Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_4614na 1ON48148124190.0
SAKL0D01408gna 1ON5064309801e-127
KLLA0D01507gna 1ON5154488921e-114
ABL123Cna 1ON4944267302e-90
ACR143WsingletonON3933332544e-23
Kwal_26.88028.677ON4123292291e-19
NCAS0C013608.677ON4063342253e-19
NDAI0E021058.677ON4083382211e-18
KLTH0D11264g8.677ON4173402183e-18
ACR144W8.677ON4083412148e-18
TPHA0D012608.677ON4193342042e-16
Suva_16.1568.677ON4063382032e-16
Smik_6.3518.677ON4053382032e-16
Kpol_1072.158.677ON3993322022e-16
ZYRO0F07392g8.677ON4183462014e-16
Skud_16.1288.677ON4053382014e-16
KNAG0J017108.677ON4153392005e-16
TBLA0B038308.677ON4133341997e-16
Kpol_1013.68.677ON4023391988e-16
SAKL0H06512g8.677ON4043281981e-15
YPL154C (PEP4)8.677ON4053381943e-15
TDEL0A062308.677ON4083271916e-15
CAGL0M02211g8.677ON4153301891e-14
KLLA0D05929g8.677ON4093391801e-13
TPHA0C008408.318ON10003701699e-12
Ecym_23968.677ON4153231651e-11
KAFR0H024208.677ON4163491534e-10
CAGL0J02288g7.182ON5411241526e-10
YIL015W (BAR1)7.182ON5872851519e-10
Skud_9.1547.182ON5164021491e-09
Suva_9.186singletonOFF5431421445e-09
Suva_9.1877.182ON3331221417e-09
Smik_9.1757.182ON5931251411e-08
YLR121C (YPS3)8.319ON5083681392e-08
Smik_12.1878.319ON5073701357e-08
Skud_12.1938.319ON4973761348e-08
ZYRO0F10274gsingletonON5723091294e-07
KNAG0I01200singletonON6771211261e-06
Ecym_43947.182ON5182981232e-06
NCAS0A124607.182ON5403021214e-06
KNAG0H027607.182ON5631251205e-06
Suva_10.2128.319ON7453551152e-05
KAFR0B057108.318ON5751741143e-05
NDAI0B017207.182ON5471521143e-05
Smik_65.1singletonON3422591105e-05
SAKL0F07172g7.182ON5422171108e-05
KLLA0D15917g7.182ON5111221091e-04
AGR407CsingletonON2681171061e-04
KAFR0B06530singletonON5383491072e-04
Ecym_42518.318ON5023501072e-04
KAFR0H023008.318ON5212431062e-04
Smik_5.7singletonON3041411043e-04
TDEL0H026507.182ON5522971045e-04
NCAS0B035608.318ON5862371045e-04
ZYRO0E02266gsingletonON5061191036e-04
ZYRO0D15554g7.182ON5213851036e-04
CAGL0M04191g8.318ON6012731036e-04
Skud_12.1928.318ON5692751010.001
KNAG0I009108.318ON5691871000.001
KNAG0E03220singletonON540252980.002
CAGL0E01837gsingletonON521125960.003
Smik_12.1868.318ON572214960.004
Kwal_33.14239singletonON651271960.004
YLR120C (YPS1)8.318ON569216940.007
CAGL0E01881gsingletonON508146920.013
Kwal_26.7254singletonON570225920.013
TBLA0D045807.182ON395129910.015
NDAI0G026208.318ON590377890.026
SAKL0C02970gsingletonON592238890.026
Kpol_543.618.318ON588384890.029
NDAI0J010308.318ON652239880.036
CAGL0E01727gsingletonON53950880.036
CAGL0E01859gsingletonON505131880.038
YIR039C (YPS6)singletonON537114880.040
SAKL0E15356gsingletonON557283870.053
Suva_10.2118.318ON566218870.053
CAGL0E01749gsingletonON482127860.054
KLLA0F22088g5.401ON55890860.055
Suva_79.1singletonON227114840.064
KNAG0G024108.318ON530405860.068
KLTH0F06754gsingletonON767224860.074
ZYRO0G02904gsingletonON531118850.076
ZYRO0F10252gsingletonON551302850.079
SAKL0H15664g8.318ON556224850.079
CAGL0E01771gsingletonON51948840.10
ZYRO0F10318g8.319ON486115830.12
AGL192W8.318ON499376830.14
NCAS0C033008.318ON559117830.15
TBLA0D00140singletonON607117830.16
ZYRO0F10230g8.318ON580134820.17
AGR240W7.182ON452376810.21
TBLA0E02630singletonON689255790.43
CAGL0E01793gsingletonON516130780.51
KNAG0E037405.162ON883147780.61
YDR144C (MKC7)8.318ON59641761.00
TPHA0A015808.318ON600147761.0
YDR379W (RGA2)5.453ON100976761.1
Smik_4.3888.318ON597290751.2
KLTH0G12386g8.318ON58044741.6
Suva_2.3058.318ON59744741.9
KLLA0E04049g8.318ON589210732.1
Suva_16.14singletonON540114732.5
CAGL0E01419g8.318ON591129722.9
TDEL0A058808.642ON37676713.2
KAFR0E03940singletonON63837723.3
ZYRO0D02244g1.204ON420109704.8
NCAS0F034205.441ON52571704.9
ZYRO0F10296gsingletonON528118688.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4614
         (481 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...   936   0.0  
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...   382   e-127
KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly...   348   e-114
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...   285   2e-90
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...   102   4e-23
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    93   1e-19
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    91   3e-19
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     90   1e-18
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    89   3e-18
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    87   8e-18
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    83   2e-16
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    83   2e-16
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    83   2e-16
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    82   2e-16
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    82   4e-16
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    82   4e-16
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    82   5e-16
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    81   7e-16
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    81   8e-16
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    81   1e-15
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    79   3e-15
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    78   6e-15
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    77   1e-14
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    74   1e-13
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....    70   9e-12
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    68   1e-11
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    64   4e-10
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...    63   6e-10
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...    63   9e-10
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...    62   1e-09
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    60   5e-09
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    59   7e-09
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...    59   1e-08
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...    58   2e-08
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...    57   7e-08
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...    56   8e-08
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...    54   4e-07
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}               53   1e-06
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...    52   2e-06
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...    51   4e-06
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...    51   5e-06
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...    49   2e-05
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...    49   3e-05
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...    49   3e-05
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)        47   5e-05
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...    47   8e-05
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...    47   1e-04
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    45   1e-04
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}             46   2e-04
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...    46   2e-04
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...    45   2e-04
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)        45   3e-04
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...    45   5e-04
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...    45   5e-04
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...    44   6e-04
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...    44   6e-04
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...    44   6e-04
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...    44   0.001
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}               43   0.001
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...    42   0.002
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...    42   0.003
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...    42   0.004
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...    42   0.004
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...    41   0.007
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...    40   0.013
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...    40   0.013
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...    40   0.015
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A    39   0.026
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...    39   0.026
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...    39   0.029
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}              39   0.036
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...    39   0.036
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...    39   0.038
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...    39   0.040
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...    38   0.053
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...    38   0.053
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...    38   0.054
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    38   0.055
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...    37   0.064
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...    38   0.068
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...    38   0.074
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...    37   0.076
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...    37   0.079
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...    37   0.079
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...    37   0.10 
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...    37   0.12 
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...    37   0.14 
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}               37   0.15 
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                 37   0.16 
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...    36   0.17 
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...    36   0.21 
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...    35   0.43 
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...    35   0.51 
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    35   0.61 
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...    34   1.00 
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...    34   1.0  
YDR379W Chr4 (1230167..1233196) [3030 bp, 1009 aa] {ON}  RGA2GTP...    34   1.1  
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...    33   1.2  
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...    33   1.6  
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...    33   1.9  
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...    33   2.1  
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...    33   2.5  
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...    32   2.9  
TDEL0A05880 Chr1 (1035123..1036253) [1131 bp, 376 aa] {ON} Anc_8...    32   3.2  
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}               32   3.3  
ZYRO0D02244g Chr4 (175646..176908) [1263 bp, 420 aa] {ON} weakly...    32   4.8  
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...    32   4.9  
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...    31   8.2  

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/481 (95%), Positives = 461/481 (95%)

Query: 1   MFFILTAVILFLRLSLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGD 60
           MFFILTAVILFLRLSLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGD
Sbjct: 1   MFFILTAVILFLRLSLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGD 60

Query: 61  DSADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPW 120
           DSADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPW
Sbjct: 61  DSADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPW 120

Query: 121 VYGDSCSLRACEGRKLYPTGGKQTVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFA 180
           VYGDSCSLRACEGRKLYPTGGKQTVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFA
Sbjct: 121 VYGDSCSLRACEGRKLYPTGGKQTVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFA 180

Query: 181 FGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENT 240
           FGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENT
Sbjct: 181 FGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENT 240

Query: 241 TLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTG 300
           TLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTG
Sbjct: 241 TLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTG 300

Query: 301 AQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNKN 360
           AQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNKN
Sbjct: 301 AQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNKN 360

Query: 361 WTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           WTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA
Sbjct: 361 WTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420

Query: 421 LKNSNVNLVQNSNISTNTLEAXXXXXXXXXXXXXXXXXXXXFPLKLHNYLYYLVIYFSLW 480
           LKNSNVNLVQNSNISTNTLEA                    FPLKLHNYLYYLVIYFSLW
Sbjct: 421 LKNSNVNLVQNSNISTNTLEATPLSSTTISSSHSTSKSEGTFPLKLHNYLYYLVIYFSLW 480

Query: 481 L 481
           L
Sbjct: 481 L 481

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 272/430 (63%), Gaps = 13/430 (3%)

Query: 9   ILFLRLSLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGDDSADAVKQ 68
           +LF  L+L FFP+S  RFL +    +V   +             G  ++       AV  
Sbjct: 12  VLFPSLALGFFPTSRDRFLQDNSCYEVNALNKQHEEATSLGNFAGSSYTPQHYKDTAVSN 71

Query: 69  AADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWVYGDSCSL 128
           ++++      + + P I+IL  D +S AY V+VTI D  Y LI+DTGSA+ WVYGDSC+ 
Sbjct: 72  SSNETF--AKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYLWVYGDSCNS 129

Query: 129 RACEGRKLYPTGGK-QTVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVATSV 187
            +C+GRKL+PT    Q V  ++F L Y  G+  G ++ D  I+N L T++ F FGVA+ V
Sbjct: 130 SSCKGRKLFPTTNVLQDV--ASFSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEV 187

Query: 188 PQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTT------ 241
           P +FENYP SGI GLP+++  ++E  +S L  S +I  +KF++ + HI +E +       
Sbjct: 188 PDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDV 247

Query: 242 --LNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFT 299
             L +N G+FAIG+ +  LYKG+IYY+ L+ + N+YW + I+ ++ N   V F N ENFT
Sbjct: 248 QDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFT 307

Query: 300 GAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNK 359
           G++S + RS IIDSG+T L+LPK DALDIH+Y   SITDG  FA+ CNST  LT E  NK
Sbjct: 308 GSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTLTLEFDNK 367

Query: 360 NWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGF 419
           NWTIP+  YLG+ Y + S YYGYCVSNI+G  I  +WILGDVF++  Y VFD++NQ++GF
Sbjct: 368 NWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGF 427

Query: 420 ALKNSNVNLV 429
           A  N N  LV
Sbjct: 428 AEGNENALLV 437

>KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly
           similar to uniprot|Q12303 Saccharomyces cerevisiae
           YLR121C YPS3 Aspartic protease
          Length = 515

 Score =  348 bits (892), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/448 (43%), Positives = 270/448 (60%), Gaps = 17/448 (3%)

Query: 2   FFILTAVILFLRLSLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGDD 61
             IL   I  L    AF+P S  R+L  G   KV + +  +  +    V +    S    
Sbjct: 14  LIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKYAAQ---FVNINDALSKQAL 70

Query: 62  SADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWV 121
              A  +++   ++   V + P ++IL+ DSN+ AY VNVTI DE Y L++D+GSA+ WV
Sbjct: 71  QGQATAKSSTKNVE---VPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDSGSAYLWV 127

Query: 122 YGDSCSLRACEGRKLYPTGG-KQTVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFA 180
           YG SC+ ++C   KL+ T   K+  + STF L Y  G  SG +++D  I+N L T++ F 
Sbjct: 128 YGSSCTSKSCTSNKLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFT 187

Query: 181 FGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYL------DH 234
           FGVA  VP +FENYPVSGI GLP+N+   +E  +SVL  S +I  +KF+L +      D+
Sbjct: 188 FGVANEVPDIFENYPVSGIFGLPSNNSDNIESIISVLSESNAISMEKFSLIIGALNSKDN 247

Query: 235 IESENTTLNA----NSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLV 290
             SE++ L A    N GLF IG+ + +LY GDI+Y+ L+ N N+YW + ID ++ NS  V
Sbjct: 248 TTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAV 307

Query: 291 TFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTV 350
            F   E  TG+QS   RSGI+DSG+T L+LP  DALD+H++   S++DG  FA+ CNST 
Sbjct: 308 NFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTE 367

Query: 351 DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVF 410
            L+ E+    W I +  YLGE Y + S YYGYCVSNI+G  +  SWILG VF+K+ Y VF
Sbjct: 368 ILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVF 427

Query: 411 DMDNQQVGFALKNSNVNLVQNSNISTNT 438
           D+ NQQ G A KN N  LV   N +TN+
Sbjct: 428 DVQNQQFGLANKNENAILVPYVNSATNS 455

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score =  285 bits (730), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 163/426 (38%), Positives = 238/426 (55%), Gaps = 17/426 (3%)

Query: 15  SLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGD-------DSADAVK 67
           +L    +++ RFL   +  ++       P   V  ++   + S G          A+  K
Sbjct: 15  ALCLHLATQNRFLEATETSRIY--KLLAPTRIVSEIKTSADDSTGSTLLKYNRSGAETKK 72

Query: 68  QAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWVYG-DSC 126
            A  + L        P I++L RD  S  +I+  T     Y L+LDTGSA  WVYG +S 
Sbjct: 73  SAQCNSLT-----FRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISWVYGVNSS 127

Query: 127 SLRACEGRKLYPTGGKQ-TVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVAT 185
           S    + R+ +       TV  S F + Y  G   G ++  +  IN L   + F FGVA 
Sbjct: 128 SSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQD-FRFGVAI 186

Query: 186 SVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNAN 245
            VP + + Y +SGI GLP++   +    + +L  SK I  + F++ L HI SE+  L+ N
Sbjct: 187 GVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDN 246

Query: 246 SGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRS 305
           +GL   GEP+  LY+G++ Y+ LV NP N+WL+AI   +  S  V     +N +  ++  
Sbjct: 247 NGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIG 306

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNKNWTIPA 365
            RSGIID+GST +VLP+ DAL +HSY   SI+DG  FA++CNS+  +  EL   NWTI  
Sbjct: 307 IRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILP 366

Query: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
           S+++GEPY + S Y GYCVSNI+G  I SSWILG+VF+++ YTVFD++ +QVGFA +N+ 
Sbjct: 367 SNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNTK 426

Query: 426 VNLVQN 431
             LV N
Sbjct: 427 ATLVHN 432

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score =  102 bits (254), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 148/333 (44%), Gaps = 34/333 (10%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQTVNGS--TFRL 152
           Y V++T+    + + + LDTGS+  W+  D C+ + C  R  Y +G   T   +  T RL
Sbjct: 83  YSVDITLGTPAQNFRVALDTGSSLLWIPSDRCTSQICRTRNRYRSGASSTFKATDKTLRL 142

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANSPG-TVE 211
            Y  G     +  D+         E   FG A ++   F      GI+G+   S G  ++
Sbjct: 143 QYVKGDAKARVSYDTLYFAGAKI-ENQGFGEAEAIGDDFSGARFDGIIGIGYPSIGYGIK 201

Query: 212 PALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVN 271
           P ++ L  S  ++   F +Y+ + ++ N+ +    G   +G   T+ +KGDI        
Sbjct: 202 PPINTLIDSGGLKDPMFGIYISNAQNRNSPV----GEIVLGGYNTQKFKGDI-------- 249

Query: 272 PNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSY 331
               WL  + + F  + L  F+   NF  A      + + D+GS+F+++P+    D  S 
Sbjct: 250 ---KWLPVLRKAFWETDLSAFK-VGNF--ALDVQGLTAVFDTGSSFIIMPEDTYTDFVSQ 303

Query: 332 LPGSITDGNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIE 388
            PG+  D     V C   NS  DLT + G     + A  Y+    Q G      C+  + 
Sbjct: 304 FPGASHDDGTDYVDCSTVNSGPDLTLDFGGVALKLSARDYV---MQLGRN---TCILAVS 357

Query: 389 GQA-IHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           G + +    ILGD F++ +YT+++  +  +G A
Sbjct: 358 GNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVA 390

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 94/329 (28%), Positives = 144/329 (43%), Gaps = 42/329 (12%)

Query: 106 EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRLDYPYGITSGAI 163
           + + +ILDTGS+  WV  D C   AC    +  +        NG++F + Y  G   G I
Sbjct: 109 QSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTSFAIQYGSGSLEGYI 168

Query: 164 FQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGTVEPALSVLYRSKS 222
            QD+  I +L   +   F  ATS P + F      GILGL  ++  +V+  +  +Y++ +
Sbjct: 169 SQDTLSIGDLTIPKQ-DFAEATSEPGLAFAFGKFDGILGLGYDTI-SVDKVVPPVYKAIN 226

