Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46138.842ON52452426720.0
ABL124W8.842ON48548915820.0
SAKL0D01430g8.842ON44746115710.0
YML115C (VAN1)8.842ON53548715380.0
NCAS0B003008.842ON52350315340.0
Suva_13.288.842ON53048615250.0
ZYRO0G14234g8.842ON50949415180.0
KAFR0A028308.842ON50749915170.0
NDAI0E002908.842ON52249615140.0
Smik_13.198.842ON53647715100.0
Kpol_541.158.842ON49849614920.0
Skud_13.268.842ON53942114940.0
KLLA0D01529g8.842ON50142914850.0
KNAG0G034208.842ON51143514700.0
KLTH0C03828g8.842ON40440614570.0
TDEL0B005608.842ON50949614540.0
TBLA0B032708.842ON52046914120.0
CAGL0B02321g8.842ON51241913890.0
TPHA0C047808.842ON52548013700.0
Kwal_27.102468.842ON33934012891e-176
CAGL0L01331g1.479ON4473658931e-114
Ecym_35731.479ON4473658861e-113
YEL036C (ANP1)1.479ON5003608891e-113
KNAG0I003001.479ON4573678841e-113
Smik_5.571.479ON4913578851e-113
NCAS0G041101.479ON4943658851e-113
TBLA0B021701.479ON5723658911e-113
KLTH0C03432g1.479ON4893658831e-113
Skud_5.541.479ON4913578831e-112
NDAI0G003401.479ON5043578831e-112
Suva_5.331.479ON4953578821e-112
Kwal_27.101571.479ON4763658781e-112
SAKL0D11792g1.479ON4833658781e-112
NDAI0B012501.479ON4464108751e-112
AFR357W1.479ON4343668661e-111
KAFR0I027701.479ON4553658671e-111
Kpol_370.51.479ON6453648821e-110
TDEL0C026001.479ON4623668491e-108
KLLA0E22155g1.479ON4503658441e-107
TPHA0O004301.479ON5483608501e-107
ZYRO0F05170g1.479ON6083588501e-106
KLLA0E12849g8.500ON3923604192e-45
KAFR0H013908.500ON3984644061e-43
TPHA0L013708.500ON3923604024e-43
TBLA0H033408.500ON3933723963e-42
SAKL0H11110g8.500ON3933603946e-42
NDAI0E030208.500ON3964633902e-41
NCAS0C023308.500ON3933663851e-40
Skud_16.2328.500ON3953663823e-40
YPL050C (MNN9)8.500ON3953663814e-40
KNAG0A021508.500ON3963663814e-40
Smik_16.1868.500ON3953663797e-40
ZYRO0F08492g8.500ON3963573752e-39
Kpol_1031.788.500ON3923603743e-39
KLTH0E11616g8.500ON3943533701e-38
Suva_16.2658.500ON3953633702e-38
CAGL0L12804g8.500ON3933573673e-38
TDEL0B013708.500ON3963573674e-38
Kwal_27.118648.500ON4533473695e-38
AGL259C8.500ON3893463533e-36
Ecym_25508.500ON3903493359e-34
NCAS0B024408.500ON4003603304e-33
NDAI0C052508.500ON4023643253e-32
KNAG0A039908.500ON3571751828e-14
SAKL0H20438gsingletonON5651641492e-09
TPHA0H014405.359ON87567733.0
CAGL0M06061g8.592ON434115714.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4613
         (524 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...  1033   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   613   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   609   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   597   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   595   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   592   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   589   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   588   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   587   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   586   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   579   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   580   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   576   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   570   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   565   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   564   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   548   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   539   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   532   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   501   e-176
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   348   e-114
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   345   e-113
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   347   e-113
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   345   e-113
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   345   e-113
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    345   e-113
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   347   e-113
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   344   e-113
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   344   e-112
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   344   e-112
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   344   e-112
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   342   e-112
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   342   e-112
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   341   e-112
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   338   e-111
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   338   e-111
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   344   e-110
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   331   e-108
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   329   e-107
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   332   e-107
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   332   e-106
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   166   2e-45
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   160   1e-43
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   159   4e-43
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   157   3e-42
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   156   6e-42
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   154   2e-41
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   152   1e-40
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   151   3e-40
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   151   4e-40
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   151   4e-40
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   150   7e-40
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   149   2e-39
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   148   3e-39
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   147   1e-38
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   147   2e-38
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   145   3e-38
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   145   4e-38
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   146   5e-38
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   140   3e-36
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   133   9e-34
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   131   4e-33
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   129   3e-32
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    75   8e-14
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    62   2e-09
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    33   3.0  
CAGL0M06061g Chr13 (633324..634628) [1305 bp, 434 aa] {ON} weakl...    32   4.0  

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/524 (95%), Positives = 498/524 (95%)

Query: 1   MLFSISERYKAMGQSNQRSQVYYLFDTIYTNVPLSPQNSRYHPKVKGKFNFRLSYKLKNV 60
           MLFSISERYKAMGQSNQRSQVYYLFDTIYTNVPLSPQNSRYHPKVKGKFNFRLSYKLKNV
Sbjct: 1   MLFSISERYKAMGQSNQRSQVYYLFDTIYTNVPLSPQNSRYHPKVKGKFNFRLSYKLKNV 60

Query: 61  IVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDT 120
           IVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDT
Sbjct: 61  IVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDT 120

Query: 121 VRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHV 180
           VRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHV
Sbjct: 121 VRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHV 180

Query: 181 LICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGT 240
           LICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGT
Sbjct: 181 LICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGT 240

Query: 241 LSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQI 300
           LSKSLKLQDAY           EGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQI
Sbjct: 241 LSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQI 300

Query: 301 FQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPG 360
           FQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 301 FQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPG 360

Query: 361 SVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGY 420
           SVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGY
Sbjct: 361 SVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGY 420

Query: 421 AEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXX 480
           AEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVH              
Sbjct: 421 AEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHFAAFAFENHAETEA 480

Query: 481 XGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRRS 524
            GKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRRS
Sbjct: 481 FGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRRS 524

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/489 (60%), Positives = 364/489 (74%), Gaps = 21/489 (4%)

Query: 53  LSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSY------------AGLLSISD---- 96
           ++YKLK+V + +  + C   +++Q +   GS  R                 + +SD    
Sbjct: 1   MNYKLKHVAMFVWVMICGTLVVRQLV---GSGEREVILVDREVPMEEREVFVDVSDDERA 57

Query: 97  -SYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLL 155
             ++  VL++ EYY++E+     + + +YD+GF+H  + +DG ++ +  E FEE ++ L+
Sbjct: 58  AEWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPE-FEEQMEELV 116

Query: 156 STTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFL 215
           S TVE YDL  Y GT NGAENREHVLIC+PLRNA  VLP+MF+HLMNLTYPHELID+AFL
Sbjct: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176

Query: 216 VSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDY 275
           VSDCS++D T+ SL+ YA  LQKGTL+  L  ++A             GDL+LKYM+++Y
Sbjct: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEY 236

Query: 276 LNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNW 335
           L MV +A   P+H+NY+KPFRSVQ+F+KDFGQ IGQGFSDRHHVKVQG RR+LMG+ARNW
Sbjct: 237 LQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNW 296

Query: 336 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLN 395
           LTANALKPYHSWVYWRD DVELCPGSVIEDLMS+GYDVIVPNVWRPLPEFLG +Q YDLN
Sbjct: 297 LTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLN 356

Query: 396 SWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSIL 455
           SWIES +ALNLAK L+EDDVIVEGYAEYATWRFHL   R+ +GN  +V+DLDGVGGVSIL
Sbjct: 357 SWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSIL 416

Query: 456 AKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
           AKAKLFR G H               GKMAKKMGY+VGGL HYTLWHIYEPS+DD+M+IA
Sbjct: 417 AKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476

Query: 516 RKERSSRRS 524
           R+ER +RRS
Sbjct: 477 RRERENRRS 485

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/461 (64%), Positives = 345/461 (74%), Gaps = 17/461 (3%)

