFVTF---IEAAAAIQFYANA 623
           N TV+IG +  + S+P+     +  G + N++    K   FV F   I+A AAIQ     
Sbjct: 366 NTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQ----- 420

Query: 624 SLEPIVLHGNILRVGWGQPSGE 645
            ++  ++ GN +R+ WG+ SGE
Sbjct: 421 GMQGFIVGGNPIRLSWGRSSGE 442

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 45/80 (56%), Gaps = 9/80 (11%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRG-GILQNIKWIHSKRICFVTF---IEAAAAIQFYANA 623
           N TV++G + P++    + ++ +  G + N++  + K   FV F   I+A A+IQ     
Sbjct: 355 NTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 409

Query: 624 SLEPIVLHGNILRVGWGQPS 643
            L+  ++ G+ +R+ WG+PS
Sbjct: 410 GLQGFIVGGSPIRLSWGRPS 429

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 39.3 bits (90), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRG-GILQNIKWIHSKRICFVTF---IEAAAAIQFYANA 623
           N TV++G + P++    + ++ +  G + N++  + K   FV F   I+A A+IQ     
Sbjct: 358 NTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 412

Query: 624 SLEPIVLHGNILRVGWGQPSGELPK 648
            L+  ++ G+ +R+ WG+PS    K
Sbjct: 413 GLQGFIVGGSPIRLSWGRPSSSSAK 437

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 45/80 (56%), Gaps = 9/80 (11%)

Query: 568 NRTVYIGNIHPRSKPEDICNVVRG-GILQNIKWIHSKRICFVTF---IEAAAAIQFYANA 623
           N TV++G + P++    + ++ +  G + N++  + K   FV F   I+A A+IQ     
Sbjct: 359 NTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 413

Query: 624 SLEPIVLHGNILRVGWGQPS 643
            L+  ++ G+ +R+ WG+PS
Sbjct: 414 GLQGFIVGGSPIRLSWGRPS 433

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 567 NNRTVYIGNIHPRSKPEDICNVVRG-GILQNIKWIHSKRICFVTF---IEAAAAIQFYAN 622
           NN TV+IG +   +    + ++    G + N+K    K   FV +   I+A AAIQ    
Sbjct: 404 NNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQ---- 459

Query: 623 ASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNV 662
             ++  ++ GN +R+ WG+ S +  ++ A+     + RNV
Sbjct: 460 -GMQGFIVGGNPIRLSWGRTSTDTSRHPAMQDMPSSLRNV 498

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 11/80 (13%)

Query: 567 NNRTVYIGNIHPRSKPEDICNVVR--GGILQNIKWIHSKRICFVTF---IEAAAAIQFYA 621
           NN TV+IG + P+     +  +    G IL  +K    K   FV +   I+A AAIQ   
Sbjct: 384 NNTTVFIGGLTPKINEAQLQALFSPFGNIL-TVKIPQGKNCGFVKYENRIDAEAAIQ--- 439

Query: 622 NASLEPIVLHGNILRVGWGQ 641
              ++  ++ GN +R+ WG+
Sbjct: 440 --GMQGFIVGGNPVRLSWGR 457

>TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {ON}
           Anc_8.670 YOR242C
          Length = 394

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 696 LRQDFTKYGQVEQINYLDDGHCCW-VNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRY 754
           L+ DF KYG +  +  +     C+ V+F N+A AIR ++    L    L K +      Y
Sbjct: 323 LKNDFKKYGTILDVTPIVSRKLCFAVHFANVASAIRAMQ-AFELKGTELNKKY------Y 375

Query: 755 KNLIIGYGKD 764
           K   + YGKD
Sbjct: 376 KRWAMWYGKD 385

>TPHA0I02890 Chr9 complement(635136..636410) [1275 bp, 424 aa] {ON}
           Anc_7.485 YBL046W
          Length = 424

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 38/86 (44%), Gaps = 18/86 (20%)

Query: 233 LLQRFSEFKSKLHSTKLSVSFVCQDETNWFRLLQMNVVTRGVTR---------------- 276
           L ++F E KS+   T + +  +C D   ++++ ++   TR +TR                
Sbjct: 87  LKKKFME-KSEYPFTIVRICELCYDPFKYYKVFELEKFTRAITRCCYVTSYWNTRGSSRV 145

Query: 277 -SLCIEFEDQSMELTSDLIHEKIPWL 301
             + +  E    E+T D+   KIPW+
Sbjct: 146 NEIVLHDESNKKEITDDVALTKIPWI 171

>TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON}
           Anc_8.466 YDL209C
          Length = 306

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 10/55 (18%)

Query: 676 INNPEFKEYHGKYKLPS--EEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHA 728
           INN E K        PS  E +LR  F++ G ++++ YL++ +C ++ F N  +A
Sbjct: 150 INNKELK--------PSQIESRLRYMFSRLGLLDRLRYLENKNCAFIKFKNQCNA 196

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR256W
           (HAP1)
          Length = 1152

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%)

Query: 167 PKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDSHSILLSFLTKATC 226
           PKG DE  TRSL  S  +   N+ I  +  + + F   +S Y    S    +  L    C
Sbjct: 702 PKGNDEPGTRSLARSYAQEAMNYAIDGYYHSLLFFNSFKSDYNKHTSIFTHMQVLLAPAC 761

Query: 227 LDFYNNLLQ 235
           LD  +  LQ
Sbjct: 762 LDMGHRALQ 770

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,117,132
Number of extensions: 4268320
Number of successful extensions: 13010
Number of sequences better than 10.0: 58
Number of HSP's gapped: 13078
Number of HSP's successfully gapped: 138
Length of query: 1067
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 947
Effective length of database: 39,721,479
Effective search space: 37616240613
Effective search space used: 37616240613
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)