Query: 223 ---IRSQKFTLYLDHIE-SENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLI 278
              +   +F  YL++ + SE +T     G    G   +  YKGDI +  L V    YW +
Sbjct: 227 DGLLDEPRFAFYLNNADDSEEST-----GEVTFGGIDSSKYKGDITW--LPVRRKAYWEV 279

Query: 279 AIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITD 338
             D I         Q     TGA         ID+G++ + LP   A  ++S +      
Sbjct: 280 KFDGIGLGDEYAELQG----TGAA--------IDTGTSLIALPSGLAEVLNSEIGAKKGW 327

Query: 339 GNYFAVFCNST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG----QA 391
              + V C S     DLTF    KN+TI A  Y  E         G C+S        + 
Sbjct: 328 TGQYTVDCESRDQLPDLTFTFNGKNFTITAYDYTLE-------VSGSCISAFTPMDFPEP 380

Query: 392 IHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           +    I+GD F++ FY+++D+ N  VG A
Sbjct: 381 VGPLAIIGDAFLRKFYSIYDLGNNAVGLA 409

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 137/334 (41%), Gaps = 38/334 (11%)

Query: 99  VNVTISDEEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRLDYPY 156
           ++V    + + +ILDTGS+  WV    C+  AC    +  +        NG+ F + Y  
Sbjct: 96  ISVGTPPQNFKVILDTGSSNLWVPSSECNSLACFLHSKYDHDASSSYKANGTKFAIQYGS 155

Query: 157 GITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPAN--SPGTVEPA 213
           G   G I QD+  I +L   +   F  ATS P + F      GILGL  +  S   V P 
Sbjct: 156 GSLEGYISQDTLNIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLAYDTISVDKVVPP 214

Query: 214 LSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPN 273
                    +  +KF  YL   + +      N G   IG      +KGDI +  L V   
Sbjct: 215 FYNAIEQGLLDEKKFAFYLGDTKKDEK----NGGEITIGGIDESKFKGDIEW--LPVRRK 268

Query: 274 NYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLP 333
            YW +  + I         +N                ID+G++ + LP   A  I++ + 
Sbjct: 269 AYWEVKFEGIALGDQYAALEN------------HGAAIDTGTSLITLPSGLAEIINTEIG 316

Query: 334 GSITDGNYFAVFCNST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG- 389
                   + + C++     DLTF    KN+TI        P+    +  G C+S I   
Sbjct: 317 AKKGWTGQYTLDCDTRDGLPDLTFNFNGKNFTI-------SPFDYTLEVSGSCISAIMPM 369

Query: 390 ---QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
              + +    I+GD F++ +Y+++D+DN  VG A
Sbjct: 370 DFPEPMGPMAIVGDAFLRKYYSIYDLDNHAVGLA 403

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/338 (26%), Positives = 140/338 (41%), Gaps = 40/338 (11%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQTV--NGSTFRL 152
           Y  ++T+    + + +ILDTGS+  WV    C   AC     Y      +   NG+ F +
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWVPSVECGSLACYLHSKYDHDKSSSYKPNGTDFAI 153

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANS--PGT 209
            Y  G   G I QD+  I +LN  +   F  ATS P + F      GILGL  +S     
Sbjct: 154 RYGTGSLEGYISQDTLNIGDLNIPKQ-DFAEATSEPGLTFAFGKFDGILGLAYDSISVNK 212

Query: 210 VEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV 269
           V P        + +  +KF  YL     +    + + G   IG      +KGDI +  L 
Sbjct: 213 VVPPFYNAIEQELLDEKKFAFYL----GDANKKSEDGGEITIGGIDKTKFKGDIDW--LP 266

Query: 270 VNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIH 329
           V    YW +  + I         +N                ID+G++ + LP   A  I+
Sbjct: 267 VRRKAYWEVKFEGIGLGDQFAELEN------------HGAAIDTGTSLIALPSGLAEIIN 314

Query: 330 SYLPGSITDGNYFAVFCNSTV---DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSN 386
           + +         + V C++     DLTF    KN+TI        PY    +  G C+S 
Sbjct: 315 TEIGAKKGWTGQYTVECDARPNLPDLTFNFNGKNFTI-------GPYDYTLEVSGSCISA 367

Query: 387 IEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           I      + +    I+GD F++ +Y+++D++N  VG A
Sbjct: 368 IMPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAVGLA 405

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 94/340 (27%), Positives = 146/340 (42%), Gaps = 44/340 (12%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRL 152
           Y   +T+    + + +ILDTGS+  WV  D C   AC    +  +        NG+ F +
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTNFAI 162

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGTVE 211
            Y  G   G I QD+  I +L   +   F  ATS P + F      GILGL  ++   V+
Sbjct: 163 QYGSGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLAFAFGKFDGILGLGYDTI-AVD 220

Query: 212 PALSVLYRSKS---IRSQKFTLYLDHIE-SENTTLNANSGLFAIGEPITELYKGDIYYSE 267
             +  +Y++ +   +   +F  YL++ + SE +T     G    G   +  YKG+I +  
Sbjct: 221 KVVPPVYKAINDGLLDEPRFAFYLNNADDSEEST-----GEVTFGGIDSSKYKGNITW-- 273

Query: 268 LVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALD 327
           L V    YW +  D I         +     TGA         ID+G++ + LP   A  
Sbjct: 274 LPVRRKAYWEVKFDGIGLGDEYAELEG----TGAA--------IDTGTSLIALPSGLAEV 321

Query: 328 IHSYLPGSITDGNYFAVFCNST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCV 384
           +++ +         + V C S     DLTF    KN+TI A  Y  E         G C+
Sbjct: 322 LNAEIGAKKGWSGQYTVDCESRDQLPDLTFTFNGKNFTISAYDYTLE-------VSGSCI 374

Query: 385 SNIEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           S        + +    I+GD F++ FY+V+D+ N  VG A
Sbjct: 375 SAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLA 414

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 92/341 (26%), Positives = 141/341 (41%), Gaps = 37/341 (10%)

Query: 92  SNSHAYIVNVTISDEEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQTV--NGST 149
           +N +A  V +    +++ +++DTGS+  WV G  C   AC   K Y      T   NG+ 
Sbjct: 90  NNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKECRAMACRLHKRYDHDRSSTYKENGTL 149

Query: 150 FRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVP-QMFENYPVSGILGLPANSPG 208
             + Y  G   G + +D+F I++L       F   T  P  +F      GILGL   S G
Sbjct: 150 TGVTYGSGSIMGYVSEDTFRISDLEIPGQ-QFTETTDEPGSVFVFAAFDGILGLAYPSLG 208

Query: 209 -TVEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSE 267
             V P    L   K ++   F +YLD +++        +G   +G      +KG+I +  
Sbjct: 209 YGVTPPFQQLMEKKLVKEPVFGMYLDDMKT-----GEGNGQLVLGGYDETKFKGEIAW-- 261

Query: 268 LVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALD 327
           L V    YW +  D +      +     EN+  A         IDSG++ +  P      
Sbjct: 262 LPVRRQAYWEVVFDSVTVGDDNIPL---ENYGAA---------IDSGTSLITFPSELFNQ 309

Query: 328 IHSYLPGSITD--GNYFAVFCNSTV--DLTFELGNKNWTIPASSY-LGEPYQEGSKYYGY 382
             S L G   D  GN +    N      LTF  G   ++I    Y +  P Q        
Sbjct: 310 FISKLSGVTKDRQGNVYVDCANKQTAPPLTFGFGGHKFSISGEDYIISVPGQSAR----- 364

Query: 383 CVSNIEGQAIHSSW---ILGDVFIKNFYTVFDMDNQQVGFA 420
           C+  I    I S+    I+GDVF++ +Y+++D  N  VG A
Sbjct: 365 CMPAIVQLDIDSAGKVAIIGDVFLRRYYSIYDFGNNAVGLA 405

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/334 (24%), Positives = 134/334 (40%), Gaps = 37/334 (11%)

Query: 99  VNVTISDEEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQTV--NGSTFRLDYPY 156
           +++    + + +ILDTGS+  WV    C+  AC     Y      T   NG+ F + Y  
Sbjct: 108 ISLGTPKQNFKVILDTGSSNLWVPSKDCTSLACYLHSKYDHDESTTYEKNGTKFTIQYGS 167

Query: 157 GITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGT--VEPA 213
           G   G I +D+ II +        F  ATS P + F      GILGL  ++     V P 
Sbjct: 168 GSMDGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGLAYDTIAVNKVVPP 227

Query: 214 LSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPN 273
                +   +   KF  YL     +N +     G    G      + GDI +  L V   
Sbjct: 228 FYNAIKQGILDENKFAFYLGDTNKDNKS----GGEATFGGYDKSKFTGDITW--LPVRRK 281

Query: 274 NYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLP 333
            YW +  D I     + +                   ID+G++ + LP   A  I++ + 
Sbjct: 282 AYWEVKFDSIALGDEVASLDG------------YGAAIDTGTSLITLPSGLAEVINTQIG 329

Query: 334 GSITDGNYFAVFCNST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG- 389
              +    + + C++     D+TF     N+T+        PY    +  G C+S I   
Sbjct: 330 AKKSWSGQYTIDCDTRDALPDMTFNFNGYNFTV-------SPYDYTLEMSGSCISAITPM 382

Query: 390 ---QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
              + +    I+GD F++ +Y+++D+DN  VG A
Sbjct: 383 DFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLA 416

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 138/338 (40%), Gaps = 40/338 (11%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRL 152
           Y  ++++ +  + + +ILDTGS+  WV    C   AC    +  +        NG+ F +
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWVPSTECGSLACFLHSKYDHEASSSYKPNGTEFAI 151

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPAN--SPGT 209
            Y  G   G I QD+  I +L   +   F  ATS P + F      GILGL  +  S   
Sbjct: 152 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 210

Query: 210 VEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV 269
           V P      +   +  +KF  YL     + +  + N G    G      +KGD+ +  L 
Sbjct: 211 VVPPFYNAIQQDLLDEKKFAFYL----GDTSKDSENGGEATFGGIDKSKFKGDVTW--LP 264

Query: 270 VNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIH 329
           V    YW +  + I         +                 ID+G++ + LP   A  I+
Sbjct: 265 VRRKAYWEVKFEGIGLGHEFAELEG------------HGAAIDTGTSLITLPSGLAEMIN 312

Query: 330 SYLPGSITDGNYFAVFCNST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSN 386
           + +         +A+ CN+     DLTF     N+TI        PY    +  G C+S 
Sbjct: 313 AEIGAKKGWSGQYALDCNTRDGLPDLTFNFNGYNFTI-------GPYDYTLEVSGSCISA 365

Query: 387 IEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           I      + +    I+GD F++ +Y+++D+ N  VG A
Sbjct: 366 ITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLA 403

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 137/338 (40%), Gaps = 40/338 (11%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRL 152
           Y  ++T+    + + +ILDTGS+  WV  + C   AC    +  +        NG+ F +
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPAN--SPGT 209
            Y  G   G I QD+  I +L   +   F  ATS P + F      GILGL  +  S   
Sbjct: 151 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 209

Query: 210 VEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV 269
           V P      +   +  +KF  YL     + +  + N G    G      +KGDI +  L 
Sbjct: 210 VVPPFYNAIQQDLLDEKKFAFYL----GDTSKDSENGGEATFGGIDESKFKGDITW--LP 263

Query: 270 VNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIH 329
           V    YW +  + I         ++                ID+G++ + LP   A  I+
Sbjct: 264 VRRKAYWEVKFEGIGLGDEYAELES------------HGAAIDTGTSLITLPSGLAEMIN 311

Query: 330 SYLPGSITDGNYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSN 386
           + L         + + CN   S  DL F     N+TI        PY    +  G C+S 
Sbjct: 312 AELGAKKGWTGQYTLDCNTRDSLPDLIFNFNGYNYTI-------GPYDYTLEVSGSCISA 364

Query: 387 IEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           I      + +    I+GD F++ +Y+++D+ N  VG A
Sbjct: 365 ITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLA 402

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/332 (25%), Positives = 141/332 (42%), Gaps = 35/332 (10%)

Query: 99  VNVTISDEEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQTV--NGSTFRLDYPY 156
           V++    +++ +ILDTGS+  WV    CS  AC     Y      T   NGS F + Y  
Sbjct: 90  VSIGTPPQKFKVILDTGSSNLWVPSVGCSSLACYLHSKYDHSLSSTYRSNGSDFVIQYGS 149

Query: 157 GITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGTVEPALS 215
           G   G I QD+  I +L   +   F  AT+ P + F      GILGL  +S  +V  A+ 
Sbjct: 150 GSLKGYISQDTLTIGDLIIPQQ-DFAEATAEPGLAFAFGKFDGILGLAYDSI-SVNKAVP 207

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275
            LY +         ++  ++  E ++ N     F   +P    ++G+I +  L V    Y
Sbjct: 208 PLYNAIHRGLLDKPMFAFYLGDEKSSKNGGEATFGGYDP--SRFEGEIKW--LPVRRKAY 263

Query: 276 WLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGS 335
           W +  D I      +  +                 ID+G++ + LP   A  +++ +   
Sbjct: 264 WEVQFDGIKLGDKFMKLEG------------HGAAIDTGTSLITLPSQIADFLNNEIGAK 311

Query: 336 ITDGNYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG--- 389
            +    + + C    S   LT    N N+TI       +P+    +  G C+S I     
Sbjct: 312 KSWNGQYTIDCKKRESLPKLTLNFYNHNFTI-------DPFDYTLEISGSCISAITPMDF 364

Query: 390 -QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
            Q +    I+GD F++ FY+++D++N  VG A
Sbjct: 365 PQPVGPLSIIGDAFLRRFYSIYDLENNAVGLA 396

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 146/346 (42%), Gaps = 40/346 (11%)

Query: 88  LTRDSNSHAYI-VNVTISDEEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQT 144
           LT   N+  Y  V++    + + +ILDTGS+  WV    CS  AC    +  + +     
Sbjct: 97  LTNYLNAQYYTEVSLGTPPQNFKVILDTGSSNLWVPSTECSSLACFLHSKYDHDSSSSYK 156

Query: 145 VNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLP 203
            NG+ F + Y  G   G I QD+  + +L+ ++   F  ATS P + F      GILGL 
Sbjct: 157 PNGTEFAIRYGSGSLEGYISQDTLNLGDLSITKQ-DFAEATSEPGLQFAFGKFDGILGLG 215

Query: 204 AN--SPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKG 261
            +  S   V P     ++   +   KF  YL          + + G+   G      Y+G
Sbjct: 216 YDTISVDGVVPPFYNAWKQGLLDEPKFAFYLGR-----DGESQDGGVATFGGVDDSKYEG 270

Query: 262 DIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLP 321
           +I +  L +    YW +  D I         +N                ID+G++ + LP
Sbjct: 271 EITW--LPIRRKAYWEVKFDGIGLGEEYAELEN------------HGAAIDTGTSLIALP 316

Query: 322 KVDALDIHSYLPGSITDGNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSK 378
              A  I++ +    +    + V C   +S  ++TF LG  N+ + A  Y+ E       
Sbjct: 317 SGLAEIINAEIGAKKSWTGQYTVECEARSSLPNMTFTLGGHNFELTAYDYILE------- 369

Query: 379 YYGYCVSNIEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
             G C+S I      + +    I+GD F++ +Y+++D+ N  VG A
Sbjct: 370 VSGQCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGLA 415

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 136/338 (40%), Gaps = 40/338 (11%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRL 152
           Y  ++T+    + + +ILDTGS+  WV  + C   AC    +  +        NG+ F +
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPAN--SPGT 209
            Y  G   G I QD+  I +L   +   F  ATS P + F      GILGL  +  S   
Sbjct: 151 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 209

Query: 210 VEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV 269
           V P      +   +  +KF  YL     + +  + N G    G      +KGDI +  L 
Sbjct: 210 VVPPFYNAIQQDLLDEKKFAFYL----GDTSKDSENGGEATFGGIDESKFKGDITW--LP 263

Query: 270 VNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIH 329
           V    YW +  + I         +                 ID+G++ + LP   A  I+
Sbjct: 264 VRRKAYWEVKFEGIGLGDEYAELEG------------HGAAIDTGTSLITLPSGLAEMIN 311

Query: 330 SYLPGSITDGNYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSN 386
           + L         + + CN   S  DL F     N+TI        PY    +  G C+S 
Sbjct: 312 AELGAKKGWTGQYTLDCNTRDSLPDLIFNFNGYNFTI-------GPYDYTLEVSGSCISA 364

Query: 387 IEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           I      + +    I+GD F++ +Y+++D+ N  VG A
Sbjct: 365 ITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLA 402

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 88/339 (25%), Positives = 140/339 (41%), Gaps = 42/339 (12%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQT--VNGSTFRL 152
           Y  ++T+    +++ +ILDTGS+  WV    C   AC   + Y      +   NG+ F +
Sbjct: 101 YYTDITLGTPPQQFKVILDTGSSNLWVPSSECGSLACFLHEKYDHSASSSYKANGTDFSI 160

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPAN--SPGT 209
            Y  G   G I QD+  I +L   +   F  ATS P + F      GILGL  +  S   
Sbjct: 161 QYGSGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLAFAFGKFDGILGLAYDTISVDK 219

Query: 210 VEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAI-GEPITELYKGDIYYSEL 268
           V P          +   KF  YL      +T  +A  G  AI G      Y GD+ +  L
Sbjct: 220 VVPPFYNALEQDLLDEAKFAFYLG-----DTNKDAEDGGEAIFGGVDKSKYTGDVTW--L 272

Query: 269 VVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI 328
            V    YW + ++ +         ++                ID+G++ + LP   A  I
Sbjct: 273 PVRRKAYWEVKLEGLGLGDEYAELES------------HGAAIDTGTSLITLPSGLAEII 320