Query: 65  LTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRY 124
           + I  IFFL+   +   G  P           +Y T  L++ EYYN++++ +D+D +++Y
Sbjct: 1   MVILIIFFLLNSIL---GGDPYV---------NYKTFSLKDHEYYNYDFKNIDVDIIQKY 48

Query: 125 DDGFKHILIDQDG--TLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHVLI 182
           D G +H LI Q G   L     E +E+ ++MLL  TV+ YDLSKY G+ NGAENR+HVL+
Sbjct: 49  DKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENRDHVLL 108

Query: 183 CVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLS 242
           CVPLRNA NVLPLMF+HLMNLTYPHELIDLAFLVSDCS+DD T+D+LI+Y++ELQ GTLS
Sbjct: 109 CVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLS 168

Query: 243 KSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQ 302
           +    QD               DL+LKYMN+DYLNMVE A K PFHK+YDKPFRSVQ+FQ
Sbjct: 169 ELFAEQDE---MRRKASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQ 225

Query: 303 KDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSV 362
           KDFGQ+IGQGFSDRH V VQG RRKLMG+ARNWLTANALKPYHSWVYWRD D+ELCPGSV
Sbjct: 226 KDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSV 285

Query: 363 IEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAE 422
           IEDLMS+  DV VPNVWRPLPEFLG EQ YDLNSW+ES  AL LA TLDEDDVIVEGYAE
Sbjct: 286 IEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAE 345

Query: 423 YATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXG 482
           Y TWR HL   R+P  N  ++LDLDGVGGVSILAKAKLFR GVH               G
Sbjct: 346 YPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFG 405

Query: 483 KMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRR 523
           KMAKKM YRVGGL HYT+WHIYEPS+DDL EIA+KER  RR
Sbjct: 406 KMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKEREKRR 446

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/487 (60%), Positives = 349/487 (71%), Gaps = 7/487 (1%)

Query: 40  RYHPK-VKGKFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSY 98
           RY P+    KF   +S     +I  L     I FL    +  +    RS  G    S++Y
Sbjct: 50  RYQPRSTPSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENY 109

Query: 99  DTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDMLLS 156
            T  LE+ EYY++++  +D + + ++DDG +H LI Q G+  L    +E ++  L+ML  
Sbjct: 110 KTIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFD 169

Query: 157 TTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLV 216
           +TVE YDLS + G  NG E R+H+L+C+PLRNA +VLPLMF+HLMNLTYPHELIDLAFLV
Sbjct: 170 STVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 229

Query: 217 SDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYL 276
           SDCS+ D T+D+LI+Y+  LQ GTLS+  +  DA               L+LKYM++ Y+
Sbjct: 230 SDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDK----LYLKYMDEGYI 285

Query: 277 NMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWL 336
           N V  A   PFH+NYDKPFRSVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWL
Sbjct: 286 NRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 345

Query: 337 TANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNS 396
           TANALKPYHSWVYWRDADVELCPGSVI+DLMS  YDVIVPNVWRPLP FLG+EQ YDLNS
Sbjct: 346 TANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNS 405

Query: 397 WIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILA 456
           W+ES  AL LAKTLDEDDVIVEGYAEY TWR HLA  RD +G+  + +DLDGVGGVSILA
Sbjct: 406 WMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILA 465

Query: 457 KAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIAR 516
           KAK+FRNGV                GKMAKKMGYRVGGL HYT+WHIYEPS+DDL EIA 
Sbjct: 466 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAS 525

Query: 517 KERSSRR 523
           +ER  RR
Sbjct: 526 REREKRR 532

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/503 (58%), Positives = 363/503 (72%), Gaps = 12/503 (2%)

Query: 32  VPLSPQNSRYHPKVKGKFNF------RLSYKLKNVIVSLLTIACIFFL---IKQTMDRNG 82
           +P S  NS Y  + + K +F       LS  +K  + SLL I    F    + +   +  
Sbjct: 21  LPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYD 80

Query: 83  STPRSYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LN 140
           S    +AG  + + SY T  L E+EYY+ ++  ++   V+++D+G +H LI Q GT  L 
Sbjct: 81  SVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLT 140

Query: 141 SNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHL 200
            +  E + + L M+L  +VE YDLS + G++NGA NR+H+L+CVPLR+AE+VLPLMF+HL
Sbjct: 141 PSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHL 200

Query: 201 MNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXX 260
           MNLTYPHELIDLAFLVSDCS+ D T+D+L++Y++ LQ GTLS+     D Y         
Sbjct: 201 MNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSK 260

Query: 261 XXEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVK 320
             + +LHLKYMN DYL +V+ + K+  H NYDKPFRS+Q+FQKDFGQIIGQGFSDRH VK
Sbjct: 261 GTK-NLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVK 319

Query: 321 VQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWR 380
           VQG RRKLMG+ARNWL ANALKPYH+WVYWRDAD+ELCPGSVIEDLMS  YDVIVPNVWR
Sbjct: 320 VQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWR 379

Query: 381 PLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNT 440
           PLPEFL  EQ YDLNSWIESD AL LAKTLDEDDVIVEGYAEY TWR HLA  RD  G+ 
Sbjct: 380 PLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDP 439

Query: 441 MDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTL 500
            +V+DLDGVGGVSILAKAK+FR+GV                GKMA+KMG+RVGGL HYT+
Sbjct: 440 NEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTI 499

Query: 501 WHIYEPSNDDLMEIARKERSSRR 523
           WHIYEPS+DDLMEIA KER ++R
Sbjct: 500 WHIYEPSDDDLMEIANKERQNKR 522

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 353/486 (72%), Gaps = 11/486 (2%)

Query: 41  YHPKVKG-KFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYD 99
           Y P+    KF   ++     +I+ L     I FL +  +   G + ++   LL  S++Y 
Sbjct: 51  YQPRSSSSKFQLAVNVISLVIIIVLSLYLMILFLSEMKL---GISIQNGNPLLG-SENYK 106

Query: 100 TAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDMLLST 157
           T  LE+ EYYN+++  +D + V ++DDG +H LI Q G+  L     E ++E + MLL +
Sbjct: 107 TIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDS 166

Query: 158 TVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVS 217
           TVE YDL+ + G  NG E R+H+L+C+PLRNA +VLPLMF+HLMNLTYPHELIDLAFLVS
Sbjct: 167 TVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 226

Query: 218 DCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLN 277
           DCS+ D T+D+LI+Y+ +LQ GTLS+  +  DA               L+LKYM++DY+N
Sbjct: 227 DCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDK----LYLKYMDEDYIN 282

Query: 278 MVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLT 337
            V  A   PFH NYDKPFRSVQ+FQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWLT
Sbjct: 283 RVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 342

Query: 338 ANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSW 397
           ANALKPYHSWVYWRDADVELCPGSVI+DLMS  YDVIVPNVWRPLP FL SEQ YDLNSW
Sbjct: 343 ANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSW 402

Query: 398 IESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAK 457
           +ES  AL+LAKTLDEDDVIVEGYAEY TWR HLA  RD  G+  +V+DLDGVGGVSILAK
Sbjct: 403 MESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAK 462

Query: 458 AKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARK 517
           AK+FRNGV                GKMAKKMGYRVGGL HYT+WHIYEPS+DDL EIA +
Sbjct: 463 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATR 522

Query: 518 ERSSRR 523
           ER  RR
Sbjct: 523 EREKRR 528

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/494 (60%), Positives = 351/494 (71%), Gaps = 12/494 (2%)

Query: 34  LSPQNSRYHPKVKGKFNFRLSYKLKNVIVSLLTIACIFFLIK--QTMDRNGSTPRSYAGL 91
           L   +S+  PK K     R S++ + ++  ++    +  L K    + R G       G 
Sbjct: 23  LPTSHSKLSPKGK-----RSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVG- 76

Query: 92  LSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFEE 149
            S + S D  VLEE  YY++++  +D   + ++D G +H LI Q G   L     E FE 
Sbjct: 77  -SNTSSNDGQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFER 135

Query: 150 HLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHEL 209
              MLLS+TVE+YDLS + G+ANGA N EHVL+CVPLR+AE VLPLMF+HLMNLTYPHEL
Sbjct: 136 EQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHEL 195