Query: 329 HSYLPGSITDGNYFAVFCNST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVS 385
           +S +         + + CN+     DLTF     N+TI        PY    +  G C+S
Sbjct: 321 NSEIGAKKGWTGQYTLECNTRDQLPDLTFNFNGYNFTIG-------PYDYTLEVSGSCIS 373

Query: 386 NIEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
            I      + +    I+GD F++ +Y+++D+++  VG A
Sbjct: 374 AITPMDFPEPVGPLAIVGDAFLRKYYSIYDLEHNAVGLA 412

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 133/334 (39%), Gaps = 38/334 (11%)

Query: 99  VNVTISDEEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQT--VNGSTFRLDYPY 156
           + +    + + ++LDTGS+  WV    C   AC     Y      T   NGS F + Y  
Sbjct: 103 IKIGTPPQSFKVVLDTGSSNLWVPSKECGSLACYLHSKYNHDESSTYKANGSAFAIQYGS 162

Query: 157 GITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGT--VEPA 213
           G   G I QD   I +L  ++   F  ATS P + F      GILGL  ++     V P 
Sbjct: 163 GSLEGYISQDVMEIGDLKITKQ-DFAEATSEPGISFAFGKFDGILGLAYDTIAVNRVVPP 221

Query: 214 LSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPN 273
           +        +   KF  YL     + +    N G    G      ++GDI +  L V   
Sbjct: 222 VYNAINQGLLDEPKFAFYL----GDASKSKDNGGEAVFGGIDETKFEGDITW--LPVRRK 275

Query: 274 NYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLP 333
            YW + ++ +         +N                ID+G++ + LP   A  I+S + 
Sbjct: 276 AYWEVKLEGLGLGEEYTELEN------------HGAAIDTGTSLITLPSGLAEIINSEIG 323

Query: 334 GSITDGNYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG- 389
                   + + C+   S  D+TF     N+TI        PY    +  G C+S I   
Sbjct: 324 AKKGWTGQYTIECDKRASLPDMTFTFDGYNFTI-------SPYDYTLEVSGSCISAITPM 376

Query: 390 ---QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
              + +    I+GD F++ +Y+V+D+ N  VG A
Sbjct: 377 DFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLA 410

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 92/339 (27%), Positives = 139/339 (41%), Gaps = 43/339 (12%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQTV--NGSTFRL 152
           Y  ++T+    + + +ILDTGS+  WV    C+  AC     Y      T   NG+TF +
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWVPSVDCNSLACYLHAKYDHSDSSTYKKNGTTFSI 148

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGT-- 209
            Y  G   G I QD   I +L       F  ATS P + F      GILGL  ++     
Sbjct: 149 QYGSGSMEGYISQDVLQIGDLVIPGQ-DFAEATSEPGLAFAFGKFDGILGLAYDTIAVNR 207

Query: 210 VEPALSVLYRSKSIRSQKFTLYL-DHIESENTTLNANSGLFAIGEPITELYKGDIYYSEL 268
           V P        K +    F+ YL D  +SE+       G    G   + L+ GDI +  L
Sbjct: 208 VVPPFYNAINKKLVDEPIFSFYLGDDTKSED------GGQVTFGGYDSSLFTGDITW--L 259

Query: 269 VVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI 328
            V    YW +  D I   + +    N                ID+G++ + LP   A  I
Sbjct: 260 PVRRKAYWEVKFDAIALGNEVADLVN------------HGAAIDTGTSLITLPSGLAEVI 307

Query: 329 HSYLPGSITDGNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVS 385
           +S +    +    + V C   ++  D+TF     N+TI        PY    +  G C+S
Sbjct: 308 NSQIGAKKSWSGQWIVDCKTRDTLPDMTFTFDGYNFTI-------TPYDYTLEVSGSCIS 360

Query: 386 NIEGQ----AIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
            I        +    I+GD F++ +Y+++D+ N  VG A
Sbjct: 361 AITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVGLA 399

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/328 (25%), Positives = 133/328 (40%), Gaps = 41/328 (12%)

Query: 106 EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRLDYPYGITSGAI 163
           + + +ILDTGS+  WV    C   AC    +  + +      NGS+F + Y  G   G I
Sbjct: 102 QNFKVILDTGSSNLWVPSAECGSLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSLEGYI 161

Query: 164 FQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANS---PGTVEPALSVLYR 219
            QD+  I +L   +   F  ATS P + F      GILGL  +S      V P  + ++ 
Sbjct: 162 SQDTLSIGDLTIPKQ-DFAEATSEPGLAFAFGKFDGILGLAYDSISVDKVVPPVYNAIHN 220

Query: 220 SKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIA 279
              +   KF+ YL      N   + + G    G   +  Y+G+I +  L V    YW + 
Sbjct: 221 GL-LDEPKFSFYLG-----NADKSTDGGEATFGGIDSSKYEGNITW--LPVRRKAYWEVK 272

Query: 280 IDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG 339
            D I                           ID+G++ + LP   A  +++ +       
Sbjct: 273 FDGIGLGDEYAILDG------------HGAAIDTGTSLIALPSGLAEILNAEIGAKKGWS 320

Query: 340 NYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG----QAI 392
             ++V C+   S  DLT   G  N+TI        PY    +  G C+S        + +
Sbjct: 321 GQYSVECDTRDSLPDLTLNFGGYNFTI-------TPYDYTLEVSGSCISAFTPMDFPEPV 373

Query: 393 HSSWILGDVFIKNFYTVFDMDNQQVGFA 420
               I+GD F++  Y+V+D+ N  VG A
Sbjct: 374 GPLAIIGDAFLRKHYSVYDLGNDAVGLA 401

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 136/338 (40%), Gaps = 40/338 (11%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRL 152
           Y  ++T+    + + +ILDTGS+  WV  + C   AC    +  +        NG+ F +
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPAN--SPGT 209
            Y  G   G I QD+  I +L   +   F  ATS P + F      GILGL  +  S   
Sbjct: 151 QYGTGSLEGYISQDTLSIGDLTIPKQ-DFAEATSEPGLTFAFGKFDGILGLGYDTISVDK 209

Query: 210 VEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV 269
           V P      +   +  ++F  YL     + +    N G    G      +KGDI +  L 
Sbjct: 210 VVPPFYNAIQQDLLDEKRFAFYL----GDTSKDTENGGEATFGGIDESKFKGDITW--LP 263

Query: 270 VNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIH 329
           V    YW +  + I         ++                ID+G++ + LP   A  I+
Sbjct: 264 VRRKAYWEVKFEGIGLGDEYAELES------------HGAAIDTGTSLITLPSGLAEMIN 311

Query: 330 SYLPGSITDGNYFAVFCNST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSN 386
           + +         + + CN+     DL F     N+TI        PY    +  G C+S 
Sbjct: 312 AEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIG-------PYDYTLEVSGSCISA 364

Query: 387 IEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           I      + +    I+GD F++ +Y+++D+ N  VG A
Sbjct: 365 ITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLA 402

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 131/327 (40%), Gaps = 35/327 (10%)

Query: 106 EEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQTV--NGSTFRLDYPYGITSGAI 163
           + + +ILDTGS+  WV    C   AC     Y      +   NG+ F + Y  G   G I
Sbjct: 102 QNFKVILDTGSSNLWVPSVDCGSLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSLEGYI 161

Query: 164 FQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPAN--SPGTVEPALSVLYRS 220
            QD+  + +L   +   F  ATS P + F      GILGL  N  S   V P        
Sbjct: 162 SQDTLSVGDLVIPKQ-DFAEATSEPGLAFAFGKFDGILGLAYNTISVDKVVPPFYNAIDQ 220

Query: 221 KSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAI 280
             +   +F  YL    S++   + + G+   G      +KG+I  S L V    YW +  
Sbjct: 221 DLLDEPRFAFYLG-DSSDSEDSSVSGGVATFGGIDKSKFKGEI--SWLPVRRKAYWEVKF 277

Query: 281 DRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGN 340
           + I                           ID+G++ + LP   A  I+S +        
Sbjct: 278 EGIGLGDEFAILDG------------HGAAIDTGTSLITLPSGLAEIINSEIGAKKGWSG 325

Query: 341 YFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG----QAIH 393
            + V C   +S  DLTF    KN+TI        PY    +  G C+S I      + + 
Sbjct: 326 QYTVDCETRSSLPDLTFNFSGKNYTI-------GPYDYTLEVSGSCISAITPMDFPEPVG 378

Query: 394 SSWILGDVFIKNFYTVFDMDNQQVGFA 420
              I+GD F++ FY+V+D+ N  VG A
Sbjct: 379 PLAIVGDTFLRRFYSVYDLGNNAVGLA 405

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/330 (25%), Positives = 140/330 (42%), Gaps = 37/330 (11%)

Query: 106 EEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQT--VNGSTFRLDYPYGITSGAI 163
           +++ +ILDTGS+  WV    C   AC     Y      T   +G    + Y  G   G I
Sbjct: 102 QKFKVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGYI 161

Query: 164 FQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGT--VEPALSVLYRS 220
            +D+  I +L T +   FG  TS P + F      GILGL  ++     + P      + 
Sbjct: 162 SEDNLQIGDL-TIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQ 220

Query: 221 KSIRSQKFTLYLDHIESENTTLNANS--GLFAIGEPITELYKGDIYYSELVVNPNNYWLI 278
             +   KF+ YL  +        + S  G+F +G   +  +KGD+    L V    YW +
Sbjct: 221 HLLDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDLI--PLHVRRQAYWEV 278

Query: 279 AIDRI-FCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSIT 337
            ++ I   + +    +N    TGA         ID+G++ + LP   A  I++ +     
Sbjct: 279 PLNAIKLGDQSTGKLEN----TGAA--------IDTGTSLITLPSDMAEIINAQIGAKKG 326

Query: 338 DGNYFAVFCNSTV---DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEG----Q 390
               + + C++     DLTF L   ++ +        P++   +  G C+S I      +
Sbjct: 327 WTGQYTLECSTRAKLPDLTFTLDGHDFVL-------SPFEYTLEVSGSCISVITPMDFPE 379

Query: 391 AIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
            I    ILGD F++ +Y+VFD+D   V  A
Sbjct: 380 PIGRMAILGDAFLRRYYSVFDLDANVVSLA 409

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/339 (25%), Positives = 137/339 (40%), Gaps = 43/339 (12%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRACEGRKLYPTGGKQT--VNGSTFRL 152
           Y   +T+    + + +ILDTGS+  WV    C   AC     Y      T   NGS F +
Sbjct: 96  YFTEITLGSPPQSFKVILDTGSSNLWVPSAECGSLACFLHTKYDHEASSTYKANGSEFAI 155

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGT-- 209
            Y  G   G + +D   I +L   +   F  ATS P + F      GILGL  +S     
Sbjct: 156 QYGSGSLEGYVSRDLLTIGDLVIPDQ-DFAEATSEPGLAFAFGKFDGILGLAYDSISVNR 214

Query: 210 VEPALSVLYRSKSIRSQKFTLYL-DHIESENTTLNANSGLFAIGEPITELYKGDIYYSEL 268
           + P +    ++K +    F  YL D  +SE+       G  + G    E Y G+I +  L
Sbjct: 215 IVPPVYNAIKNKLLDDPVFAFYLGDSDKSED------GGEASFGGIDEEKYTGEITW--L 266

Query: 269 VVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI 328
            V    YW +  + I       T +                 ID+G++ + LP   A  +
Sbjct: 267 PVRRKAYWEVKFEGIGLGEEYATLEG------------HGAAIDTGTSLIALPSGLAEIL 314

Query: 329 HSYLPGSITDGNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVS 385
           ++ +         ++V C   +S  DLT      N+TI A  Y  E         G C+S
Sbjct: 315 NAEIGAKKGWSGQYSVDCESRDSLPDLTLNFNGYNFTITAYDYTLE-------VSGSCIS 367

Query: 386 NIEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
                   + +    I+GD F++ +Y+++D+ +  VG A
Sbjct: 368 AFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVGLA 406

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 100/370 (27%), Positives = 153/370 (41%), Gaps = 65/370 (17%)

Query: 87  ILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWVYGD---SCSLRA-----CE--GRKL 136
           +LT  +  ++  + V    +  ++I+DTGS+  WV G    +C L +     CE  G   
Sbjct: 65  VLTNRNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHDNLTCPLASDGSFNCERFGSFS 124

Query: 137 YPTGGKQTVNGSTFRLDYPYGITS-GAIFQDSFIINNLNTSETFAFGVATSVPQMFENYP 195
                  T N + F + Y  G    G   QD+ II  +N +   +FGV  +         
Sbjct: 125 ISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNAT-GLSFGVVHTTTSS----- 178

Query: 196 VSGILGLPANSPGTVEPALS------------VLYRSKSIRSQKFTLYLDHIESENTTLN 243
            +GILG+    P T   A+             VL     I  Q +++YLD   S      
Sbjct: 179 -AGILGIGL--PDTETTAVGQYGHYKYDNFPMVLKNKGIISHQGYSIYLDSSSS------ 229

Query: 244 ANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQS 303
              G F +G   T  Y G +Y   LV   N Y+    D        VT Q     T + S
Sbjct: 230 -TYGEFLLGGVDTSKYTGTLYKLPLVNWYNTYFSSPGDF------HVTLQGLGLITNSGS 282

Query: 304 -----RSKRSGIIDSGSTFLVLPKVDALDIHSYLPG--SITDGNYFAVFCNSTVDLTFEL 356
                 +K + I+D+GST   +P      + S L G  S T G Y       T  L F  
Sbjct: 283 AVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTETSKLVFNF 342

Query: 357 GNKNWTIPASSY---LGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMD 413
           G  N+ +P SS+   LG+           C   +  ++  S++ILGD F++N Y  FD++
Sbjct: 343 GGINYKLPMSSFINTLGD---------NVCSLKVSSRS-DSNFILGDDFLRNVYAAFDLE 392

Query: 414 NQQVGFALKN 423
           N+++G A+ +
Sbjct: 393 NKEIGLAMAD 402

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 130/323 (40%), Gaps = 30/323 (9%)

Query: 106 EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRLDYPYGITSGAI 163
           + + +++DTGS+  WV   +C   AC    R  +        N S F + Y  G   G +
Sbjct: 112 QSFKVVMDTGSSNLWVPNKNCVSEACLNHARFDHDRSSSYAKNDSRFSVSYGKGSMEGFV 171

Query: 164 FQDSFIINNLNTSETFAFGVATSVP-QMFENYPVSGILGLPANSPGT--VEPALSVLYRS 220
             D+  I +L T +   F  AT  P   F      GILGL  +      + P        
Sbjct: 172 SYDTLKIGDL-TIKNQGFAEATVEPGSAFVYGQFDGILGLAYDGLAVNHIVPPFYEAVHQ 230

Query: 221 KSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAI 280
             +    F  YL    S+    ++ +G    G      + G+I  S L V    YW + +
Sbjct: 231 GLLDEPVFAFYL----SDEKKGDSLAGEVVFGGYDETKFTGEI--SWLPVIRKAYWEVEL 284

Query: 281 DRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSIT--D 338
           + I   S     QN              G +D+G++F+  P     +  S    ++   D
Sbjct: 285 NSITLGSQKFQLQN------------YGGALDTGTSFITFPSELYQEFVSKTGATVDPDD 332

Query: 339 GNYFAVFCNSTV-DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWI 397
           G+  A    S   DLTFEL  +++TI +S Y+    Q         ++ ++        I
Sbjct: 333 GHIIAPCSGSGFPDLTFELAGRSFTISSSDYV---VQWDDTTCAVAITPLDLGGAGKMVI 389

Query: 398 LGDVFIKNFYTVFDMDNQQVGFA 420
           +GDVF++ +Y+++D+    VG A
Sbjct: 390 IGDVFLRRWYSIYDLSKNAVGLA 412

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 85/349 (24%), Positives = 147/349 (42%), Gaps = 48/349 (13%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRAC--EGRKLYPTGGKQTVNGSTFRL 152
           Y  +++I    + + +I+DTGS+  WV    C+  AC    +  +        NG+ F +
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWVPSVDCNSLACFLHNKYDHRVSSTYVRNGTRFAI 158

Query: 153 DYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQM-FENYPVSGILGLPANSPGTVE 211
            Y  G   G +  D+  + +L   +   F  ATS P + F      GI GL  ++  +V 
Sbjct: 159 RYGSGALEGYMSNDTVTVGDLQIPKQ-DFAEATSEPGLAFAFGKFDGIFGLAFDTI-SVN 216

Query: 212 PALSVLYRSKS---IRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSEL 268
            A+   Y + +   + + +F  YL      +  L    G    G      + G+I +  L
Sbjct: 217 RAVPPFYNAVNRGLLDAPQFAFYLG-----DKRLRKEGGEVTFGGYDETRFTGNITW--L 269

Query: 269 VVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI 328
            V    YW +  + I   S       P   TGA         ID+G++ + LP   A  +
Sbjct: 270 PVRREAYWEVDFNGISFGSQYA----PLTATGAA--------IDTGTSLITLPSGLAEIL 317

Query: 329 HSYLPGSITDGNYFAVFCN--STV-DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVS 385
           ++ +         + + C+  ST+ D+TF LG  N++I        PY    +  G C+S
Sbjct: 318 NAQIGARKNWSGQYVLDCSRRSTLPDITFNLGGSNFSI-------GPYDYTLEASGTCIS 370

Query: 386 NIEG----QAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQ 430
            I      + +    I+GD F++ +Y+V+D+ N     +  NS V L +
Sbjct: 371 AIVPMDFPEPVGPLAIIGDAFLRRWYSVYDLGN-----STTNSTVGLAE 414

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 64/124 (51%), Gaps = 11/124 (8%)