Query: 210 IDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLK 269
           IDLAFLVSDC++DD T+D+LI+Y+ +LQ GTLS+     D             E  L+LK
Sbjct: 196 IDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTE-KLYLK 254

Query: 270 YMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLM 329
           YMN DYL  V+ +   PFH+NYDKPFRSVQ+FQKDFGQ+IGQGFSDRH VKVQG RRKLM
Sbjct: 255 YMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLM 314

Query: 330 GKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSE 389
           G+ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMS  YDV VPNVWRPLP+FL  E
Sbjct: 315 GRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGE 374

Query: 390 QEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGV 449
           Q YDLNSW+ES  ALNLAKTLDEDDVIVEGYAEY T+R HLA  RDP  +  ++LDLDGV
Sbjct: 375 QPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGV 434

Query: 450 GGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSND 509
           GGVSILAKA+LFR G+                GKMAKKMGYRVGGL HYTLWHIYEPS+D
Sbjct: 435 GGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDD 494

Query: 510 DLMEIARKERSSRR 523
           DL EIA KER SRR
Sbjct: 495 DLREIANKERESRR 508

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/499 (58%), Positives = 356/499 (71%), Gaps = 20/499 (4%)

Query: 34  LSPQNSRYHPKVKGKFNF-------RLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPR 86
           L   NS Y    + K NF       RL+Y    +I        I FL+   ++   +  +
Sbjct: 20  LPRTNSLYETDSEKKLNFTPKNRKRRLNYA--KIIFGFFVSFLILFLM---LNFEFNASK 74

Query: 87  SYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQE 144
               ++ I+    T  L + EYYNF++  +D   ++++D G +H LI Q GT  L    +
Sbjct: 75  LNKTIIDIAQK--TINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQ 132

Query: 145 EGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLT 204
           E +E  ++ML  +T+ETYDL  + G  NGAENR+HVL+C+PLR+A +VLPLMFRHLMNLT
Sbjct: 133 EIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLT 192

Query: 205 YPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEG 264
           YPHELIDLAFLVSDCS++D+T+D+LI +++ LQ GTLS+ L   DA+           + 
Sbjct: 193 YPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETST----KS 248

Query: 265 DLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGT 324
           +LHLKYM+ +YL  V+ A   PFH++YDKPFRSVQIF+K+FGQIIGQGFSDRH VKVQG 
Sbjct: 249 NLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGI 308

Query: 325 RRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPE 384
           RRKLMG+ARNWLTANALKPYHSWVYWRDAD+ELCPGSVIEDLM+  YDVIVPNVWRPLP 
Sbjct: 309 RRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPA 368

Query: 385 FLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVL 444
           FL  EQ YDLNSW ES  AL LA+TLDEDDVIVEGYAEY TWR HLA  RDPQGN  +V+
Sbjct: 369 FLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVV 428

Query: 445 DLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIY 504
           D+DGVGGVSILAKAKLFR+GV                GKMAKKMGY+VGGL HYTLWHIY
Sbjct: 429 DIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIY 488

Query: 505 EPSNDDLMEIARKERSSRR 523
           EPS+DDL E+A KER  RR
Sbjct: 489 EPSDDDLKEMANKEREERR 507

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/496 (58%), Positives = 357/496 (71%), Gaps = 6/496 (1%)

Query: 30  TNVPLSPQNSRYHPKVKGKF-NFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSY 88
           +NV    +  R+ PK K    N  +   +  +I +L+     +F    T  R G      
Sbjct: 27  SNVADELKKQRFIPKKKSTAKNVAIGSVVSFIICALIYCGYSYFF--NTSPRLGKINLYA 84

Query: 89  AGLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEG 146
                +S SY T  L + EYYN+++  ++ D + ++++G +H LI + GT  L    +E 
Sbjct: 85  NKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQ 144

Query: 147 FEEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYP 206
           +E+ L MLL  +VE YDL K+ G+ NGAENR+H+L+CVPLR+AE+VLPLMF+HLMN+TYP
Sbjct: 145 YEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYP 204

Query: 207 HELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDL 266
           HELIDLAFLVSDCS  D+T+++L+ Y+  LQ GTLS+  +  D Y           + +L
Sbjct: 205 HELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTK-NL 263

Query: 267 HLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRR 326
           HLKYMN++YL MVE A   P H+NYDKPFRSVQIF+KDFGQ+IGQGFSDRH VKVQG RR
Sbjct: 264 HLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRR 323

Query: 327 KLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFL 386
           KLMG+ARNWL ANALKPYHSWVYWRDAD+ELCPG+++ED+M+  YDV+VPNVWRPLPEFL
Sbjct: 324 KLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFL 383

Query: 387 GSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDL 446
            SEQ YDLNSWIESD AL LAKTL EDDVIVEGYAEY TWR HLA  R+ QG+   V+DL
Sbjct: 384 DSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDL 443

Query: 447 DGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEP 506
           DGVGGVSILAKAKLFR+GVH               GKMAK+MGYRVGGL HYT+WHIYEP
Sbjct: 444 DGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEP 503

Query: 507 SNDDLMEIARKERSSR 522
           S+DDL EIA KER SR
Sbjct: 504 SDDDLKEIANKERQSR 519

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/477 (60%), Positives = 346/477 (72%), Gaps = 7/477 (1%)

Query: 41  YHPKVKG-KFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYD 99
           Y P+ K  KF   ++     +I  L     I FL   ++       R   G    SD+Y 
Sbjct: 51  YQPRSKSSKFQMTVNAISLIIITILSLYLSISFLTGMSIGVPIQNGRPLLGSSKSSDNYK 110

Query: 100 TAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDMLLST 157
           T  LE+ EYY++++  +D + V ++D+G +H LI Q G+  L    +E ++  L MLL +
Sbjct: 111 TIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDS 170

Query: 158 TVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVS 217
           TVE YDLS++ G +NG E R+H+L+CVPLRNA +VLPLMF+HLMNLTYPHELIDLAFLVS
Sbjct: 171 TVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230

Query: 218 DCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLN 277
           DCS+DD T+D+LI+Y+ +LQ GTLS+  +  DA               L+L+YM+++Y+N
Sbjct: 231 DCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDK----LYLQYMDQNYIN 286

Query: 278 MVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLT 337
            V  A   PFH+NYDKPFRSVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWLT
Sbjct: 287 RVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346

Query: 338 ANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSW 397
           ANALKPYHSWVYWRDADVELCPGS+I+DLMS  YDVIVPNVWRPLP FL SEQ YDLNSW
Sbjct: 347 ANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSW 406

Query: 398 IESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAK 457
           +ES   L LAKTLDEDDVIVEGYAEY TWR HLA  RD +G+  +V+DLDGVGGVSILAK
Sbjct: 407 MESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAK 466

Query: 458 AKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEI 514
           AKLFRNGV                GKMAKKMGYRVGGL HYT+WHIYEPS+DDL EI
Sbjct: 467 AKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/496 (58%), Positives = 361/496 (72%), Gaps = 17/496 (3%)

Query: 32  VPLSPQNSRYHPKVKGKFNFRLSYKLKNV-IVSLLTIACIFFLIKQTMDRNGSTPRSYAG 90
           +P+S  +SR+ PK K +  F  +     V I +++T+      I Q    + S+      
Sbjct: 17  LPIS--DSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVFICQNSFSSSSS------ 68

Query: 91  LLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFE 148
            +  S + +  +LE++EYY+++++  D   V+++DDG KH LI + G+  L    +  +E
Sbjct: 69  NVVDSHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYE 128

Query: 149 EHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHE 208
           + L  LLSTTV+ YDLSKY+GT NG +NREHVL+CVPLR+AE+VLPLMF+++MNLTYPHE
Sbjct: 129 QELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHE 188

Query: 209 LIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHL 268
           LIDLAFLVSDC++ DHT++SLI+Y+  LQ GTL+   +  D                L+L
Sbjct: 189 LIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMDK------DDSKKDSEKLYL 242

Query: 269 KYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKL 328
           KYMNKDYL MVE+A   PFH +Y+KPFRSVQIFQKDFGQ +GQGF++RH VKVQG RRKL
Sbjct: 243 KYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKL 302