Query: 303 SRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGN-YFAVFCNS-----TVDLTFEL 356
           S +K   ++D+GST + LP      I SYL  + +D +  F + C S     T DL F  
Sbjct: 273 SNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTF 332

Query: 357 GNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQ 416
           G  +  IP  S++  P +E +   G  +++ +G+ I     LGD F+ + YTVFD+DN  
Sbjct: 333 GELHMKIPLRSFILLPDEESNGLCGLGITSSKGRVI-----LGDSFLTHVYTVFDLDNYM 387

Query: 417 VGFA 420
           +  A
Sbjct: 388 ISLA 391

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 126/285 (44%), Gaps = 57/285 (20%)

Query: 181 FGVATSVPQMFENYPVSGILGLP----------ANSPGTVEPAL-SVLYRSKSIRSQKFT 229
           FGVA      +   PVSG+LG+             +P    P    +L   K I    ++
Sbjct: 157 FGVA-----KYATTPVSGVLGIGFPRRESVKGYEGAPNEYYPNFPQILKSEKIIDVVAYS 211

Query: 230 LYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTL 289
           L+L+  +S        +G    G      + GD++   +V   N Y  I    +   +TL
Sbjct: 212 LFLNSPDS-------GTGSIVFGAIDESKFSGDLFTFPMV---NEYPTI----VDAPATL 257

Query: 290 -VTFQNPENFTGAQSRS----------KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITD 338
            +T Q      GAQ++S          K   ++DSG++ L  PKV A  + S++  S ++
Sbjct: 258 AMTIQG----LGAQNKSSCEHETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSE 313

Query: 339 GNYFAVF-CNSTV---DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHS 394
                +  C  +V   +  F+ G+   ++P SS +  P  EGS Y G+ V     Q  + 
Sbjct: 314 EEGIYILDCPVSVGDVEYNFDFGDLQISVPLSSLILSPETEGS-YCGFAV-----QPTND 367

Query: 395 SWILGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQNS--NISTN 437
           S +LGDVF+ + Y VFD+DN ++  A  N N + V     NI T+
Sbjct: 368 SMVLGDVFLSSAYVVFDLDNYKISLAQANWNASEVSKKLVNIQTD 412

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 93/402 (23%), Positives = 164/402 (40%), Gaps = 82/402 (20%)

Query: 85  ITILTRDSNSH-------------AYIVNVTISDEEYSLILDTGSAFPWVYGDS---CSL 128
           I  LT D + H             A  +++    ++ +++ DTGSA  WV   S   CS 
Sbjct: 22  IAALTNDGSGHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSP 81

Query: 129 RAC---------EGRKLYPTGGKQTV-----NGSTFRLDYPYG----------ITSGAIF 164
           ++           G K+ P+    ++     N S+   D   G           + G+  
Sbjct: 82  KSNPSLYQNATYNGSKITPSVDCSSMSTYNENSSSTYQDLDNGRFYIIYADETFSDGSWG 141

Query: 165 QDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLP----------ANSPGTVEPAL 214
           +++  +N ++  +   FG+A      +   PVSG+LG+             +P    P  
Sbjct: 142 KETVSVNGIDIPD-IQFGLAK-----YATTPVSGVLGIGFPRRESVKGYEGAPDKYYPNF 195

Query: 215 SVLYRSKSI-RSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPN 273
             L +S+ I     ++L+L+  +S         G    G      + GD+    +V   N
Sbjct: 196 PQLLKSEQIIDVVAYSLFLNSPDS-------GMGSIVFGAIDESKFYGDLLTFPMV---N 245

Query: 274 NYWLIAIDRIFCNSTLVTFQNPENFTGAQSRS----KRSGIIDSGSTFLVLPKVDALDIH 329
            Y  I +D     +  +     +N +G +  +    K   ++DSG++ L  PK  A  + 
Sbjct: 246 EYPTI-VDAPATLAMTIQGLGAQNKSGCERETFMTTKYPVLLDSGTSLLNAPKTIADKMA 304

Query: 330 SYLPGSIT-DGNYFAVFCNSTVD---LTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVS 385
           S++  S + D   + + C  + D    TF+ G+    +P +S +  P  EG    GYC  
Sbjct: 305 SFVNASYSADEGIYILNCPDSADDIEYTFDFGDLQINVPLTSLILSPEVEG----GYC-- 358

Query: 386 NIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNVN 427
               Q  + S +LGDVF+ + Y VFD+DN ++  A  N N +
Sbjct: 359 GFAVQPTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNAS 400

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 20/142 (14%)

Query: 300 GAQSRS----------KRSGIIDSGSTFLVLPKVDALDIHSYLPGSIT--DGNYFAVFCN 347
           GAQ++S          K   ++DSG++ L  PK  A  + S++  S +  +G Y      
Sbjct: 217 GAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPE 276

Query: 348 STVDL--TFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKN 405
           ST D+  TF+ G+    +P +S +  P  EG    GYC      Q  + S +LGDVF+ +
Sbjct: 277 STYDVEYTFDFGDLQINVPLTSLILSPETEG----GYC--GFAVQPTNDSMVLGDVFLSS 330

Query: 406 FYTVFDMDNQQVGFALKNSNVN 427
            Y VFD+DN ++  A  N N +
Sbjct: 331 AYVVFDLDNYKISLAQANWNAS 352

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 64/122 (52%), Gaps = 10/122 (8%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSIT--DGNYFAVFCNSTVDL--TFELGNKNWTIPA 365
           ++DSG++ L  PK  A  + S++  S +  +G Y      ST D+  TF+ G+    +P 
Sbjct: 27  LLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFDFGDLQINVPL 86

Query: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
           +S +  P  EG    GYC      Q  + S +LGDVF+ + Y VFD+DN ++  A  N N
Sbjct: 87  TSLILSPETEG----GYC--GFAVQPTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWN 140

Query: 426 VN 427
            +
Sbjct: 141 AS 142

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 67/125 (53%), Gaps = 12/125 (9%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPG--SITDGNYF---AVFCNSTVDLTFELGNKNWTIP 364
           ++DSG++ L  PKV A  + S++    S  +G Y      F +  ++ TF+ G+   ++P
Sbjct: 285 LLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAFADE-IEYTFDFGDLKISVP 343

Query: 365 ASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNS 424
            +S +  P  EG    GYC      Q  + S +LGDVF+ + Y VFD+DN ++  A  N 
Sbjct: 344 LTSLILSPEAEG----GYC--GFAVQPTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANW 397

Query: 425 NVNLV 429
           +V+ +
Sbjct: 398 DVSEI 402

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 94/368 (25%), Positives = 144/368 (39%), Gaps = 52/368 (14%)

Query: 88  LTRDSNSHA----------YIVNVTIS--DEEYSLILDTGSAFPWVYGDS---C-SLRAC 131
           L++ SN H           Y V + I    +  +++LDTGSA  WV G     C S+  C
Sbjct: 44  LSKRSNGHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDC 103

Query: 132 EGRKLYPTGGKQTVNG---STFRLDYPYGI-TSGAIFQDSFIINNLNTSETFAFGVATSV 187
           +   ++      T      S F   Y  G    GA  QD    N L+ S   +F VA   
Sbjct: 104 DQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSG-LSFAVANES 162

Query: 188 PQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTTL----- 242
              F      G+LG+  ++          +   +S     F L+L H  + + T      
Sbjct: 163 NSTF------GVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFL 216

Query: 243 ---NANSGLFAIGEPITELYKGDIYYSELV--VNPNNYWL-IAIDRIFCNSTLVTFQNPE 296
              + +SG    G      Y+G +Y   LV       Y   +A D       L T  +  
Sbjct: 217 NDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQT--DKR 274

Query: 297 NFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG-NYFAVFCNSTVDLT-- 353
           N T   + +K   ++DSG+T   LP      +   L  S +    Y+   C S+ + T  
Sbjct: 275 NIT--LTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSV 332

Query: 354 -FELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDM 412
            F+ G      P S +  +         G CV  I  QA +++ ILGD F++N Y V+D+
Sbjct: 333 AFDFGGFRINAPLSDFTMQ------TSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDL 386

Query: 413 DNQQVGFA 420
           DN ++  A
Sbjct: 387 DNYEISLA 394

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 92/370 (24%), Positives = 143/370 (38%), Gaps = 52/370 (14%)

Query: 86  TILTRDSNSHA----------YIVNVTIS--DEEYSLILDTGSAFPWVYGDS---C-SLR 129
           ++L++ S+ H           Y V + I    +  +++LDTGSA  WV G     C S+ 
Sbjct: 42  SVLSKRSSGHENFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVM 101

Query: 130 ACEGRKLYPTGGKQTVNG---STFRLDYPYG-ITSGAIFQDSFIINNLNTSETFAFGVAT 185
            C+   ++      T      S F   Y  G    GA  QD    NNL+ S    F VA 
Sbjct: 102 DCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLKYNNLDLSG-LPFAVAN 160

Query: 186 SVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDH---IESENTTL 242
                F      G+LG+  ++          +   +S     F L+L H   I++   +L
Sbjct: 161 ESNSTF------GVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAYSL 214

Query: 243 NAN-----SGLFAIGEPITELYKGDIYYSELV--VNPNNYWL-IAIDRIFCNSTLVTFQN 294
             N     SG    G      Y+G +Y   LV       Y   +A D       L T + 
Sbjct: 215 FLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKR 274

Query: 295 PENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG-NYFAVFCNST---V 350
               T     +K   ++DSG+T   LP      +   L  S +    Y+   C S+    
Sbjct: 275 NTTLT----TTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKT 330

Query: 351 DLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVF 410
            + F+ G      P S +  +         G C   +  QA +++ ILGD F++N Y V+
Sbjct: 331 SIAFDFGGFRINAPLSDFTMQ------TSVGTCALALIPQAGNATAILGDSFLRNAYVVY 384

Query: 411 DMDNQQVGFA 420
           D+DN ++  A
Sbjct: 385 DLDNYEISLA 394

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 97/376 (25%), Positives = 143/376 (38%), Gaps = 65/376 (17%)

Query: 87  ILTRDSNSHA----------YIVNVTISDEEYSL--ILDTGSAFPWVYGDS---C-SLRA 130
           +L + SN H           Y V + I     SL  +LDTGSA  WV       C S+  
Sbjct: 43  VLGKRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGSVMD 102

Query: 131 CEGRKLYPTGGKQTVNG---STFRLDYPYGI-TSGAIFQDSFIINNLNTSETFAFGVATS 186
           C+   ++      T      S F   Y  G    GA  QD    N L+ S   +F VA  
Sbjct: 103 CDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSG-LSFAVANE 161

Query: 187 VPQMFENYPVSGILGLPANSPGTVEPALSVLYR-------SKSIRSQKFTLYLDHIESEN 239
               F      G+LG+         PAL V Y         KS     F L+L    + +
Sbjct: 162 SNSTF------GVLGIGL-------PALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAID 208

Query: 240 TTL--------NANSGLFAIGEPITELYKGDIYYSELV--VNPNNYWL-IAIDRIFCNST 288
            T         + +SG    G      Y+G +Y   LV       Y   +A D       
Sbjct: 209 ATAYSLFLNDESQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIG 268

Query: 289 LVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG-NYFAVFCN 347
           L T ++    T     +K   ++DSG+T   LP      +   L  + +    Y+   C 
Sbjct: 269 LQTDRHNTTLTA----TKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACP 324

Query: 348 ST---VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIK 404
           S+     + F+ G  +   P S +  +     +   G CV  +  QA +++ ILGD F++
Sbjct: 325 SSDNDTSVAFDFGGFHINAPVSDFTMQ-----TSVGGTCVLAVIPQAGNATAILGDSFLR 379

Query: 405 NFYTVFDMDNQQVGFA 420
           N Y V+D+DN +V  A
Sbjct: 380 NAYVVYDLDNYEVSLA 395

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 125/309 (40%), Gaps = 68/309 (22%)

Query: 146 NGSTFRLDYPYG-ITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGI--LGL 202
           N + F + Y  G   SG    DS    N+N  E  +F VA       E     G+  +GL
Sbjct: 197 NKTEFYISYGDGSFASGYWGTDSVNFANMNL-EGVSFAVAN------ETNSTVGVFGIGL 249

Query: 203 PANSPG-TVEPALS------------VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLF 249
           P N    T +P+L+            VL    +I    ++L+L+       +L+A+SG  
Sbjct: 250 PENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLN-------SLDASSGDI 302

Query: 250 AIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENF---------TG 300
             G      YKGD+Y   L+                NS    ++NP  F         T 
Sbjct: 303 LFGAVDRSKYKGDLYTLPLL----------------NSDPTKYKNPMEFDVTLQGVGFTN 346

Query: 301 AQSRS-----KRSGIIDSGSTFLVLPKVDALDIHSYLPGSIT-DGNYFAVFCNSTVD--- 351
             S++     K   ++DSG++ + LP   A  I   L GS   D  Y+ + C S  D   
Sbjct: 347 GSSKTTFTTTKIPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQ 406

Query: 352 LTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFD 411
           L F+ G        S+YL     +G      CV  I    + +  ILGDVF+ + Y V+D
Sbjct: 407 LVFDFGGFTIKNNLSNYLLGSPDDGDD--SQCVLGILPSDVQA--ILGDVFLADAYVVYD 462

Query: 412 MDNQQVGFA 420
           +D+ +V  A
Sbjct: 463 LDDYEVSLA 471

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 68/121 (56%), Gaps = 10/121 (8%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSITDGN--YFAVFCNSTVD---LTFELGNKNWTIP 364
           ++DSGST + LP++ A  I++ + G+  DG+   + + C + V+   L F+ G  + + P
Sbjct: 270 LVDSGSTMVYLPELIATAIYNKV-GARYDGSSEMYTIDCGTNVENDNLIFDFGGFHISTP 328

Query: 365 ASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNS 424
            S+Y+     +     G C+  I  Q+  ++ +LGD F+ + Y VFD+D+ ++  A  NS
Sbjct: 329 VSNYI---ITDQRSSNGQCLFGILSQS-GNTVVLGDTFLSSAYVVFDLDHYEISMAQGNS 384

Query: 425 N 425
           N
Sbjct: 385 N 385

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 129/298 (43%), Gaps = 40/298 (13%)

Query: 144 TVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLP 203
           T  G  F +DY    + G   +D  +I N + S    FGV+        N  ++GILG+ 
Sbjct: 125 TPTGYKFFIDYVNTFSRGIWAKDRLVIGNADVSG-LQFGVSN-----ISNTTINGILGVG 178

Query: 204 ----------ANSPGTVEPALSVLYR-SKSIRSQKFTLYLDHIESENTTLNANSGLFAIG 252
                     + +P    P L +L + S  I    ++++L+H       LN+N      G
Sbjct: 179 YERLESVKGYSGAPNRTYPNLPMLLKESGKIDKVAYSVFLNH-------LNSNVSTVTFG 231

Query: 253 EPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQ---SRSKRSG 309
              +E Y GD+Y   LV   N Y  I     F + TL   +   N++      S +    
Sbjct: 232 GVDSEKYTGDLYKFPLV---NIYKSIPRPSKF-HITLQALEVHGNYSSLNKTVSNTPLPA 287

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVF-CNSTVD---LTFELGNKNWTIPA 365
           + D+G+  +V+P   A +I S +  +  +     +F C +  D   L F+ G+     P 
Sbjct: 288 LFDTGTNGMVVPPNVAENIASTIHATFDEKFSLYLFACPAEEDDTKLVFDFGDIQIEAPL 347

Query: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
           ++++    + G++  G  +   +G     ++ LG  F+++ Y V+++++ +V  A  N
Sbjct: 348 ANFIVPAAELGTEQCGVAIIPEDG-----TFTLGIPFLRSTYVVYNLEDYEVALAQAN 400

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 123/302 (40%), Gaps = 69/302 (22%)

Query: 161 GAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLP----------ANSPGTV 210
           G+   +   +N ++ S +  FG+   V       PVSG+LG+            N+P   
Sbjct: 153 GSWATEKLTMNGVDVS-SLQFGLGNCV-----TTPVSGVLGIGFPRRESVKGYDNAPNEF 206

Query: 211 EPAL-SVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIY----- 264
            P    VL     I    ++++L+ +ES+       +G    G   T  Y GD+      
Sbjct: 207 YPNFPQVLKNQGIIDVVAYSMFLNKLESD-------TGSILFGAIDTSKYTGDLVTFPML 259

Query: 265 --YSELVVNPNNYWLI-----AIDRIFCNS-TLVTFQNPENFTGAQSRSKRSGIIDSGST 316
             Y ++   P    +I     A D   C + T VT             SK   ++DSG+T
Sbjct: 260 NIYPDVTDKPATLMVILQGLGAQDNANCKAETFVT-------------SKIPVLLDSGTT 306

Query: 317 FLVLPKVDALDIHSYLPGSIT-DGNYFAVFCNST-----VDLTFELGNKNWTIPASSYLG 370
            +  PK  A  +  ++  + + D   + + C +       D  F+ G     +P S+++ 
Sbjct: 307 LMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTDYIFDFGGVQIKVPLSNFIL 366

Query: 371 EPYQEGSKYYGYCVSNIEGQAI----HSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNV 426
               EG    G C     G A+     ++ +LGD+F+ + Y VFD+DN Q+  A  N + 
Sbjct: 367 SAQSEG----GPC-----GFAVLPDDSNTMVLGDIFLSSAYVVFDLDNYQISLAAANLDN 417

Query: 427 NL 428
           N+
Sbjct: 418 NV 419

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 303 SRSKRSGIIDSGSTFLVLPKVDALDIHSYLPG--SITDGNYFAVFCNST--VDLTFELGN 358
           S +K   ++DSGST +  P   A  + +++    S +DG Y     N T  +D  F+ G+
Sbjct: 287 STTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESDGIYTLECPNDTTNIDYIFDFGD 346