Query: 329 MGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGS 388
           MG+ARNWL  NALKPYH+WVYWRDADVELCPG+VIEDLMS  +DV+VPNVWRPLPEFL S
Sbjct: 303 MGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNS 362

Query: 389 EQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDG 448
           EQ YDLNSW+ES+ AL LAK LDEDDVIVEGYAEY TWR HLA  R+  GN   V+DLDG
Sbjct: 363 EQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDG 422

Query: 449 VGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSN 508
           VGGVSIL KAKLFR+G+H               GKMAKKMG+RVGGL HYTLWHIYEPS+
Sbjct: 423 VGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 482

Query: 509 DDLMEIARKERSSRRS 524
           DDL+EIA KER + RS
Sbjct: 483 DDLLEIASKERENNRS 498

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/421 (66%), Positives = 325/421 (77%), Gaps = 6/421 (1%)

Query: 97  SYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDML 154
           +Y T  LE+ EYYN+++  +D + + ++D G +H LI Q G+  L    EE +++ L+ML
Sbjct: 108 NYKTIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNML 167

Query: 155 LSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAF 214
           L +TVE YDLS + G  NG E R+H+L+C+PLRNA +VLPLMF+HLMNLTYPHELIDLAF
Sbjct: 168 LDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227

Query: 215 LVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKD 274
           LVSDCS+ D T+D+LI+Y+ +LQ GTLS+  +  DA               L+LKYM++D
Sbjct: 228 LVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDK----LYLKYMDED 283

Query: 275 YLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARN 334
           Y+N V  A   PFH NYDKPFRSVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARN
Sbjct: 284 YINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 343

Query: 335 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDL 394
           WLTANALKPYHSWVYWRDADVELCPGSVIEDLMS  YDV+VPNVWRPLP FL SEQ YDL
Sbjct: 344 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDL 403

Query: 395 NSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSI 454
           NSW+ES  AL LAKTLDEDDVIVEGYAEY TWR HLA  RD +GN  +V+DLDGVGGVSI
Sbjct: 404 NSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSI 463

Query: 455 LAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEI 514
           LAKAK+FRNGV                GKMAKKMGYRVGGL HYT+WHIYEPS+DDL EI
Sbjct: 464 LAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

Query: 515 A 515
           A
Sbjct: 524 A 524

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/429 (63%), Positives = 331/429 (77%), Gaps = 7/429 (1%)

Query: 98  YDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFEEHLDMLL 155
           Y    L+E EYY+++++ LD+DT+++YD+G  H +I + G   L+S  +E FE   DMLL
Sbjct: 76  YIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLL 135

Query: 156 STTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFL 215
           ++T + YDLS+Y G +NGA NR+HVL+CVPLR+A ++LP++F++LMNLTYPHELID+AFL
Sbjct: 136 ASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFL 195

Query: 216 VSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDY 275
           VSDC+ +  TM SL+ +++ELQ GTLSK+L+  +A               L+LKYM KDY
Sbjct: 196 VSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEA-----DKDKGNSAEQLYLKYMGKDY 250

Query: 276 LNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNW 335
           L MV+NA   PFH +YDKPFRS+QIF+KDFGQ IGQGFSDRH VKVQG RRKLMG+ARNW
Sbjct: 251 LKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNW 310

Query: 336 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLN 395
           LTANALKPYHSWVYWRD DVELCPG+VIEDLM   YDVIVPNVWRPLP FLG  Q YDLN
Sbjct: 311 LTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLN 370

Query: 396 SWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSIL 455
           SW+ES+ A+ LAKTLDEDDVIVEGYAEY TWR HL   R   GN  D+LDLDGVGGVSIL
Sbjct: 371 SWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSIL 430

Query: 456 AKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
           A+A+LFR G+H               GKMAKKMG++VGGL HYTLWHIYEPS+DDL EIA
Sbjct: 431 ARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIA 490

Query: 516 RKERSSRRS 524
           + ER SRR+
Sbjct: 491 KLERESRRN 499

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/435 (62%), Positives = 331/435 (76%), Gaps = 3/435 (0%)

Query: 91  LLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFE 148
           L S + +Y T  L+E+EYYN+++  LD   + ++D G +H LI + G   L    +E +E
Sbjct: 77  LESGNHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYE 136

Query: 149 EHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHE 208
             +  L  +TV+ YDL+++ G+ +G  NR+HVLICVPLR+AE VLPLMF+HLMNLTYPHE
Sbjct: 137 AEVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHE 196

Query: 209 LIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHL 268
           LID+AFLVSDCS DD+T+++LI+Y+ +LQ GTLS+     DA               L+L
Sbjct: 197 LIDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDA-VTDYLNAKDRKNNKLYL 255

Query: 269 KYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKL 328
           KYM ++YLN VE A   P+H+NYDKPFRSVQIF+K+FGQIIGQGFSDRH VKVQG RRKL
Sbjct: 256 KYMKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKL 315

Query: 329 MGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGS 388
           MG++RNWLTANALKPYHSWVYWRDAD+ELCPGSVI+D+M+  YDV+VPNVWRPLPEFL  
Sbjct: 316 MGRSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNG 375

Query: 389 EQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDG 448
           EQ YDLNSW+ES  AL LA+TLDEDDVIVEGYAEY TWR HLA  RD +G+  +V+DLDG
Sbjct: 376 EQPYDLNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDG 435

Query: 449 VGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSN 508
           VGGVSILA+AKLFRNGV                GKMA+K+G+RVGGL HYTLWHIYEPS+
Sbjct: 436 VGGVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSD 495

Query: 509 DDLMEIARKERSSRR 523
           DDL EIA KER  RR
Sbjct: 496 DDLREIANKEREKRR 510

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/406 (67%), Positives = 313/406 (77%), Gaps = 5/406 (1%)

Query: 121 VRRYDDGFKHILIDQDG--TLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENRE 178
           +R++D+G +H LI + G   L+S+ +E +EE +  LL +TVE YDL  + G+A G  NRE
Sbjct: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61

Query: 179 HVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQK 238
           HVL+ VPLRNAE VLPLMF++LMNLTYPHELIDLAFLVSDCS+DD T+++L+ Y +ELQ 
Sbjct: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121

Query: 239 GTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSV 298
           GTLS       A+             DL LKYM   YL MV++A   PFHK YDKPFRSV
Sbjct: 122 GTLSDVFA---AHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178

Query: 299 QIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELC 358
           QIFQKDFGQIIGQGFSDRH VKVQG RRKLMG+ARNWLTANALKPYHSWVYWRDADVELC
Sbjct: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238

Query: 359 PGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVE 418
           PGSVI+DLMS  +DV VPNVWRPLPEFL  EQ YDLNSWIESD AL LA+TLDEDDVIVE
Sbjct: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298

Query: 419 GYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXX 478
           GYAEY TWR HLA  RDP  N  D+++LDGVGGVSILAKAKLFRNGVH            
Sbjct: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358

Query: 479 XXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRRS 524
              GKMAKKMGYRV GL HYTLWHIYEPS+DDL++IA +ER  +RS
Sbjct: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/496 (57%), Positives = 350/496 (70%), Gaps = 7/496 (1%)

Query: 31  NVPLSPQNSRYHPKVK-GKFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYA 89
           N  L    S+ +PK K   F +  S   +    +L+++ C       +    GS+  S  
Sbjct: 17  NYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMFKFLSTVILGSSESSSP 76

Query: 90  GLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGTLNSNQEE--GF 147
                + SYDT  L +  YY++++  +D D ++++D+G  +  I Q G      EE   F
Sbjct: 77  LPSIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKF 136

Query: 148 EEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPH 207
           E+ + MLL +TVE YD+ ++ GT N AEN+EHVL+CVPLR+AENVLPLMF+HLMN+TYPH
Sbjct: 137 EQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPH 196

Query: 208 ELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLH 267
           ELIDLAFLVSDCS+ DHT+D+LI+Y+ +LQ GTLS+      A              +L+
Sbjct: 197 ELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVF----AEVEMSEKERKKGGENLY 252

Query: 268 LKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRK 327
           L+YM++DYL  V+++   PFH+NYDK FRSVQIFQKDFGQ IGQGFSDRH VKVQG RRK
Sbjct: 253 LQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRK 312

Query: 328 LMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLG 387
           LM +ARNWLTANALKPYHSWVYWRDADVELCPGSVI+DLM+  YDV+VPNVWRPLP FL 
Sbjct: 313 LMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLD 372

Query: 388 SEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLD 447
            +Q YDLNSWIES  AL+LAKTLDEDDVIVEGYAEY TWR HLA  RD  G+  +V++LD
Sbjct: 373 GQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLD 432

Query: 448 GVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPS 507
           GVGGVSILA+A+LFR G+H               GKMAKKMG+RVGGL HYTLWHIYEPS
Sbjct: 433 GVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPS 492

Query: 508 NDDLMEIARKERSSRR 523
           +DDL EI  KER  RR
Sbjct: 493 DDDLKEIGNKEREKRR 508

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/469 (59%), Positives = 333/469 (71%), Gaps = 14/469 (2%)

Query: 64  LLTIACIFFLIKQTMDRNGSTP----------RSYAGLLSISDSYDTAV-LEESEYYNFE 112
           L T   I+ L K T+  +   P           SY    S + +Y  A  LE+ EYY+++
Sbjct: 47  LATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYD 106

Query: 113 YRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGT 170
           +R +D  +   +D G +H LI Q G   + S  +E + + ++ LLS++V+ YDLS++ GT
Sbjct: 107 FRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGT 166

Query: 171 ANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLI 230
           ANGAENREH+L   PLR+AE+VLP+MF+HLMNLTYPHELID+AFLVSDCS+ D T+D+LI
Sbjct: 167 ANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLI 226

Query: 231 SYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKEPFHKN 290
           ++A  LQ GTL    K  DA                +LK+M+++Y+ M + +   P H  
Sbjct: 227 TFARHLQDGTLVDIFKDMDA-SIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNE 285

Query: 291 YDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYW 350
           Y+KPFRSVQIFQKDFGQIIGQGFSDRH VKVQG RRKLMG+ARNWLTANALKPYHSWVYW
Sbjct: 286 YNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYW 345

Query: 351 RDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTL 410
           RDADVELCPGSVI+DLMS  YDVIVPNVWRPLPEFL  EQ YDLNSW+ES  AL LAKTL
Sbjct: 346 RDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTL 405

Query: 411 DEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXX 470
           DEDDVIVEGYAEY TWR HLA  RDP G+    LD+DGVGGVSILAKAKLFR+GVH    
Sbjct: 406 DEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAF 465

Query: 471 XXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKER 519
                      GKMAKKMGY VGGL +Y LWHIYEPS+DDL ++A  ER
Sbjct: 466 TFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/419 (61%), Positives = 317/419 (75%), Gaps = 8/419 (1%)

Query: 103 LEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGTLNSNQEE--GFEEHLDMLLSTTVE 160
            +++ Y++F++  +D+D V ++D G  + LI + GT N ++ +   + ++L MLL +TVE
Sbjct: 98  FKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVE 157

Query: 161 TYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCS 220
            YDL  + G+A+G E +EH+L+CVPLR+AE VLPLMF++LMNLTYPHELIDLAFLVSDCS
Sbjct: 158 KYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCS 217

Query: 221 KDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVE 280
           + D T+++L +Y++ LQ+G L   L   D Y              +HLKYM  DYL  V+
Sbjct: 218 EGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSNES------IHLKYMEPDYLKRVK 271

Query: 281 NALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANA 340
            A K PFH NY KPFRSVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWL +NA
Sbjct: 272 AAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNA 331

Query: 341 LKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIES 400
           LKPYHSWVYWRDADVELCPGSVIEDLM   YDVIVPNVWRPLP+FL S Q YDLNSW+ES
Sbjct: 332 LKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMES 391

Query: 401 DNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKL 460
           + AL LAKTLDEDDVIVEGYAEY T+R HLA  R+  G+   V+DLDGVGGVSILA+A++
Sbjct: 392 NEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARV 451

Query: 461 FRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKER 519
           FR GVH               GKMAKK+G+RVGGL HYTLWHIYEPS+DDL+ +A+ E+
Sbjct: 452 FREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEK 510

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/480 (56%), Positives = 344/480 (71%), Gaps = 14/480 (2%)

Query: 50  NFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDS----YDTAVLEE 105
           NFR      NV +S++ + CIF  I +T+  N S  + Y   +   ++    +DT VL  
Sbjct: 46  NFRDKVSNFNVALSVILL-CIF--IAKTISVNVSIYK-YNSFVHEEETETVTFDTQVLTA 101

Query: 106 SEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT-----LNSNQEEGFEEHLDMLLSTTVE 160
            EYYN+++   +LDT+ +YD G +  L+D   T     L+   +E ++  L  LLS++V+
Sbjct: 102 PEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVD 161

Query: 161 TYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCS 220
            YD+  ++GT++G  +REHVL+C+PLR+AE+VLPLMF++LMNLTYPHELID+AFLVSDCS
Sbjct: 162 IYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCS 221

Query: 221 KDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXE-GDLHLKYMNKDYLNMV 279
           ++DHT++SL+ Y   LQ GTL    +  D             +   L+LKYM K+YL  V
Sbjct: 222 ENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRV 281

Query: 280 ENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTAN 339
           + A K PFH+NYDKPFRS+QI++KDFGQ +GQ FSDRH VKVQG RRKLMG+ARNWL  N
Sbjct: 282 KEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTN 341

Query: 340 ALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIE 399
           ALKPYHSWVYWRDADVELCPG+VIEDLMS  +DVIVPNVWRPLPEF+ SEQ YDLNSW+E
Sbjct: 342 ALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWME 401

Query: 400 SDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAK 459
           S  A++LAK L ED+VIVEGYAEY TWR HLA  R+  G+   V+D+DGVGGVSILA+A+
Sbjct: 402 SREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARAR 461

Query: 460 LFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKER 519
           LFR GVH               GKMAKKMG+RVGGL HYTLWHIYEPS+DDLM IA KE+
Sbjct: 462 LFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEK 521

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  501 bits (1289), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 267/340 (78%), Gaps = 3/340 (0%)

Query: 184 VPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSK 243
           VPLRNA+ VLPLMF++LMNLTYPHELIDLAFLVSDCS+DD T ++L+ YA+ELQ GTLS+
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 244 SLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQK 303
                 ++             DL LKYM   YL MV++A   PFHKNYDKPFRSVQIFQK
Sbjct: 62  VFA---SHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQK 118

Query: 304 DFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVI 363
           +FGQ+IGQ FSDRH VKVQGTRRKLMG+ARNWLTANALKPYHSWVYWRDADVELCPGSVI
Sbjct: 119 NFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 178

Query: 364 EDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEY 423
           EDLM+ GYDV VPNVWRPLPEFL  EQ YDLNSW+ESD AL+LAK LDEDDVIVEGYAEY
Sbjct: 179 EDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEY 238

Query: 424 ATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGK 483
            TWR HL   R+  G+    +DLDGVGGVSILAKA+LFRNGVH               GK
Sbjct: 239 PTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGK 298

Query: 484 MAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRR 523
           MAKKMGY V GL HYTLWHIYEPS+DDL+++  +ER S+R
Sbjct: 299 MAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 178/365 (48%), Positives = 222/365 (60%), Gaps = 53/365 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL+ Y G  +G +  + +L CVPLR+A   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S  D+TM  L+ + ++ Q                                         
Sbjct: 114 SS--DNTMGVLMHHLQQAQ----------------------------------------- 130

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                     K+ +K F +++IF+KDFGQIIGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 131 ----------KDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 180

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            A+KPYHSWVYWRD DVE+ P S++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW+
Sbjct: 181 VAIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 240

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA TL ED VIVEGY EYATWR HLA  RDP GN  D + LDG+GGVSIL+KA
Sbjct: 241 ESEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKA 300

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           ++FR G H               GK++++MG+ V GL HY +WHIYEPS DDL  +A   
Sbjct: 301 RVFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMA 360