Query: 359 KNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVG 418
             +T+P S+ +  P Q GS   G+ +     Q   +  +LGDVF+ +   VFD+D+ Q+ 
Sbjct: 347 MKFTLPLSNLI-LPSQGGSNVCGFGL-----QRSDNEIVLGDVFLCSTLVVFDLDHYQIS 400

Query: 419 FALKN 423
            A  N
Sbjct: 401 LAKSN 405

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 84/355 (23%), Positives = 141/355 (39%), Gaps = 72/355 (20%)

Query: 106 EEYSLILDTGSAFPWV----------------YG-----DSCSLRACEGRKLYPTGGKQT 144
           +  +++LDTGSA  WV                YG     +S +  A      Y + G  T
Sbjct: 75  QNVTVLLDTGSADLWVPSNANPYCGSAMNCDQYGVFDKANSSTFTANHSAPFYASYGDGT 134

Query: 145 VNGSTF---RLDYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILG 201
                F   +L Y  G+    +   SF + N + S     G+   +P +   Y  SG + 
Sbjct: 135 FAEGVFGQDKLHYSGGLDLSGL---SFAVANKSNSTVGVLGIG--LPMLEVTY--SGKVA 187

Query: 202 LPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFA-------IGE- 253
           +        +     L RS +I +  ++L+L+     + T  + S LF        +G+ 
Sbjct: 188 VADKRSYQYDNFPLFLKRSGAIDATAYSLFLN-----DETQTSGSVLFGAVDHSKYLGQL 242

Query: 254 ---PITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGI 310
              P+  LYK   Y   +  +     L    R   N+TL T + P              +
Sbjct: 243 YTIPLVNLYKAQGYQRPVAFDVTLQGLGLQTRAH-NTTLTTTRIP-------------AL 288

Query: 311 IDSGSTFLVLPKVDALDIHSYLPGSIT-DGNYFAVFCNSTVD----LTFELGNKNWTIPA 365
           +DSG+T   LP      +   L  + + +  Y+   C ++ D    + F+LG  +   P 
Sbjct: 289 LDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNATSVVFDLGGFHINAPL 348

Query: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           S +  +         G CV  I  QA +++ ILGD F+++ Y V+D+DN +V  A
Sbjct: 349 SDFTMQ------TNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLA 397

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 79/174 (45%), Gaps = 25/174 (14%)

Query: 254 PITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDS 313
           PI  +Y  + Y + L  +   Y L  I     N+T+ T + P              ++DS
Sbjct: 321 PIVNVYASEGYKNPLEFDVTMYGL-GISTSDSNTTIATMKIP-------------ALLDS 366

Query: 314 GSTFLVLPKVDALDIHSYLPGSITDG-NYFAVFCNSTVDLT---FELGNKNWTIPASSYL 369
           G+T +  P+     +   L  S +D   ++A+ C S+ D T   F+ G  + T+P S +L
Sbjct: 367 GTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPLSDFL 426

Query: 370 GEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
                 GS+    C+  +  Q    S ILGD F+ N Y V+D++N ++  A  N
Sbjct: 427 --IRVSGSE----CILAMAAQD-DESIILGDYFLTNAYVVYDLENYEISMAQAN 473

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 69/152 (45%), Gaps = 12/152 (7%)

Query: 290 VTFQNPENFTGAQS--RSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSIT-DGNYFAVFC 346
           V  QN  + T  ++   SK   ++DSG+T +  PK  A  +  ++  + + D   + + C
Sbjct: 277 VAAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNC 336

Query: 347 NST-----VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDV 401
            S      ++  F+ G     IP   ++  P  +GS   G C   +  +      +LGD+
Sbjct: 337 PSQEVLNDIEYIFDFGGLQVKIPLEKFI-LPSDDGS---GPCAFGVLPETTTDRMVLGDI 392

Query: 402 FIKNFYTVFDMDNQQVGFALKNSNVNLVQNSN 433
           F+   Y VFD+D+ Q+  A  N N N   N +
Sbjct: 393 FLSFVYAVFDLDHYQISLANINKNANSESNED 424

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 110/259 (42%), Gaps = 32/259 (12%)

Query: 175 TSETFAFGVATSVPQMFENYPVSGILG--LPANSPGTVEPALSVLYRSKSIRSQKFTLYL 232
           T E+F+FGVA +           GILG  LPA   G    +L   Y +     + F + L
Sbjct: 30  TLESFSFGVANNTENQ------GGILGISLPA---GENTHSLGGAYNTTPFEYENFPMAL 80

Query: 233 D---HIESENTTL-----NANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIF 284
                IE    +L      A+ G    G      Y G +Y   ++   +    ++   +F
Sbjct: 81  KSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVS-PGMF 139

Query: 285 CNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAV 344
             +  V   N ++     S+ +   + DSG+T+  LP   A  I     G  + G+    
Sbjct: 140 VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQGYT 199

Query: 345 F-CNSTVD--LTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDV 401
           F C+   D  L+ + G  N +   S+++       ++   +C+ NIE  A  S ++LGD 
Sbjct: 200 FDCSKVKDTLLSIDFGGFNISANISNFV-------TRTKDHCLLNIE--AADSGFVLGDA 250

Query: 402 FIKNFYTVFDMDNQQVGFA 420
           F+ + Y VFD+++ +V  A
Sbjct: 251 FLVDAYVVFDLESHEVSIA 269

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 96/217 (44%), Gaps = 39/217 (17%)

Query: 223 IRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV------VNPNNYW 276
           I    ++LYL+       +L+++SG    G   +  Y GD+Y   LV      VN    +
Sbjct: 213 IDKTAYSLYLN-------SLDSSSGSILFGGIDSNKYTGDLYTFPLVNIHPSVVNKPAKF 265

Query: 277 LIAIDRIFCNSTLVTFQNPENFTGAQSR----SKRSGIIDSGSTFLVLPKVDALDIHSYL 332
            + +  I   S+           G++      +K   ++DSG+T LV P+  A  + +Y+
Sbjct: 266 HVTVQGIGVQSS-----------GSEQSILMSTKYPALLDSGTTLLVAPQEFADSMANYV 314

Query: 333 PGSITD-GNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIE 388
             +  D    + + C   N   +  F+ G+    +P  +++  P  E ++Y G+ V    
Sbjct: 315 NATYNDLEGIYTMTCPPENDDTEFLFDFGDLKIKVPLKNFILAP--EDNEYCGFGV---- 368

Query: 389 GQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
                 + ILGD+F+   Y V+D+++ +V  A  N N
Sbjct: 369 -LPTVDTMILGDMFLSAAYVVYDLESYEVSLAQANWN 404

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 303 SRSKRSGIIDSGSTFLVLPKVDALDIHSYLPG--SITDGNYFAVFCNSTVDLTF--ELGN 358
           +  K   ++DSGST +  P+     I   L    S +DG Y      S  D TF  + G 
Sbjct: 289 AHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRTFYFDFGE 348

Query: 359 KNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVG 418
               +P    L  P + G  Y G  +      A    WILGD+ +K+ Y V+D+DN ++ 
Sbjct: 349 LKLKVPIHDLLYLP-ESGQNYCGLAII-----ASGEEWILGDLVLKSAYVVYDLDNLEIS 402

Query: 419 FA 420
            A
Sbjct: 403 IA 404

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLP---GSITDGNYFAVFCNSTVDLTFELGNKNWTIPAS 366
           I+D+GS+  +LP       +  L    GS T G        +  ++ FELG K + I  +
Sbjct: 156 ILDTGSSLTLLPTEIFDKFNGALEAALGSKTGGRVSCSARETAPEIVFELGGKKFAITGN 215

Query: 367 SYLGEPYQEGSKYYGYCVSNIEGQAIHSS---WILGDVFIKNFYTVFDMDNQQVGFA 420
            Y+     E       C+  I  QA  +     ILG  F++ FY+V+D+ + +VG A
Sbjct: 216 EYIMPAGSE-------CMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGLA 265

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 89/349 (25%), Positives = 143/349 (40%), Gaps = 55/349 (15%)

Query: 106 EEYSLILDTGSAFPWVYGD---------------SCSLRACEGRKLYPTGGKQTVNGSTF 150
           +  ++ +DTGS+  WV G                S  L  C     + T    T + +  
Sbjct: 103 QNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGTFNTNKSSTWSSNNS 162

Query: 151 RLDYPYGIT---SGAIFQDSFIINNLN-TSETFAFGVATSVPQMFENYPVSGIL----GL 202
           R    YG T   SG   +D   IN LN T  TFA   A++         ++ +     G 
Sbjct: 163 RFFIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQLETTYNGS 222

Query: 203 PANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGD 262
            ++   T      VL  +    S  ++L+L+ +++E       SG    G      Y G+
Sbjct: 223 NSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAE-------SGSILFGAVDHSKYSGN 275

Query: 263 IYYSELVVNPNNYWLIAIDRIFCNST--LVTFQNPENFTGAQ----SRSKRSGIIDSGST 316
           +Y   LV   N Y     DR F N     VT Q     +G++    +++K + I+DSG++
Sbjct: 276 LYTLPLV---NTYK----DRGFPNPIEFAVTLQGIGIVSGSKKTTITQTKLAAILDSGTS 328

Query: 317 FLVLPKVDALDIHSYLPGSITDG-NYFAVFC---NST-VDLTFELGNKNWTIPASSYLGE 371
             VLP      I S L G  +   + + V C   NST  +L F+ G        S+++ E
Sbjct: 329 LTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILE 388

Query: 372 PYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
              +       C+  +      +S ILGD F+ + Y V+D++N Q+  A
Sbjct: 389 IEDD------ICILGLS-SVDENSVILGDTFLASAYVVYDLENLQISMA 430

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 85/350 (24%), Positives = 140/350 (40%), Gaps = 43/350 (12%)

Query: 97  YIVNVTISD--EEYSLILDTGSAFPWVYGDSCSL-----RACEGRKLYPTGGKQTVNGST 149
           Y VN++I    +E ++++DTGS+  W+ G           + E    +  G       S+
Sbjct: 76  YSVNLSIGTPAQEVTVLVDTGSSDLWIIGADVDCGPDNSDSTEPLDCFEYGAFDKSKSSS 135

Query: 150 FRLDY-----PYGITS---GAIFQDSFIINNLNTSE-TFAFGVATSVPQMFENYPVSGIL 200
           ++ ++      YG TS   G    D   + +LN    TFA   A++         ++GI 
Sbjct: 136 WKNNHTEFYISYGDTSFASGEWGTDKLDLGDLNADGLTFAVATASNSSVAVLGIGLTGIE 195

Query: 201 GLPANSPGTVE----PALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPIT 256
              A+     E    P   VL R+  I    ++LYL+        L+A SG    G    
Sbjct: 196 VTRASGDNGYEYDNLPI--VLKRNGVIDKTAYSLYLND-------LDATSGSVLFGAVDH 246

Query: 257 ELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGST 316
             Y G +    LV     Y       +      + F + +   G  S +K   ++DSG+T
Sbjct: 247 SKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGKK-RGTISATKVPALLDSGTT 305

Query: 317 FLVLPKVDALDIHSYLPGSITDGNY--FAVFCNST----VDLTFELGNKNWTIPASSYLG 370
               P   A  I S + G++ +     F + C+      +DL +  G    T P  +YL 
Sbjct: 306 LSYFPTELAAAIASNV-GAVWNARLRKFLIPCSQAKRNNIDLIYNFGGVEITSPLVNYLS 364

Query: 371 EPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           E   E     G   ++       +  ILGDVF+ + YTV+D++  +V  A
Sbjct: 365 ETNVEDVCLLGIVPTS------SNDIILGDVFLTSVYTVYDLEALEVSIA 408

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 99/243 (40%), Gaps = 51/243 (20%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275
           +L  S +  S  ++L+LDH E+E+ T+     LF  G      Y G +Y   LV      
Sbjct: 217 ILKNSGATHSNLYSLHLDHPEAEHGTV-----LF--GAVDHSKYTGSLYTIPLV------ 263

Query: 276 WLIAIDRIFCNSTLVT--FQNPENF--------------TGAQSRSKRSGIIDSGSTFLV 319
                      +TL T  F +P  F                  + +K + ++DSG+T   
Sbjct: 264 -----------NTLKTHGFSDPAKFEVTLQGVGIVANNTQTTLTNTKIAALLDSGTTLTY 312

Query: 320 LPKVDALDIHSYLPGSITDG-NYFAVFC----NSTVDLTFELGNKNWTIPASSYLGEPYQ 374
           LP+     I   +    +    Y+ V C    NS   L F+ G  +     + ++ E + 
Sbjct: 313 LPQALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTLVFDFGGFHINGKLTDFIVETFG 372

Query: 375 EGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQNSNI 434
                   C+  I  +   +S ILGD F+ N Y VFD++N ++  A    NV+  Q+  I
Sbjct: 373 N------VCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEISMAQALHNVDDDQDIEI 426

Query: 435 STN 437
            T+
Sbjct: 427 VTS 429

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 67/141 (47%), Gaps = 12/141 (8%)

Query: 283 IFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYF 342
           +F  +  V   N ++     S+ +   + DSG+T+  LP   A  I     G  + G+  
Sbjct: 61  MFVTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQG 120

Query: 343 AVF-CNSTVD--LTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILG 399
             F C+   D  L+ + G  N +   S+++       ++   +C+ NIE  A  S ++LG
Sbjct: 121 YTFDCSKVKDTLLSIDFGGFNISANISNFV-------TRTKDHCLLNIE--AADSGFVLG 171

Query: 400 DVFIKNFYTVFDMDNQQVGFA 420
           D F+ + Y VFD+++ +V  A
Sbjct: 172 DAFLVDAYVVFDLESHEVSIA 192

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 123/297 (41%), Gaps = 58/297 (19%)

Query: 165 QDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLP----------ANSPGTVEPAL 214
           ++   +N ++ S T  FGVA      +   PV G+LG+            ++P    P  
Sbjct: 162 KEKLRLNGIDIS-TLQFGVAD-----YATVPVGGVLGIGFPRRESVKGYDDAPNEFYPNF 215

Query: 215 -SVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPN 273
             VL     I    ++++L+ + S+     A S LF   +P    Y G +Y   +V    
Sbjct: 216 PQVLKNEGVIGVAAYSMFLNEVSSD-----AGSILFGAVDPTK--YTGSLYTFPMV---- 264

Query: 274 NYWLIAIDRIFCNSTL-VTFQNPENFTGAQSRS----------KRSGIIDSGSTFLVLPK 322
           N +   +D+    +TL +T Q      GA+S S          K++ ++DSG+T +  P 
Sbjct: 265 NEYPNVVDK---PATLAMTLQA----LGAKSDSSCKYKTFTTTKQAVLLDSGTTLMTAPP 317

Query: 323 --VDALDIHSYLPGSITDGNYFAVFCNSTVDLT---FELGNKNWTIPASSYLGEPYQEGS 377
              + +    + P        F   C S  D T   F+ G+   T+P +S +     +G 
Sbjct: 318 EIAEEMAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDFGDLKITLPLASLVISSSGDGH 377

Query: 378 KYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQNSNI 434
             +G   ++        S  LG +F+ + Y V+D+DN Q+  A    + N  Q S +
Sbjct: 378 CGFGLTPASY-------SMTLGAIFLSSAYVVYDLDNYQISIAQAKWDGNPSQKSRV 427

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 101/237 (42%), Gaps = 44/237 (18%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV------ 269
           +L +S +I S  ++L+LD        L+A  G    G      Y G++Y   +V      
Sbjct: 289 LLKQSGAIDSTSYSLFLDD-------LDAKQGSVLFGAVDHTKYVGNLYTVPMVNILASK 341

Query: 270 --VNPNNYWLIAIDRIFCNSTLVTFQN-PENFTGAQSRSKRSGIIDSGSTFLVLPKVDAL 326
              NP     I  D        +  QN  +N+T   + +K   ++DSG+T    P+    
Sbjct: 342 GYPNP-----IQFDVTLAG---IGIQNDSKNYT--VTTNKFPALLDSGTTISYFPQEVVQ 391

Query: 327 DIHSYLPGSITDG-NYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGY 382
            I   L    +    ++A+ CN   S+ +  F+ G  + T P S +L  P    +     
Sbjct: 392 TIARQLGARYSSALGFYAMSCNGVSSSTNFVFDFGGFHITGPVSDFL-LPTSGNT----- 445

Query: 383 CVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN-------SNVNLVQNS 432
           CV  +  Q      +LGD+F+ + Y V+D+DN ++  A  N       SN+ ++ +S
Sbjct: 446 CVLAMAPQE-SQHILLGDIFLTHAYVVYDLDNYEISLAQANTGTQNLDSNIQIISDS 501

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (48%), Gaps = 11/119 (9%)

Query: 309 GIIDSGSTFLVLPKVDALDIHSYLPGSITDG---NYFAVFCNSTVD-LTFELGNKNWTIP 364
           G++DSG+T + LP+  A  + +   GS  D      + + C S  + + F  G  N    
Sbjct: 355 GLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPSDDEKIVFNFGGFNIETS 414

Query: 365 ASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
            S+Y+ +         G C+ NI   + +   ILGD F+++ Y V+DMDN ++  A  N
Sbjct: 415 LSNYITD------NGNGQCILNISPTSDYMG-ILGDSFLRDSYVVYDMDNNEISLAQAN 466

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 92/385 (23%), Positives = 145/385 (37%), Gaps = 71/385 (18%)