Query: 519 RSSRR 523
              +R
Sbjct: 361 EEEKR 365

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  345 bits (886), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 175/365 (47%), Positives = 219/365 (60%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           V+ YDLS Y G  +G +  + VL CVPLR+A N LP+ F+HL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            + D  TM  L++   +LQ                                         
Sbjct: 110 STDD--TMGVLLNSLHDLQS---------------------------------------- 127

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                      +  K F  ++IFQKDFGQIIGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 128 ---------QADGTKRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 178

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            A+KPYHSWVYWRD DVE  P +++EDLM    D+IVPNVWRPLP++L   Q YDLNSW+
Sbjct: 179 AAIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWV 238

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA +L EDDVIVEGY EYATWR HLA  RDP G+    ++LDG+GGVSIL+KA
Sbjct: 239 ESEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKA 298

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR G H               GK++++M Y V GL HY +WH+YEPS+DDL  +A   
Sbjct: 299 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMA 358

Query: 519 RSSRR 523
              +R
Sbjct: 359 EEEQR 363

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  347 bits (889), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/360 (49%), Positives = 219/360 (60%), Gaps = 51/360 (14%)

Query: 156 STTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFL 215
           + +VE YDL  Y G  +G +  + +L CVPLR+A   LP+ F HL  +TYPH LIDL+FL
Sbjct: 59  TPSVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 216 VSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDY 275
           VSD S  D+TM  L+S  +  Q                                      
Sbjct: 119 VSDSS--DNTMGVLLSNLQMAQS------------------------------------- 139

Query: 276 LNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNW 335
                        ++  K F +++I++KDFGQIIGQ FSDRH    QG RRKLM +ARNW
Sbjct: 140 ------------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNW 187

Query: 336 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLN 395
           L + ALKPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLN
Sbjct: 188 LGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLN 247

Query: 396 SWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSIL 455
           SW ES+  L LA +LDED VIVEGY EYATWR HLA  RDP GN  D ++LDG+GGVSIL
Sbjct: 248 SWKESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSIL 307

Query: 456 AKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
           AKAK+FR G H               G+++++M Y V GL HY +WHIYEPS+DDL  +A
Sbjct: 308 AKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  345 bits (884), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 178/367 (48%), Positives = 221/367 (60%), Gaps = 51/367 (13%)

Query: 157 TTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLV 216
              E YDL  Y G +NG +  + +L CVPLR+A   LP+ F+HL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 217 SDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYL 276
           SD SKDD TM  L+S  +  Q                                       
Sbjct: 125 SD-SKDD-TMGVLLSNLQTAQS-------------------------------------- 144

Query: 277 NMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWL 336
                       K+  K F +++ F+KDFGQIIGQ FSDRH    QG RRKLM +ARNWL
Sbjct: 145 -----------QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWL 193

Query: 337 TANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNS 396
            + A+KPYHSWVYWRD DVE  P +++EDLM  G DVIVPNVWRPLPE+LG+ Q YDLNS
Sbjct: 194 GSVAIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNS 253

Query: 397 WIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILA 456
           W ESD  L LA +LD+D VIVEGY EYATWR HLA  RDP G+    ++LDG+GGVSIL+
Sbjct: 254 WQESDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILS 313

Query: 457 KAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIAR 516
           KA++FR+G H               GK++++MGY V GL HY +WHIYEPS +DL  +A 
Sbjct: 314 KARVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAW 373

Query: 517 KERSSRR 523
                +R
Sbjct: 374 MAEEEQR 380

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 217/357 (60%), Gaps = 51/357 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G  +G +  + +L CVPLR+A   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S  D+TM  L+S         L K+   QD                             
Sbjct: 122 SS--DNTMGVLLS--------NLHKAQSQQDK---------------------------- 143

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                         K F +++I++KDFGQIIGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 144 -------------SKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA  L+ED VIVEGY EYATWR HLA  RDP GN  D ++LDG+GGVSILAKA
Sbjct: 251 ESEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
           K+FR G H               G+++++M Y V GL HY +WHIYEPS+DDL  +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 178/365 (48%), Positives = 222/365 (60%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G  +G +  + +L CVPLR+A   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S  D+TM  L+S               LQ+A                            
Sbjct: 142 SS--DNTMGVLLS--------------NLQNAQS-------------------------- 159

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                     ++  K F +++IF+KDFGQIIGQ FSDRH  K QG RRKLM +ARNWL +
Sbjct: 160 ---------QQDRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGS 210

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            A+KPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 211 VAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 270

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA +LDED VIVEGY EYATWR HLA  RDP GN  D ++L+G+GGVSIL+KA
Sbjct: 271 ESEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKA 330

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR+G H               GK++++M + V GL HY +WHIYEPS +DL  +A   
Sbjct: 331 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMA 390

Query: 519 RSSRR 523
              +R
Sbjct: 391 EEEKR 395

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  347 bits (891), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 224/365 (61%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           V  YDL+ Y G ++G +  + +L CVPLR+A   LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            SKDD TM  L+S+ +  Q                                         
Sbjct: 132 -SKDD-TMGVLLSHLQTAQSQ--------------------------------------- 150

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
            +N LK          F +++I++KDFGQIIGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 151 -QNKLKR---------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 200

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE CP +++EDLM  G DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 201 VALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 260

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA +LDED VIVEGY EYATWR HLA  RDP G+  + ++LDG+GGVSIL+KA
Sbjct: 261 ESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKA 320

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR+G H               GK++++M Y V GL HY +WHIYEPS +DL  +A   
Sbjct: 321 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMA 380

Query: 519 RSSRR 523
              +R
Sbjct: 381 EEEKR 385

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  344 bits (883), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 223/365 (61%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           V+ YDL  Y G A+G +  +HVL  VPLR+A   LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVSD 112

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM  L+ Y   LQK   SK  + Q                              
Sbjct: 113 SSDD--TMGVLLEY---LQKAQ-SKPDRTQR----------------------------- 137

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                           F +++I++KDFGQ IGQ FSDRH    QG RRKLMG+ARNWL +
Sbjct: 138 ----------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA++LDED VIVEGY EYATWR HLA  RDP G+  D ++LDG+GGVSIL+KA
Sbjct: 242 ESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKA 301

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR G H               GK+++++GY V GL HY +WHIYEPS+DDL  +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 519 RSSRR 523
              +R
Sbjct: 362 EEEKR 366

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  344 bits (883), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 216/357 (60%), Gaps = 51/357 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G  +G +  + +L CVPLR+A   LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S  D+TM  L+S  +  Q                                         
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------------------------------- 139

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                     ++  K F +++I++KDFGQIIGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 140 ---------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DV+  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA  LDED VIVEGY EYATWR HLA  RDP GN  D ++LDG+GGVSILAKA
Sbjct: 251 ESEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
           K+FR G H               G+++++M Y V GL HY +WHIYEPS+DDL  +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  344 bits (883), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 176/357 (49%), Positives = 215/357 (60%), Gaps = 51/357 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL+ Y G  +G +  + +L CVPLR+A   LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM  L+S  +  Q                                         
Sbjct: 147 SSDD--TMGVLLSNLQNAQS---------------------------------------- 164

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                     ++  K F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 165 ---------QQDKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGS 215

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            A+KPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 216 VAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 275

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA TL EDDVIVEGY EYATWR HLA  RDP GN  D ++LDG+GGVSILAKA
Sbjct: 276 ESEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKA 335

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
           K+FR G H               GK+++KM Y V GL HY +WHIYEPS +DL  +A
Sbjct: 336 KVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  344 bits (882), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 218/357 (61%), Gaps = 51/357 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G  +G +  + +L CVPLR+A   LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S  D+TM  L+S              KLQ A                            
Sbjct: 122 SS--DNTMGVLLS--------------KLQMAQS-------------------------- 139

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                     ++  K F +++I++KDFGQIIGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 140 ---------QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA  LDED VIVEGY EYATWR HLA  RDP GN  D ++LDG+GGVSILAKA
Sbjct: 251 ESEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
           K+FR G H               G+++++M Y V GL HY +WHIYEPS+DDL  +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  342 bits (878), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 220/365 (60%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G  +G +  + VL  VPLR+A   LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM  L+ + ++ Q  T  K                                   
Sbjct: 113 SSDD--TMGVLLDHLKKAQSKTDRK----------------------------------- 135

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                         K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMG+ARNWL +
Sbjct: 136 --------------KRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  + LA++LDED VIVEGY EYATWR HLA  RDP GN  D ++LDG+GGVSIL+KA
Sbjct: 242 ESEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKA 301

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR G H               GK+++++GY V GL HY +WHIYEPS+DDL  +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 519 RSSRR 523
              +R
Sbjct: 362 EEEKR 366

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  342 bits (878), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 176/365 (48%), Positives = 222/365 (60%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL+ Y G A+G +  + VL CVPLR+A   LP+ F+H+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM  L+S        +L K+   QD                             
Sbjct: 142 SSDD--TMGVLLS--------SLKKAQSNQDK---------------------------- 163

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                         + F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 164 -------------SQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGS 210

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 211 VALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWK 270

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA +L+ED VIVEGY EYATWR HLA  RDP G+    ++LDG+GGVSIL+KA
Sbjct: 271 ESEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKA 330

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR G H               GK++++M Y V GL HY +WH+YEPS+DDL  +A   
Sbjct: 331 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMA 390

Query: 519 RSSRR 523
              +R
Sbjct: 391 EEEKR 395

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  341 bits (875), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/410 (45%), Positives = 239/410 (58%), Gaps = 61/410 (14%)

Query: 115 PLDLDTVRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGA 174
           PL +  +  + +   H  I  + T N ++   F++        +VE YD+S Y G  +G 
Sbjct: 17  PLSICAIFLFLNKLLHSWIIDEFTRNEHRIPDFQD------IPSVEFYDMSNYQGHKDGW 70

Query: 175 ENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAE 234
                +LICVPL++A N LPL F+ L  +TYPHELIDL+FLVSD S  D+TM +L++  +
Sbjct: 71  NQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVSDSS--DNTMYNLLNMLK 128

Query: 235 ELQ--KGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKEPFHKNYD 292
            LQ   GT  K                                                 
Sbjct: 129 RLQIDGGTSGK------------------------------------------------- 139

Query: 293 KPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRD 352
             F +++I++KDFGQ+IGQGFSDRH    QG RRKLMGKARNWL   A+KPYHSWVYWRD
Sbjct: 140 --FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAIKPYHSWVYWRD 197

Query: 353 ADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDE 412
            DVE+ P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW ES+  L L+ +L E
Sbjct: 198 VDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEAGLALSNSLGE 257

Query: 413 DDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXX 472
           D VIVEGY EYATWR HLA  RDP G+    ++LDGVGGVSIL+KA +FR+G H      
Sbjct: 258 DAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVFRSGSHFPAFSF 317

Query: 473 XXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSR 522
                    GK++K M + V GL +Y +WHIYEPS +DL  +A+ E   R
Sbjct: 318 KKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEKER 367

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  338 bits (866), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 178/366 (48%), Positives = 218/366 (59%), Gaps = 52/366 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE +DLS   G A+G    + VL CVPLR+A   LP+ F+HL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
               D TM  L  +  ELQ                                       + 
Sbjct: 102 SK--DETMSVLRQHVRELQ---------------------------------------SQ 120

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
            +NA          + F +++IFQKDFGQ IGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 121 PDNA----------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 170

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE  P ++IEDLM    DVIVPNVWRPLP++LG  Q YDLNSW+
Sbjct: 171 VALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWV 230

Query: 399 ESDNALNLAK-TLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAK 457
           ES+  L LA  T DED VIVEGY EYATWR HLA  RDP G+    ++LDG+GGVSIL++
Sbjct: 231 ESEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSR 290

Query: 458 AKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARK 517
           A++FR+G H               GK+++ MGY V GL HY +WHIYEPS+DDL  +A  
Sbjct: 291 ARVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWM 350

Query: 518 ERSSRR 523
               +R
Sbjct: 351 AEEEQR 356

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  338 bits (867), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/365 (47%), Positives = 219/365 (60%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G ++G +  + +L CVPLR+A   LP+ F HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM  L+S+ +  Q   + KS                                  
Sbjct: 122 SSDD--TMGVLLSHLQSAQS-QMDKS---------------------------------- 144

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                         K F +++I++KDFGQIIGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 145 --------------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 190

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHSWVYWRD DVE  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 250

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA+ L+ED VIVEGY EYATWR HLA  RDP G+  + ++LDG+GGVSIL+KA
Sbjct: 251 ESEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKA 310

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR G H               G+++++M Y V GL HY +WHIYEPS +DL  +A   
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMA 370

Query: 519 RSSRR 523
              +R
Sbjct: 371 EEEKR 375

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  344 bits (882), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 220/364 (60%), Gaps = 51/364 (14%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D   +  VE YDLS Y G  +G +  + +L C+PLR+A   LP+ F H+  +TYPH L+D
Sbjct: 59  DFKNTPGVEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVD 118

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L+FLVSD S D  TM  L+S+ + +Q                                  
Sbjct: 119 LSFLVSDSSDD--TMGVLLSHLQTVQS--------------------------------- 143

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                            ++  K F +++I++KDFGQIIGQ FSDRH    QG RRKLM K
Sbjct: 144 ----------------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAK 187

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQE 391
           ARNWL + ALKPYHSWVYWRD D+E  P +++EDLM    D+IVPNVWRPLP++LG+ Q 
Sbjct: 188 ARNWLGSVALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQP 247

Query: 392 YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGG 451
           YDLNSW ES+  L LA  LDE+ VIVEGY EYATWR HLA  RDP G+  D ++LDG+GG
Sbjct: 248 YDLNSWQESEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGG 307

Query: 452 VSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDL 511
           VSIL+KAK+FR+G H               GK++++M Y V GL HY +WHIYEPS +DL
Sbjct: 308 VSILSKAKVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDL 367

Query: 512 MEIA 515
             +A
Sbjct: 368 KHMA 371

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  331 bits (849), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 174/366 (47%), Positives = 214/366 (58%), Gaps = 52/366 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G  +G +    +L  VPLR+A   LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM  L+ + +  Q                                         
Sbjct: 117 SSDD--TMGELLHHLQIAQS---------------------------------------- 134

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                     K+ +K F +++IF+KDFGQ IGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 135 ---------QKDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 185

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
             LKPYHSWVYWRD DVE+ P S++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 186 VTLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 245

Query: 399 ESDNALNLAKTL-DEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAK 457
           ES+  + LA TL DED VIVEGY E+ATWR HLA  RDP GN  D ++LDG+GGVSILAK
Sbjct: 246 ESEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAK 305

Query: 458 AKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARK 517
           AK+FR G H               GK++++M Y V GL HY +WHIYEPS +DL  +A  
Sbjct: 306 AKVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWM 365

Query: 518 ERSSRR 523
               +R
Sbjct: 366 AEEEKR 371

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  329 bits (844), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 171/365 (46%), Positives = 216/365 (59%), Gaps = 51/365 (13%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G ANG +  + V+ CVPLR+A   L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM +L+S+    Q                                         
Sbjct: 117 SSDD--TMKTLLSHLRRAQS---------------------------------------- 134

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                    +++  + F +++IF+KDFGQ +GQ FSDRH    QG RRK M +ARNWL +
Sbjct: 135 ---------NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGS 185

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALKPYHS+VYWRD DV+  P +++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW+
Sbjct: 186 AALKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 245

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           ES+  L LA +LDED  IVEGY EYATWR HLA  RDP G+    ++LDG+GGVSIL+KA
Sbjct: 246 ESEGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKA 305

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKE 518
           K+FR G H               GK++++M Y V GL HY +WHIYEPS+DDL  +A   
Sbjct: 306 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 365

Query: 519 RSSRR 523
              +R
Sbjct: 366 EEEKR 370

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  332 bits (850), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 168/360 (46%), Positives = 213/360 (59%), Gaps = 51/360 (14%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D   +  VE YDL  Y G  +G +  + ++ CVPLR+A   LP  F HL  ++YPH LID
Sbjct: 58  DFRDTPNVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLID 117