Query: 91  DSNSHAYIVNVT-ISDEEYS-------------LILDTGSAFPWVYGDS---CSLRACEG 133
           D NS   ++++  +SDE YS             L++D+GSA  WV   +   CS  A  G
Sbjct: 29  DGNSGTLMLSLKHVSDEFYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSG 88

Query: 134 -RKLYPTGGKQTVNGSTFRLDYPYGITSGAIFQD----SFIINNLN---------TSETF 179
             K Y   GK        +      + S + F+D     F IN  +         T E  
Sbjct: 89  ASKNYTYNGKAITETIDCQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVS 148

Query: 180 AFGVATSVPQ----MFENYPVSGILGL--PANSPGTVEPAL---------SVLYRSKSIR 224
           A G   S  Q     + +  + GILGL  P        P            +L +   I 
Sbjct: 149 AAGAHISGLQFGVAQYASEEIPGILGLGFPRRESVRGYPGAPNKFYDNFPQMLKKDGIID 208

Query: 225 SQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIF 284
              +++YL+            S LF   +P    Y GD+Y   +    N Y  I      
Sbjct: 209 VVAYSMYLNDPNGSG----GGSVLFGGVDP--SKYSGDLYTFPMA---NQYPNIVSKPAT 259

Query: 285 CNSTLVTFQNPENFTGAQSR---SKRSGIIDSGSTFLVLPKVDALDIHSYLPGSI---TD 338
              TL  F   +   G Q     +  + ++DSG++ +  P+     +  ++  +     D
Sbjct: 260 LAVTLQGFGAQKKSEGRQETFDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSED 319

Query: 339 GNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSS 395
              + + C   +   +  F+ G+    +P S+ +  P   G  Y G  V   +G     +
Sbjct: 320 DGIYVMDCPPKDDDTEFVFDFGDLQIAVPVSTLILPP--SGESYCGLGVLPKDG-----T 372

Query: 396 WILGDVFIKNFYTVFDMDNQQVGFA 420
           W LGDVF+   Y VFD+DN +V  A
Sbjct: 373 WTLGDVFLSYAYLVFDLDNYKVSMA 397

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 110/273 (40%), Gaps = 47/273 (17%)

Query: 167 SFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQ 226
           SF + N   S     G+   +P +   Y  SG   +    P   +    VL R+ +I+S 
Sbjct: 245 SFAVANRTNSTVGVLGIG--LPALEVTY--SGRTAVSGQRPYQYDNFPLVLLRNGAIKSN 300

Query: 227 KFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV--------VNPNNYWL- 277
            ++L+L++  +E       +G    G      Y GD+Y   +V         NP  + + 
Sbjct: 301 SYSLFLNNASAE-------TGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVT 353

Query: 278 ---IAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPG 334
              + I     N+T+ T + P              ++DSG+T   LP+     I   L  
Sbjct: 354 LNGLGISSSSDNTTITTTKIP-------------ALLDSGTTLTYLPQALVTRIVQKLQA 400

Query: 335 SITD-GNYFAVFCNSTVDLT---FELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQ 390
           + ++   Y+   C S  D T   F+ G  +   P ++++     +       C+  I  Q
Sbjct: 401 TYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAPITNFIIGSSGDS------CILGIMPQ 454

Query: 391 AIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
           +     ILGD F+ + Y V+D++N ++  A  N
Sbjct: 455 S-GGGIILGDSFLNSAYVVYDLENYEISMAQAN 486

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 116/275 (42%), Gaps = 29/275 (10%)

Query: 167 SFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQ 226
           SF + N   S     G+   +P++   Y  SG     +  P T +    VL  S +I++ 
Sbjct: 237 SFAVANETNSTMGVLGIG--LPELEVTY--SGSTASSSRRPYTYDNFPMVLKNSGAIKTN 292

Query: 227 KFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCN 286
            ++LYL+  ++++ T+     LF  G      Y G +Y   +V   +     +  +    
Sbjct: 293 AYSLYLNDSDAKHGTI-----LF--GAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVT 345

Query: 287 STLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG-NYFAVF 345
              +    P+N     + ++   ++DSG+T   LP+     I   L    +    Y+ + 
Sbjct: 346 INGIGISYPDNSQKTLTTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLD 405

Query: 346 CNS---TVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVF 402
           C S   +  + F+ G  +     SS++      G+     C+  I   A   + ILGD F
Sbjct: 406 CPSNSNSTQIVFDFGGFHINASLSSFI---LNAGN----ICLLGI--IATDDTTILGDSF 456

Query: 403 IKNFYTVFDMDNQQVGFA-----LKNSNVNLVQNS 432
           + N Y V+D+DN ++  A     + N N+ ++ +S
Sbjct: 457 LTNAYVVYDLDNLEISMAQAQYNITNENIEVITSS 491

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 84/187 (44%), Gaps = 30/187 (16%)

Query: 262 DIYYSELVVNPNNY----WLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTF 317
           DIY+      P  +    + + +D+    ST+ T   P              ++DSG+T 
Sbjct: 310 DIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIP-------------ALLDSGTTI 356

Query: 318 LVLPKVDALDIHSYLPGSI-TDGNYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPY 373
              P   A +I      +  +   ++ + C+   S  +L F+ G  + T P   ++    
Sbjct: 357 SYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV---V 413

Query: 374 QEGSKYYGYCVSNIEGQAIHSSWI-LGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQNS 432
           Q+ S+    CV  I  Q    +W+ LGDVF+ N Y V+D++N +V  A  N + +L ++ 
Sbjct: 414 QQSSQT---CVLAIGPQ--QENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESV 468

Query: 433 NISTNTL 439
            + ++T+
Sbjct: 469 EVISSTV 475

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 105/252 (41%), Gaps = 42/252 (16%)

Query: 173 LNTSETFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLY- 231
           L +S        T+    ++N+PV         + G +E     L+ + S  ++   L+ 
Sbjct: 221 LESSNAGRLAAETNSSYEYDNFPVQ------LKNKGVIEKIAYSLFLNDSDATEGSVLFG 274

Query: 232 -LDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLV 290
            +DH + EN       GLF +  P+   YK      + V +P  +++      F     +
Sbjct: 275 AVDHSKYEN-------GLFTV--PMVNTYK-----DQGVQHPIEFYVTMYGLGFKKDGFL 320

Query: 291 TFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG-NYFAVFCNST 349
                 NF           ++DSGST   LP      + S L  + ++  N + + C S 
Sbjct: 321 NTITTTNF---------PVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSE 371

Query: 350 VD---LTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAI-HSSWILGDVFIKN 405
            D   L+F+LG     +P S  + +      ++   CV  ++GQ      +ILGD F+ +
Sbjct: 372 EDATFLSFDLGGFLIDVPLSDLVAK------RHKNQCVLMVKGQGEGEGGYILGDTFLSS 425

Query: 406 FYTVFDMDNQQV 417
            Y V+D+++ ++
Sbjct: 426 AYVVYDLESYEI 437

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 14/125 (11%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVF---CNSTVD---LTFELGNKNWTI 363
           ++DSGST  +LP+ D  D+ +       DG    +    C S  D   L F      +++
Sbjct: 301 LLDSGSTISLLPR-DVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSGAEFSV 359

Query: 364 PASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
             + ++        K+ G C          +  +LGD F+ N YTVF++D++++  A  N
Sbjct: 360 NVTDFM-------EKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQAN 412

Query: 424 SNVNL 428
            N +L
Sbjct: 413 YNSSL 417

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 93/214 (43%), Gaps = 29/214 (13%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275
           VL  S +I++  ++LYL+  ++E+ T+     LF  G      Y G +Y   +V   +  
Sbjct: 285 VLKNSGAIKTNAYSLYLNDSDAEHGTI-----LF--GAVDHSKYTGTLYTIPIVNTLSAS 337

Query: 276 WLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI------- 328
              +  +       +   + +N     + +K   ++DSG+T   LP+     I       
Sbjct: 338 GFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQ 397

Query: 329 HSYLPGSITDGNYFAVFCNS--TVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSN 386
           +SY  G      Y+ + C S  +  + F+ G  +     SS++      GS     C+  
Sbjct: 398 YSYRLG------YYVLDCPSDDSTQIVFDFGGFHINASLSSFI---LSTGST----CLLG 444

Query: 387 IEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           I   + ++  ILGD F+ N Y V+D+DN ++  A
Sbjct: 445 IIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMA 478

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 114/271 (42%), Gaps = 44/271 (16%)

Query: 168 FIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANS-PGTVEPAL-----SVLYRSK 221
           F + N++ S+    GV              G+ GL +++ P   EP+       VL ++ 
Sbjct: 198 FAVANMSDSDVGVLGV--------------GLTGLESSADPFDDEPSQYPNFPVVLKQNN 243

Query: 222 SIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAID 281
            I    ++LY++ +++E     A S LF  G      Y G +Y   LV     Y++  I 
Sbjct: 244 VISKMAYSLYINSLDAE-----AGSVLF--GAVDHSKYTGGLYTIPLVNALAQYFVDEIL 296

Query: 282 RIFCNSTLVTFQNPEN-FTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGN 340
                   +  ++ +N F    + ++   ++DSG+T + +    A  I   L  +++D  
Sbjct: 297 EFDVTVQGLGIESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDY 356

Query: 341 YFAVF-CNSTVD---LTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSW 396
               F C +  D   L F+ G    T P S+Y+ E   E           + G  +  S+
Sbjct: 357 ELYTFECPAKDDDTQLVFDFGGFQITNPLSNYVLETDDE----------KVCGLGVVPSY 406

Query: 397 --ILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
             ILGD F+ + Y VFD++N ++     N N
Sbjct: 407 SNILGDEFLASAYVVFDLENLELSIGQANLN 437

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 91/216 (42%), Gaps = 33/216 (15%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTL--------NANSGLFAIGEPITELYKGDIYYSE 267
           VL  S +I+S  ++LYL+  ++ + T+             L+ I  PI        + S 
Sbjct: 282 VLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTI--PIVNTLSASGFSSP 339

Query: 268 LVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALD 327
           +  +     +   D    N TL T + P              ++DSG+T   LP+     
Sbjct: 340 IQFDVTINGIGISDSGSSNKTLTTTKIP-------------ALLDSGTTLTYLPQTVVSM 386

Query: 328 IHSYLPGSITDG-NYFAVFCNS--TVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCV 384
           I + L    +    Y+ + C S  ++++ F+ G  +   P SS++      G+     C+
Sbjct: 387 IATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPLSSFI---LSTGTT----CL 439

Query: 385 SNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
             I   +  +  ILGD F+ N Y V+D++N ++  A
Sbjct: 440 LGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMA 475

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (46%), Gaps = 25/146 (17%)

Query: 305 SKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAV-------FCNSTVD---LTF 354
           SK   ++D+GST   LP    +D+++ L  S T+G Y           C S  D   L F
Sbjct: 306 SKFPALLDTGSTDTHLP----VDVYNALAES-TNGTYDQTQNKIRIPKCLSKKDKTILNF 360

Query: 355 ELGNKNWTIPASSYLGEPYQEG-SKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMD 413
            LG  N        +G PY+E   K  G C  N+       + ILGD  I+  Y VFD++
Sbjct: 361 SLGGVN--------IGVPYKEMVKKIKGKCYINVAPTGSDFA-ILGDDVIRYAYMVFDLE 411

Query: 414 NQQVGFALKNSNVNLVQNSNISTNTL 439
           ++++  A  + N  L ++  +  +T+
Sbjct: 412 DREISLAQASFNDTLPEDIEVVVSTI 437

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 89/225 (39%), Gaps = 39/225 (17%)

Query: 212 PALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVN 271
           PAL  L     I    ++L+LD +++E+       G    G      Y G++Y   LV  
Sbjct: 271 PAL--LVDQGKIHQNAYSLFLDDLDAEH-------GSVLFGAVDHSKYTGNLYTVPLV-- 319

Query: 272 PNNYWLIAI-DRIFCNSTLVTFQNPENFTGAQ-SRSKRSGIIDSGSTFLVLPKVDALDIH 329
            N Y      D I  + TL       N T    + +    ++DSG+T   LP      I 
Sbjct: 320 -NIYKSSGFPDPIQLDVTLQGLGMSANKTNITFTTTPIPALLDSGTTLTYLPSSMVQSIA 378

Query: 330 SYLPGSIT-DGNYFAVFCNSTVD---LTFELGN-------KNWTIPASSYLGEPYQEGSK 378
             L    + D  Y+ + C+   D   L F+ G        +N+ I ASS           
Sbjct: 379 RRLSAQYSYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQNFLIKASS----------- 427

Query: 379 YYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
              +C   +  Q+  S  ILGD F+   Y V+D++N +V  A  N
Sbjct: 428 --NFCALGLVPQS-SSRAILGDNFLTAAYVVYDLENLEVSMAQAN 469

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 61/129 (47%), Gaps = 15/129 (11%)

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLT--------FELG 357
           K S ++DSG++ L  P      I   L  +  +  +  +  + T DLT        F+  
Sbjct: 263 KYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSET-DLTLYKDMIINFKFM 321

Query: 358 NKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQV 417
           + N  I    ++  PY +      Y  + +  + +++ ++LGD+F+ + YT+F++DN  +
Sbjct: 322 DFNVPINMLEFI-LPYDDS-----YVFAILPTKNVNTGFVLGDIFLPHVYTIFNLDNYTI 375

Query: 418 GFALKNSNV 426
              L N N+
Sbjct: 376 SLGLSNQNI 384

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 85/377 (22%), Positives = 156/377 (41%), Gaps = 70/377 (18%)

Query: 88  LTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWVYGDS---CSLRACEGRKLYPTGGKQT 144
           LT   + ++  V +    ++ +++LDTGS+  WV       C   + EG  LY    + T
Sbjct: 71  LTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGTTSTEG-SLYGGETQDT 129

Query: 145 VNGSTFRLDYPYGITSGAIFQDS---FIINNLNTSETFAFGV-ATSVPQMFENYPVS--- 197
           ++ ST+     +  +  + FQ +   F+I+  + S  FA G   T V ++ ++  ++   
Sbjct: 130 IDCSTYG---TFDSSKSSTFQSNDTDFLISYGDGS--FAEGTWGTDVIKLDDSLSLNDVS 184

Query: 198 -----------GILGLPA-------NSPGTVEPALSVLY--------RSKSIRSQKFTLY 231
                      G+LG+         +S  +V    S +Y        +S  I S  ++LY
Sbjct: 185 VAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYMYDNFPISLKKSGLIESTAYSLY 244

Query: 232 LDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWL-IAIDRIFCNSTLV 290
           L+   S+       SG    G      Y G +Y   ++ +  +Y   +  D       ++
Sbjct: 245 LNDPSSK-------SGNILFGGVDHSKYTGQLYTVPMLSSTTSYKTPVEFDVTLNGIGII 297

Query: 291 -TFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGN--YFAVFCN 347
            +  N +  T  Q      G++DSG+TF  LP      I   L G+  D N  Y+ + C+
Sbjct: 298 DSSGNKKTLTATQFY----GLLDSGTTFSYLPSALVAMIGEEL-GASYDSNIGYYTIDCS 352

Query: 348 ST----VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFI 403
           +       + F++G  +     S ++ +           C+ +I  Q      +LGD F+
Sbjct: 353 AEDSDDTKIVFDMGGFHINTTLSDFVIQISTS------TCILSIVPQ--DGKVVLGDSFL 404

Query: 404 KNFYTVFDMDNQQVGFA 420
            N Y V+D+DN ++  A
Sbjct: 405 NNAYIVYDLDNYEIAMA 421

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 103/238 (43%), Gaps = 44/238 (18%)

Query: 216 VLYRSKS-IRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIY----YS---- 266
           VL +S+  ++   ++L+LD  +S       +SG F +G      Y G +Y    YS    
Sbjct: 257 VLLKSQGYVKKVVYSLFLDAQDS-------SSGSFLLGAVDHSKYSGGLYTLPMYSGTDG 309

Query: 267 --ELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVD 324
              L   P+ +       I     L      EN T A +RS     +DSGST  V P   
Sbjct: 310 DDTLSSTPSRF-------IITLQGLGISDKGENKTVATTRSLV--YLDSGSTGTVFPSEY 360

Query: 325 ALDIHSYLPGSITDGNY--FAVFCNSTVDLT---FELGNKNWTIPASSYLGEPYQEGSKY 379
           A  I   L G+   G+Y  + + C S  D T   ++ G    + P S+Y+     E +  
Sbjct: 361 AELIADSL-GASYSGDYEAYVMKCPSKDDDTNFVYDFGGFTISSPLSNYM-----EATGD 414

Query: 380 YGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN-----SNVNLVQNS 432
              CV +I+   I    +LGD F+ + Y V+D+++ ++  A  N      N+ +V +S
Sbjct: 415 DSVCVLDIDTDDI-PYIVLGDAFLVSAYVVYDLEDYEISIAQANYDGGSENIEVVSDS 471

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 88/384 (22%), Positives = 163/384 (42%), Gaps = 63/384 (16%)

Query: 88  LTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWVYGDS---CSL-----RACEGRKLY-- 137
           +   SN ++  +++  + +  +++LDTGS+  WV G +   CS       A +  K    
Sbjct: 102 IMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPLCSRGDSNSDAVDCAKFGTF 161

Query: 138 --PTGGKQTVNGSTFRLDYP-YGITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENY 194
              T    + N ++F + Y      SG   QD+  + +L+ +   +F VA      + N 
Sbjct: 162 NPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVT-GLSFAVAN-----YTNS 215

Query: 195 PVSGILG--LPA---------NSPGT---VEPALSVLYRSKSIRSQKFTLYLDHIESENT 240
            V G+LG  LP+         N  GT    E    +L  S + ++  ++LYL+ ++S   
Sbjct: 216 TV-GVLGIGLPSLEVTYSGSNNVAGTRYQYENFPLLLKNSGATKANAYSLYLNDLDSR-- 272

Query: 241 TLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDR-IFCNSTL--VTFQNPEN 297
                +G    G      Y G +Y   LV   N        + +  + TL  +   + E+
Sbjct: 273 -----TGSVLFGGVDHNKYSGTLYTIPLV---NTLRAAGFSQPVEFDVTLQGMGISDDEH 324

Query: 298 FTGAQSRSKRSGIIDSGSTFLVLPK-VDALDIHSYLPGSITDGNYFAVFC---NSTVDLT 353
                + +K   ++DSG+T + LP  + +L    Y     +   Y+ + C   +    + 
Sbjct: 325 GNVTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNCPDSDEDSQIV 384

Query: 354 FELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMD 413
           F+ G  + +   ++Y+ +         G CV  I  Q+   + ILGD F+++ Y V+D+D
Sbjct: 385 FDFGGFHISTNLTTYIIQAVG------GICVLGILPQS-SGTAILGDSFLQHAYVVYDLD 437

Query: 414 N-----QQVGFALKNSNVNLVQNS 432
           N      Q  F   + NV ++ +S
Sbjct: 438 NLEISMAQASFETDDENVEVISSS 461

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 107/239 (44%), Gaps = 42/239 (17%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV-VNPNN 274
           VL +S +I +  ++L+LD ++  +       G    G      Y G +Y   ++ +  N+
Sbjct: 340 VLKQSGAIHTTTYSLFLDDLDESH-------GSVLFGAIDHSKYTGQLYTVPMINIMRNS 392

Query: 275 YWLIAIDRIFCNSTL--VTFQNPE-NFTGAQSRSKRSGIIDSGSTFLVLP----KVDALD 327
            +    + I  + TL  +  QN E N T   + +K + ++DSG+T    P    ++ A  
Sbjct: 393 GY---SNPIQFDVTLFGIGLQNGERNLT--LTTTKLAALLDSGTTISYFPTSVVELVARQ 447

Query: 328 IHSYLPGSITDGNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCV 384
           I++     +    ++ V C   +S  +L F+ G  + + P   +L +  Q+       C+
Sbjct: 448 INAQYSARL---GFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQ------TCI 498

Query: 385 SNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN---------SNVNLVQNSNI 434
             +  Q      ILGD+F+ + Y V+D+DN  +  A  +         S++ L+ NS I
Sbjct: 499 LAMAPQE-SQHVILGDIFLTHAYVVYDLDNYVIALAQADTSTSNQSSSSDIELITNSTI 556

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 378 KYYGYCVSNIE--GQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
           K  G C   I    +   +  +LGD+F+++ Y+VF+M++ +V FA+ N N
Sbjct: 372 KRKGKCYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDMEVSFAVANGN 421

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 16/131 (12%)

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVF---CNS---TVDLTFELGNK 359
           K   + DSG+++  +P   A  I S + G+I D    A+    C S   T ++ F     
Sbjct: 295 KLPALFDSGTSYSYVPYTMAQVIASQVNGTI-DNKTEAIRLPKCPSKKDTREVVFNFNGV 353

Query: 360 NWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSS--WILGDVFIKNFYTVFDMDNQQV 417
              IP    L + YQ+ S   G C  ++     ++    +LGD F++  YTVFD++ Q++
Sbjct: 354 EIAIP----LKQFYQKKS---GKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQEL 406

Query: 418 GFALKNSNVNL 428
             A  N N +L
Sbjct: 407 SIARANFNSSL 417

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 12/114 (10%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVD---LTFELGNKNWTIPAS 366
           ++DSG+TF  LP   A  I     G  +  +   +F  S V+   L+ + G  N +   S
Sbjct: 322 MLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKVNDTLLSVDFGGFNISANIS 381

Query: 367 SYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           +++             CV N++     S+++LGD F+ + Y V+D++N ++  A
Sbjct: 382 NFVTSAKDR-------CVLNVKQS--ESTYMLGDAFLVDAYVVYDLENYEISIA 426

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 110/283 (38%), Gaps = 39/283 (13%)

Query: 154 YPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANSPG----T 209
           Y Y   SG  +QD+  + ++   E F FGVA        +  + G+ G    + G    T
Sbjct: 192 YDYTFASGTWYQDTIEVGSI-IIEKFNFGVAQETNATIGSLGL-GLEGNEITNEGDYTYT 249

Query: 210 VEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV 269
            E   + L  S  I+   +++Y   I++E+ +L     LF   E     Y GD  Y+  +
Sbjct: 250 YENFPTKLKNSGMIKRVIYSIYAGKIDTEDGSL-----LFGAVEH--SRYVGDTLYTLPL 302

Query: 270 VNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLP-------- 321
           VN NN     ++       LV   N  N T    R   + ++++G+    LP        
Sbjct: 303 VNVNNASSDPVEFHVTLQNLVVSVNKTNTTIMSDR--YAALLNTGAIVTYLPTHLFSDFI 360

Query: 322 -KVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNKNWTIPASSYLGEPYQE---GS 377
            K    +   Y    +TD       C+S +  +++ G        + YL E  +    G+
Sbjct: 361 KKTGLSESQKYYGMYVTD-------CSSEISFSYDFGGFKIESSLNDYLFEIDESEIPGA 413

Query: 378 KYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           K    C   I         +LG  F  + Y VFD++  +V  A
Sbjct: 414 K----CAVTINSHD-EKYLVLGSGFFSSAYVVFDLERLEVSIA 451

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 97/218 (44%), Gaps = 25/218 (11%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275
           VL  S +I+S  ++LYL+  ++++ T+     LF  G      Y G +Y   LV   + +
Sbjct: 278 VLKNSGAIKSNAYSLYLNDSDAKHGTI-----LF--GGVDHNKYSGTLYTVALVNTLSGF 330

Query: 276 WLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLP----KVDALDIHSY 331
                  I  N   +   N +  T   + +K   ++DSG+T   LP    ++ A ++ + 
Sbjct: 331 TSPIQFDITLNGLGIIDDNGDEKT--LTTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQ 388

Query: 332 LPGSITDGNYFAVFC---NSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIE 388
               I    Y+ + C   +++ ++ F+ G  +     SS++       S     C+  I 
Sbjct: 389 YSSRI---GYYVMECPSSDNSTEIVFDFGGFHINASLSSFIL------STSGNTCLLGII 439

Query: 389 GQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNV 426
             +  +  ILGD F+ N Y V+D++N ++  A    NV
Sbjct: 440 PTSDSTGSILGDSFLTNAYVVYDLENLEISMAQAKYNV 477

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVF--CNSTVD---LTFELGNKN 360
           K + ++D+G T  VLP   A  + S + G+I D N F     C +  +   + F  G   
Sbjct: 300 KLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEKRTVVFNFGGAE 359

Query: 361 WTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
            +I              K  G C   ++ +       LGD+F+++ Y V++++++++  A
Sbjct: 360 ISIDIRDLT-------RKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIA 412

Query: 421 LKNSNVN 427
             N+N N
Sbjct: 413 --NANFN 417

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 7/90 (7%)

Query: 351 DLTFELGNKNWTIPASSYLGEPYQEGSKY-------YGYCVSNIEGQAIHSSWILGDVFI 403
           +L FE GN N ++P   +LG  Y   S            C   +      S  +LG  FI
Sbjct: 342 NLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEACYLKMYPNYATSFSVLGQSFI 401

Query: 404 KNFYTVFDMDNQQVGFALKNSNVNLVQNSN 433
           KN Y V D+DN  +  A   S+  + + +N
Sbjct: 402 KNAYIVHDVDNSNIALAQAASDEAVEKAAN 431

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVD---LTFELGNKNWTIPAS 366
           + DSG++   LP   A  I     G  +  N   +F  S V+   L+ + G  N +   S
Sbjct: 119 LFDSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDCSKVNNTLLSIDFGGFNISANIS 178

Query: 367 SYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           + +    ++      +C+ NIE  A  S ++LGD F+ + Y VFD+++ +V  A
Sbjct: 179 NSVTPITKD------HCLLNIE--ADDSGYVLGDAFLIDTYVVFDLESHEVSVA 224

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 95/405 (23%), Positives = 160/405 (39%), Gaps = 63/405 (15%)

Query: 55  EFSFGDDSADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDT 114
           E  FGD+ A A K     +           IT LT   +  +  ++V    +  ++++DT
Sbjct: 27  EKKFGDNYAGATKWQRPQMRLAKRNTGYEEIT-LTNQQSFFSVELDVGTPAQNVTVLVDT 85

Query: 115 GSAFPWVYGDS---CSLRACEGRKLYPTGGKQTVNGS---TFRLDY-----------PYG 157
           GS+  W+ G     C   +  G    P   +  V+ S   TF L+            P+ 
Sbjct: 86  GSSDLWITGADNPYCLTYSGSGADSIPR--RDRVDCSEYGTFSLEDSSTWSQNSSAPPFY 143

Query: 158 IT-------SGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPA------ 204
           IT       SG   QD   + ++N +   +F VA    +      V GI GLP       
Sbjct: 144 ITYGDTTFASGVWGQDHLHLQDVNVTG-VSFAVAN---RTNSTVGVMGI-GLPGLETTNS 198

Query: 205 -NSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDI 263
            + P T      VL  S + +S  ++LYL+ +E E        G    G      Y G +
Sbjct: 199 GSRPYTYANFPQVLKNSGATQSALYSLYLNDLEEER-------GSILFGAVDHSKYTGSM 251

Query: 264 YYSELVVNPNNYWL---IAIDRIFCNSTLVTFQ-NPENFTGAQSRSKRSGIIDSGSTFLV 319
           Y   ++    +Y     I  D       L + + N +  T   + +K   ++DSG+T   
Sbjct: 252 YTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVT--ITSTKMPALLDSGTTMTY 309

Query: 320 LPKVDALDIHSYLPGSITD--GNYFAVFCN--STVDLTFELGNKNWTIPASSYLGEPYQE 375
           LP      I   L  S++   G Y     N    + L ++ G  +     ++Y+ +  Q 
Sbjct: 310 LPSNIVSQIAQQLGASMSARFGQYVLPCSNVPENMHLVYDFGGFHINSNLTNYIVQASQT 369

Query: 376 GSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
                  C+  +  +  +++ ILGD F+ + Y V+D++N Q+G A
Sbjct: 370 ------LCILGLFPRDSNTA-ILGDTFLTDAYVVYDLENLQIGLA 407

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 90/224 (40%), Gaps = 37/224 (16%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275
           VL  + +I    ++LYL+       +L+A SG    G      Y G +Y   LV    +Y
Sbjct: 251 VLKENGAIDKIAYSLYLN-------SLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTYKDY 303

Query: 276 WL-------IAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI 328
            +       + +  I   S     Q  E FT     +K + ++DSG+T +         I
Sbjct: 304 GVKTPVQFDVTVQGIGIESEKACRQ--ETFT----TTKIAALMDSGTTLMYTAPEIVNKI 357

Query: 329 HSYLPGSITDG-NYFAVFCNSTVDLT---FELGNKNWTIPASSYLGEPYQEGSKYYGYCV 384
             Y+  S + G   F   C S  D T   F+ G      P S+Y+     E         
Sbjct: 358 ALYVNASFSPGYGLFMFRCPSDGDDTQFIFDFGGFQIKSPLSNYILRTDDE--------- 408

Query: 385 SNIEGQAIHSS---WILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
            NI G  + SS    I GD F+ + Y V+D++N ++  A  N N
Sbjct: 409 -NICGLGLISSNQGTIFGDEFLASAYVVYDLENLELSLAQANWN 451

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 55/118 (46%), Gaps = 11/118 (9%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSITDG-NYFAVFCNSTVD---LTFELGNKNWTIPA 365
           ++DSG+T + LP      +   L      G  Y+   C S VD   L F  G  N     
Sbjct: 335 LLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDC-SRVDNTNLYFNFGGFNIVSNM 393

Query: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
           S+Y+     E S     CV  ++     ++ ILGD+F+++ Y VFD+D+ ++  A  N
Sbjct: 394 STYVVSRSNENS-----CVLGLQPGGPEAA-ILGDMFMQHAYIVFDLDDFEISMAQAN 445

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 120/302 (39%), Gaps = 48/302 (15%)

Query: 146 NGSTFRLDYPYG-ITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGI--LGL 202
           N STF L Y  G    G    D   ++ LN S+  +F VA       E+    G+  +GL
Sbjct: 148 NDSTFYLTYGDGSFAKGLWGMDHVYLDGLNVSDV-SFAVAN------ESNSTVGVFGVGL 200

Query: 203 PANSPGTVEPALS-----------VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAI 251
           P     TV P ++           VL  +  ++   ++LYL+  +S       NSG    
Sbjct: 201 PGEE-ATVTPGVNGNHYQYKNFPQVLKDNGVVQKNAYSLYLNSPDS-------NSGNILF 252

Query: 252 GEPITELYKGDIYYSELVVNPNNYWLIAI-DRIFCNSTLVTFQNPENFTGAQSRSKRSGI 310
           G      Y G++Y   +V   N Y    +  R F  +         +     S  K   +
Sbjct: 253 GAVDHSKYSGNLYTLPIV---NTYADQGVAPREFDVTVQGITVGNSSSNSTVSSDKTLAL 309

Query: 311 IDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFC----NSTVDLTFELGNKNWTIPAS 366
           +DSG+T + LP   A ++   L G  +    + +      N    +TF+ G  +     S
Sbjct: 310 LDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSENDDTKITFDFGGFHIETKLS 369

Query: 367 SYLGEPYQEGSKYYGYCVSNI---EGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
           +Y+     +GS      +  I   EG       I GDVF+ + Y V+D+++ ++  A  N
Sbjct: 370 NYI----LQGSGPQDVAILGILRTEGDRA----IFGDVFLVDAYVVYDLEDYEISLAQAN 421

Query: 424 SN 425
            N
Sbjct: 422 FN 423

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 92/224 (41%), Gaps = 42/224 (18%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELV------ 269
           +L R+  I++  ++L+L+       + N++SG    G      Y G +Y   L+      
Sbjct: 276 ILKRNNVIKANAYSLFLN-------STNSSSGSLLFGAVDHSKYSGQLYTVPLLNTLESS 328

Query: 270 --VNPNNYWL----IAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKV 323
              +P  + +    I +     N+TL T   P              ++DSG+T    P  
Sbjct: 329 GYTDPIQFEVAVQGIGVRTSGSNTTLTTTVIP-------------ALLDSGATLSYFPVQ 375

Query: 324 DALDIHSYLPGSITDG-NYFAVFCNSTVDLT---FELGNKNWTIPASSYLGEPYQEGSKY 379
            A  I   L  + +    Y+ V C S+ D T   ++ G  +     + Y+    +     
Sbjct: 376 VAEMIADALDATYSSSYGYYIVDCPSSDDDTEIIYDFGGFHIASKLTDYILTTNRPS--- 432

Query: 380 YGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
              CV  I  Q   + +ILGDVF+ + Y V+D+DN ++  A  N
Sbjct: 433 --ICVLGIVPQN-SNRFILGDVFLTSAYVVYDLDNFEISLAQAN 473

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 378 KYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
           K+ G C      Q   S ++LGD F+++ YTVFD+D++++  A  N N
Sbjct: 371 KHKGKCYLPCVSQE-SSFFLLGDSFMRHVYTVFDLDDKEISIAQANFN 417

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 54/115 (46%), Gaps = 11/115 (9%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSI-TDGNYFAVFCNSTVD---LTFELGNKNWTIPA 365
           ++DSG+T + LP+     +   L  +  ++ +Y+ + C S  D   L  + G        
Sbjct: 324 LLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLKCPSQNDNTRLILDFGGFQVNAKI 383

Query: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           ++++    Q G    G   S+ +      S  LGDVF+ + Y V+D+DN ++  A
Sbjct: 384 TNHITR-SQNGECLLGITPSDTD------SGTLGDVFLVDAYVVYDLDNYEISLA 431

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 88/376 (23%), Positives = 135/376 (35%), Gaps = 74/376 (19%)

Query: 91  DSNSHAYIVNVTISD--EEYSLILDTGSAFPWVYGDSCSLRA----------CEGRKLYP 138
           D+    Y VN++I    +E  +++DTGS+  WV G                 C     + 
Sbjct: 68  DNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFD 127

Query: 139 TGGKQTVNGSTFRLDYPYGITS---GAIFQDSFIINNLNTSE-TFAFGVATSVPQMFENY 194
           T    T   +  +    YG ++   G    D   +   N    TFA   A++      + 
Sbjct: 128 TSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFAVAHASN-----SSV 182

Query: 195 PVSGILGLPANSPGTVEPALS-------------VLYRSKSIRSQKFTLYLDHIESENTT 241
            V GI GLPA     +E  +S             VL R+  I+   ++++++        
Sbjct: 183 AVLGI-GLPA-----METTMSSQQFGYQYDNLPMVLKRNNVIKKTVYSMFINE------- 229

Query: 242 LNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTF----QNPEN 297
           LNA +G    G      YKG +    LV    NY       +  + TL          E+
Sbjct: 230 LNAKTGSVLFGAVDHSKYKGTLNTVPLV--NANYRRRVNKPVELHVTLAAIGLHTGRDED 287

Query: 298 FTGAQSRSKRSGIIDSGSTFLVLP--------KVDALDIHSYLPGSITDGNYFAVFCNST 349
                  SK   ++DSG+T    P        +      HS   G I D N   +   + 
Sbjct: 288 KVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLHQTAY 347

Query: 350 VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSS--WILGDVFIKNFY 407
           +   ++ G      P S Y       G+  +G           HSS   ILGDVF+   Y
Sbjct: 348 I---YDFGGFQIRSPLSDYSMMTNVRGTCRFGIMP--------HSSDYVILGDVFLTRAY 396

Query: 408 TVFDMDNQQVGFALKN 423
            VFD++  +V  A  N
Sbjct: 397 VVFDLEALEVSMAQAN 412

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 309 GIIDSGSTFLVLPKVDALDIHSYLPGSITDGN-YFAVFCN----STVDLTFELGNKNWTI 363
            ++DSG+T    P      + + L    +  N Y+ + C+    +T  L F+ G  +   
Sbjct: 307 ALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFGGFHINA 366

Query: 364 PASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
             + ++    Q G+     C  +I  Q   SS ILGD F+ N Y V+D+DN ++  A
Sbjct: 367 TLADFV---VQSGTST---CFLSIIPQN-SSSAILGDTFLNNAYVVYDLDNLEISMA 416

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 13/117 (11%)

Query: 309 GIIDSGSTFLVLPKVDALDIHSYLPGSITDGN-YFAVFCNSTVD---LTFELGNKNWTIP 364
            ++DSG+T   LP      + S L  S  +    + + C S  D     F+ G    ++P
Sbjct: 364 ALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDDREFNFDFGGFQISVP 423

Query: 365 ASSYLGEPYQEGSKYYGYCVSNI-EGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
            S+++ E   +       CV  + E  A  +  ILGD F+   Y V+D++N ++  A
Sbjct: 424 LSNFILEALPD------VCVLTLFESHAERA--ILGDSFLTEAYVVYDLENLEISMA 472

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 27/134 (20%)

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG---------NYFAVFCNSTVDLT--- 353
           K   ++DSGST   LP+ D L++       + DG         NY+ + C S  D T   
Sbjct: 379 KIPALLDSGSTLAYLPE-DLLEM-------VADGLGARFSENLNYYLMDCPSKHDETKIV 430

Query: 354 FELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMD 413
           F  G  N     ++Y   P    +     CV  I      SS ILGD F+ + Y V+D++
Sbjct: 431 FNFGGFNIETNLTTYT-TPISSDT-----CVLRILPSG-DSSAILGDAFLVHAYVVYDLE 483

Query: 414 NQQVGFALKNSNVN 427
           + ++  A  N +VN
Sbjct: 484 DFEISMAQANFDVN 497

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 78/376 (20%), Positives = 142/376 (37%), Gaps = 81/376 (21%)

Query: 99  VNVTISDEEYSLILDTGSAFPWVYGDS---C--------SLRA--------CEGRKLYPT 139
           + V    ++   +LDTGSA  W+  ++   C         +R         C G K +  
Sbjct: 50  IEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQEVRGVTVTPSIDCRGIKTFCN 109

Query: 140 GGKQTVN--GSTFRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVS 197
               T+    + F +DY      G+   D  +I   + S    FGV  +      N  +S
Sbjct: 110 ESSTTLRILPNPFYIDYADTFVDGSWATDRLVIGGHDVS-GMKFGVGRT-----SNTELS 163

Query: 198 GILGLP----------ANSPGTVEPAL-SVLYRSKSIRSQKFTLYLDHIESENTTLNANS 246
           G+LG+           A +P    P L   L    S++   +++ L      +       
Sbjct: 164 GVLGVGHANLESVRGYAGAPNATYPNLPRQLKLDGSVQKLAYSVSLQKTSERD------- 216

Query: 247 GLFAIGEPITELYKGDIYYSELVV------NPNNYWLIAIDRIFCNSTLVTFQNPENFTG 300
           G    G   T  Y G ++   ++       +P+N++ IA+  I             +  G
Sbjct: 217 GEILFGAIDTSKYVGKLHTFPILNIDPHLNSPSNFY-IALQGI-------------DIQG 262

Query: 301 AQSRSKRS-------GIIDSGSTFLVLPKVDALDIHSYLPGSI-TDGNYFAVFC---NST 349
            +S + R         ++D+G+  +V+  + A DI + L  +  T+   F + C   + T
Sbjct: 263 GRSSTGRPLINSSFHALLDTGTGGMVVSSL-AEDIGAALNATYDTEQCVFVIQCPTEDDT 321

Query: 350 VDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTV 409
               F  G     +P S+++           G C   I       ++ LG  F+K  YTV
Sbjct: 322 RQFNFNFGELQIAVPISNFV---VPASGLETGQCALAIM-PGTSETFALGIPFLKEVYTV 377

Query: 410 FDMDNQQVGFALKNSN 425
           F++++ ++  A  N+N
Sbjct: 378 FNLEDNEISMARANTN 393

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 109/255 (42%), Gaps = 42/255 (16%)

Query: 178 TFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIES 237
           T+A    T+ P  ++N+P+                   VL  S +I    ++LYL+   +
Sbjct: 360 TYAGVYQTTKPYTYDNFPL-------------------VLKNSGAIHKSAYSLYLNKQSA 400

Query: 238 ENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPEN 297
           +N       G    G      Y+GD  Y+  +VN +     +   I  + TL      +N
Sbjct: 401 KN-------GNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYS-KPIEFDVTLQGLGVSDN 452

Query: 298 FTG--AQSRSKRSGIIDSGSTFLVLPKVDALDI-HSYLPGSITDG-NYFAVFCNSTVD-- 351
             G    + ++   ++DSG+T    PK D L++    +  S ++   Y+ + C  + D  
Sbjct: 453 RNGNFTVTTTQIVALLDSGTTLTYFPK-DMLNLLAKRINASYSEALGYYVMNCPDSRDNT 511

Query: 352 -LTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVF 410
            L F+ G  +     ++++       S   G CV  +     +S+ ILGD+F+ + Y V+
Sbjct: 512 QLVFDFGGFHIKTNLTNFVL------SSASGKCVLGLLPYNGNSA-ILGDIFLTHAYVVY 564

Query: 411 DMDNQQVGFALKNSN 425
           ++D+ ++  A  N N
Sbjct: 565 NLDDLEISMAQANFN 579

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 15/130 (11%)

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVF---CNSTVD---LTFELGNK 359
           K + +IDSG+T    P  + +++ +    +  D N   +    C S  D   L F LG  
Sbjct: 298 KVAALIDSGTTISEFPD-EIVEVVAKQMNATVDPNGNGIRLAKCPSKKDNAKLLFNLGGA 356

Query: 360 NWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSW-ILGDVFIKNFYTVFDMDNQQVG 418
              +    +        +K  G C   I      S   ILGD F+++ YTVFD++  +V 
Sbjct: 357 LIYVDIKEFT-------TKVKGKCYLEIIPSGAESDLVILGDNFMRSVYTVFDLEANEVS 409

Query: 419 FALKNSNVNL 428
            A  N N +L
Sbjct: 410 IAQANFNSSL 419

>KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {ON}
           Anc_5.162 YJL013C
          Length = 883

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 68/147 (46%), Gaps = 19/147 (12%)

Query: 176 SETFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPA-LSVLYRSKSIRS-QKFTLYLD 233
           +E     +  + PQ+ E  P++ +  L  +   T+EP  L     S S ++  K  ++ D
Sbjct: 176 TEKLKEKLQNAAPQLKELEPLATVQHLFNH---TMEPKFLKNGSCSASFKTIDKLPIFKD 232

Query: 234 HIESENTTLNANSGLFAIGEPITELYKGD----IYYSELVVNPNNYWLIAIDRIFCNSTL 289
             + E   L  N+ L    EP++ + +G+    IY  ++V  PN       +RI CN  L
Sbjct: 233 AEDDEPHMLRVNTNL----EPLSSIKEGERENPIY--KIVKLPNR----KPERIDCNFNL 282

Query: 290 VTFQNPENFTGAQSRSKRSGIIDSGST 316
           +  QN E F+  Q  +K+  + D  ST
Sbjct: 283 LYTQNGEEFSIEQILAKKRDLYDKRST 309

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 383 CVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKN 423
           C+  I  Q+   + ILGD F+ N Y V+D+DN ++  A  N
Sbjct: 432 CILGIAPQS-DPTIILGDNFLANTYVVYDLDNMEISMAQAN 471

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 67/147 (45%), Gaps = 25/147 (17%)

Query: 292 FQNPENFT------GAQSRSKRS--------GIIDSGSTFLVLPKVDALDIHSYLPGSIT 337
           FQ+P  F       G  + SK +         ++DSG+T   LP      + + L  S +
Sbjct: 290 FQSPYEFDITLQGLGISTSSKNTTVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYS 349

Query: 338 DG-NYFAVFCNSTVDLT---FELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIH 393
               Y+ + C S+ D T   F+ G  +  +P +S++       +     C+  I  ++  
Sbjct: 350 ARLGYYTMSCPSSSDSTEIVFDFGGFHINVPLTSFIV------TSSMNVCILGIIPRSGD 403

Query: 394 SSWILGDVFIKNFYTVFDMDNQQVGFA 420
            + ILGD F+++ Y V+D++N ++  A
Sbjct: 404 QA-ILGDSFLQHAYVVYDLENLEISLA 429

>YDR379W Chr4 (1230167..1233196) [3030 bp, 1009 aa] {ON}
           RGA2GTPase-activating protein for the
           polarity-establishment protein Cdc42p; implicated in
           control of septin organization, pheromone response, and
           haploid invasive growth; regulated by Pho85p and Cdc28p
          Length = 1009

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 25  RFLHNGKVGKVATADFWFPNEQV---PSVRVGREFSFGDDS-ADAVKQAADDVLDPTYVH 80
           R   NG   +  TAD   P+++V   P+ ++ R FS    +    +K    ++LDP + H
Sbjct: 400 RLSDNGSFSRPQTADNLLPHKKVAPSPNKKLSRSFSLKSKNFVHNLKSKTSEMLDPKHPH 459

Query: 81  LSPAITILTRDSNSHA 96
            S +I    ++S++H+
Sbjct: 460 HSTSI----QESDTHS 471

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 118/290 (40%), Gaps = 55/290 (18%)

Query: 160 SGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILG--LPANSPGTVEPALS-- 215
           SG    D   +NNLN +   +F VA       E     G+LG  LP         +LS  
Sbjct: 205 SGTWGHDRLSLNNLNVTG-LSFAVAN------ETNSTVGVLGIGLPGLESTYSGVSLSSA 257

Query: 216 -----------VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIY 264
                      +L  S +I+S  ++L+ +H +S++ T+     LF  G      Y GD+Y
Sbjct: 258 QKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTI-----LF--GAVDHGKYAGDLY 310

Query: 265 YSELVVNPNNYWLIAIDRIFCNSTLVTF-----QNPENFTGAQSRSKRSGIIDSGSTFLV 319
              ++    N      D I    TL        +  EN T   + +K   ++DSG+T   
Sbjct: 311 TIPIINTLQNRGYK--DPIQFQVTLQGIGVSHGERDENMT-TLTTTKIPVLLDSGTTISY 367

Query: 320 LPKVDALDIHSYLPGSI--TDGNYFAVFCNSTVD----LTFELGN---KNWTIPASSYLG 370
           +P  D +++ +   G+    D  Y+ + C + ++    L F+ G     NW       L 
Sbjct: 368 MP-ADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANW-------LS 419

Query: 371 EPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
                       C+  I  Q+   + ILGD F+ + Y V+D+DN ++  A
Sbjct: 420 NFQLLTDSRSNVCILGIAPQS-DPAIILGDNFLVSTYVVYDLDNMEISMA 468

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 394 SSWILGDVFIKNFYTVFDMDNQQVGFALKN-----SNVNLVQNS 432
           SS ILGD F+   Y V+D+DN ++  A  N     SN+ ++ +S
Sbjct: 450 SSLILGDNFLTAAYVVYDLDNLEISLAQANYDGGSSNIEVISSS 493

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 29/44 (65%), Gaps = 5/44 (11%)

Query: 394 SSWILGDVFIKNFYTVFDMDNQQVGFAL-----KNSNVNLVQNS 432
           S+ ILGD F+ N Y V+D+DN ++  A      ++ +++++++S
Sbjct: 444 STVILGDNFLSNAYVVYDLDNMEISMAQVDLSGRSEDIDVIEDS 487

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 90/210 (42%), Gaps = 21/210 (10%)

Query: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275
           VL R+  I    ++++L+        L+A+SG    G      Y G +Y   +V   N  
Sbjct: 285 VLQRNGVIEKNAYSVFLND-------LDADSGSILFGAVDHSKYTGTLYTVPMV---NAL 334

Query: 276 WLIA-IDRIFCNSTLVTFQNPENFTGAQ-SRSKRSGIIDSGSTFLVLPKVDALDIHSYLP 333
             I   ++I  + TL       ++     +++K   ++D+G+TF   P   A  I S + 
Sbjct: 335 RSIGYTEQIRLSITLQGIGVTSSYGNETVTQTKYPALLDTGATFCYFPSSLAAAIASSVS 394

Query: 334 GSITDG-NYFAVFCNS--TVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQ 390
            + +    Y+ V C+S    DL F+ G  +   P S Y+             CV  I  Q
Sbjct: 395 ATYSSSSGYYFVDCDSGSDYDLVFDFGGFHIISPLSDYIVTTSSSSQ-----CVLGILPQ 449

Query: 391 AIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           +  +   LGD F+ + Y V+D++  ++  A
Sbjct: 450 S-DNEITLGDAFLTSAYVVYDLEELEISLA 478

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 12/114 (10%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVD---LTFELGNKNWTIPAS 366
           + DSG++  VLP   A  I     G  +  +   +F  + V+   L+F+ G  N +   S
Sbjct: 324 LFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKVNNTLLSFDFGGFNISANIS 383

Query: 367 SYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420
           +++  P ++      +C+  I      + ++LGD F+ + Y V+D++N +V  A
Sbjct: 384 NFV-TPAKD------HCILQILPS--DTIFVLGDAFLVDTYVVYDLENHEVSVA 428

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 20/129 (15%)

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSY----LPGSITDGNYFAVF--C---NSTVDLTFEL 356
           K   ++DSG+T   LP    +D+HS     L G +     F     C   N    L F  
Sbjct: 363 KMPALLDSGTTVSYLP----IDLHSLVAKQLKGIVDPQTGFIELKNCPAKNDNTQLVFNF 418

Query: 357 GNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQ 416
           G    +I  + ++ E   + + Y  +      G       +LGD F++N Y V+D+++ +
Sbjct: 419 GGAFISIKYTEFI-EKSDDDNCYVTFMPQGEPG------ILLGDNFLRNAYIVYDLEDME 471

Query: 417 VGFALKNSN 425
           +  A  N N
Sbjct: 472 ISIAQANFN 480

>TDEL0A05880 Chr1 (1035123..1036253) [1131 bp, 376 aa] {ON}
           Anc_8.642 YPL133C
          Length = 376

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 170 INNLNTSETF--AFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQK 227
           I +L T E    + G  T  P   E+   +G +GLP   PG  E   S + R+ S   Q+
Sbjct: 39  IAHLCTDENLGNSMGPTTPAPAAEES---TGDIGLP---PGGAEQLTSAMTRTPSFLPQQ 92

Query: 228 FTLYLDHIESENTTLN 243
            T   +H+ SE ++LN
Sbjct: 93  PTFVSEHVGSEFSSLN 108

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 389 GQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425
           G    S   LGD+F+ + Y V+D+DN+++  A  N N
Sbjct: 379 GSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINYN 415

>ZYRO0D02244g Chr4 (175646..176908) [1263 bp, 420 aa] {ON} weakly
           similar to uniprot|P46958 Saccharomyces cerevisiae
           YJL146W IDS2 Protein involved in modulation of Ime2p
           activity during meiosis appears to act indirectly to
           promote Ime2p-mediated late meiotic functions found in
           growing cells and degraded during sporulation
          Length = 420

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 158 ITSGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVL 217
           +  G+I +   + + LN   +F+ G     P++ E   VS +  L  +SP  VEP L + 
Sbjct: 138 LRRGSIQEVQRVRHLLNPRSSFS-GAPPEEPELQEGCSVSWVTILANSSPEYVEPILVLQ 196

Query: 218 YRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIG---EPITELYKGDI 263
              KS+ S KF L + H    ++++    G+  +      + EL+K  I
Sbjct: 197 ESLKSVNS-KFGLCVIHNSEVDSSMIREKGIETVAFDKAKLPELFKKSI 244

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 5/71 (7%)

Query: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELG----NKNW 361
           K SGII  GS+  ++  +         PG + D   F  F +S V+  F  G    + +W
Sbjct: 171 KHSGIIPGGSSTKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDW 230

Query: 362 TIPASSYLGEP 372
             P    L EP
Sbjct: 231 EFPKDDGL-EP 240

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 17/118 (14%)

Query: 310 IIDSGSTFLVLPKVDALDIHSYLPGSI-TDGNYFAVFCNSTVD---LTFELGNKNWTIPA 365
           ++DSG+T + LP   A  I S   G +  +   + + C  + D   +TF+ G        
Sbjct: 377 VLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGGVTIKTDI 436

Query: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWIL---GDVFIKNFYTVFDMDNQQVGFA 420
            +Y+ E  Q  +K    C+  I    I +S IL   GDVF+ + Y V+D++ +++  A
Sbjct: 437 RNYIFE--QSENK----CLLGI----IPNSDILAVFGDVFLTDAYVVYDLEGKEISLA 484

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,261,835
Number of extensions: 2409794
Number of successful extensions: 6326
Number of sequences better than 10.0: 128
Number of HSP's gapped: 6339
Number of HSP's successfully gapped: 129
Length of query: 481
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 368
Effective length of database: 40,524,141
Effective search space: 14912883888
Effective search space used: 14912883888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)