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L+FLVSD S D  TM  L+S  +  Q                                  
Sbjct: 118 LSFLVSDSSDD--TMGVLLSNLQTAQS--------------------------------- 142

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                            ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM +
Sbjct: 143 ----------------QRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMAR 186

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQE 391
           ARNWL + ALKPYHSWVYWRD D+E  P +++EDLM    D+IVPNVWRPLP++LG+ Q 
Sbjct: 187 ARNWLGSVALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQP 246

Query: 392 YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGG 451
           YDLNSW ES+  L LA  L+ED VIVEGY EYATWR HLA  RDP G+    ++LDG+GG
Sbjct: 247 YDLNSWQESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGG 306

Query: 452 VSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDL 511
           VSIL+KA +FR+G H               GK++++MGY V GL HY +WHIYEPS +DL
Sbjct: 307 VSILSKANVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  332 bits (850), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 214/358 (59%), Gaps = 52/358 (14%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           VE YDL  Y G  +G +    +L  VPLR+A   LP  F H+  +TYPH LID +FLVSD
Sbjct: 63  VEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVSD 122

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            S D  TM +L+S+ E+ Q                                         
Sbjct: 123 SSDD--TMGALLSHLEKAQS---------------------------------------- 140

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                    +K+  + F +++I++KDFGQ IGQ FSDRH    QG RRKLM +ARNWL  
Sbjct: 141 ---------NKDKTRRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGT 191

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWI 398
            ALK YHSWVYWRD DVELCP S++EDLM    DVIVPNVWRPLP++LG+ Q YDLNSW 
Sbjct: 192 VALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 251

Query: 399 ESDNALNLAKTLDEDD-VIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAK 457
           ES+  + LA +L +DD VIVEGY +Y+TWR HLA  RDP GN  D L+LDG+GGVSIL+K
Sbjct: 252 ESEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSK 311

Query: 458 AKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515
            K+FR G H               GK++++MGY V GL HY +WHIYEPS +DL  +A
Sbjct: 312 GKVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  166 bits (419), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 169/360 (46%), Gaps = 62/360 (17%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D++    +  YDL+K   T+N   N+E VLI  P++         + +L++LTYP  LI+
Sbjct: 89  DLIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIE 145

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F++   +  D  +  L                                          
Sbjct: 146 LGFIIPRTASGDAALQKL------------------------------------------ 163

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                   E+A++E      DK F  + I ++        G  DRH ++VQ  RR  M  
Sbjct: 164 --------ESAVREVQTGKQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMAL 215

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQE 391
           ARN L  + + P+ SW+ W DAD+   P +VI+DL S    V+  NV++   +F   +Q+
Sbjct: 216 ARNELLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQK 272

Query: 392 ------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLD 445
                 YD N+W ES+  L LA+ L ++++IVEGY+E AT+R  +A+  D  G T  +++
Sbjct: 273 KESIRPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLME 332

Query: 446 LDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           LDGVGG   L KA++ R+G                  KMAK++GY V GL +Y ++HI E
Sbjct: 333 LDGVGGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  160 bits (406), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 130/464 (28%), Positives = 203/464 (43%), Gaps = 86/464 (18%)

Query: 53  LSYKLKN-----VIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYDTAVLEESE 107
           +SYKL+      VI+ +++I  +F +      RNG  P      LSIS+      +E + 
Sbjct: 7   ISYKLRKNPFLLVILPIISILAVFLIFI----RNGEHPMLGIENLSISNHKWAHEVENTW 62

Query: 108 YYNFEYRPLDLDTVRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLLSTT-VETYDLSK 166
           Y+ F              + FK   + +           F +H+D ++    +  YDL+K
Sbjct: 63  YFPF-------------TNKFK---MPKYSYKRKQSNWLFNDHVDDIIPEGHIAHYDLNK 106

Query: 167 YAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTM 226
              TA  A N+E VLI  P++         + +L+ LTYP ELI+L F++      ++ +
Sbjct: 107 LRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPRTKTGENAL 163

Query: 227 DSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKEP 286
             L                                                  E A+K+ 
Sbjct: 164 KEL--------------------------------------------------EIAIKKV 173

Query: 287 FHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHS 346
                ++ F  + I ++D          DRH + VQ  RR  M  ARN L  + L P+ +
Sbjct: 174 QSDKKNQRFAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMALARNELLFSTLGPHTA 233

Query: 347 WVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQE-----YDLNSWIESD 401
           WV W DAD+   P +VI+D+ S    V+  NV++    F   E++     YD N+W ESD
Sbjct: 234 WVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIRPYDFNNWRESD 291

Query: 402 NALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLF 461
             L +A  +DE+++IVEGY+E AT+R  +A+  +  G   D ++LDGVGG   L KA + 
Sbjct: 292 IGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVKADVH 351

Query: 462 RNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           R+G                  KMAK++ Y V GL +Y ++HI E
Sbjct: 352 RDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  159 bits (402), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 103/360 (28%), Positives = 166/360 (46%), Gaps = 62/360 (17%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D++    +  YDL+K   T +  + +EHVLI  P++   +     + +L+ ++YP  L++
Sbjct: 89  DIIPEGHIAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLE 145

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F++      D T+  L +  + +Q G      K++D                      
Sbjct: 146 LGFIIPRTPTGDETLKKLEAAVKNVQTG------KVEDR--------------------- 178

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                                  F  + I ++D       G  +RH + VQ  RR  M  
Sbjct: 179 -----------------------FAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMAL 215

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQE 391
           ARN L  +++ P  SWV W DAD+   P +VI+D+ +    V+  NV++    F   E+ 
Sbjct: 216 ARNELLFSSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ---RFFDKEKN 272

Query: 392 ------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLD 445
                 YD N+W ES+  L +AK ++ED++IVEGYAE AT+R  +A+  D  G    ++ 
Sbjct: 273 ENSIRPYDFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMA 332

Query: 446 LDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           LDGVGG   L KA++ R+G                  KMAK++ Y + GL +Y ++HI E
Sbjct: 333 LDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  157 bits (396), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 110/372 (29%), Positives = 177/372 (47%), Gaps = 69/372 (18%)

Query: 147 FEEHL-DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTY 205
           F  H+ D++    +  YDL+K   T++ A N+E VLI  P++   +     +++L+ LTY
Sbjct: 81  FNRHVEDIIPENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTY 137

Query: 206 PHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGD 265
           P ELI+L F++                                               GD
Sbjct: 138 PRELIELGFILPRSDS------------------------------------------GD 155

Query: 266 LHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKD---FGQIIGQGFSDRHHVKVQ 322
             LK         +E A+K+      ++ F  + I ++D   FGQ++ +   +RH + VQ
Sbjct: 156 AALK--------ALEAAVKKVQTDKKNQRFSKITILRQDSQGFGQLMEK---ERHALHVQ 204

Query: 323 GTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPL 382
             RR  M  ARN L  + + P+ SWV W DAD+   P +VI+D+ +    V+  NV++  
Sbjct: 205 KERRAAMALARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ-- 262

Query: 383 PEFLGSEQE------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDP 436
             +   E++      YD N+W ESD  L +A  +++D++IVEGY+E AT+R  +A+  DP
Sbjct: 263 -RYFDEEKKEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDP 321

Query: 437 QGNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLS 496
             +    + LDGVGG   L KA + R+G                  KMAK++ Y V GL 
Sbjct: 322 TASVNSEMMLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLP 381

Query: 497 HYTLWHIYEPSN 508
           +Y ++H+ E +N
Sbjct: 382 NYLVYHMEEFNN 393

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  156 bits (394), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 171/360 (47%), Gaps = 62/360 (17%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D++ +  +  YDL+K   T N A N+E VLI  P++N        + +L+ LTYP ELI+
Sbjct: 88  DVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIE 144

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F+V      +  ++ L +  +++Q G      K +D +                    
Sbjct: 145 LGFIVPRTGSGNVALEQLEAAVKKVQTG------KKEDRFGK------------------ 180

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
               + ++  A      +++DK      + +K+           RH ++VQ  RR  M  
Sbjct: 181 ----ITILRQA-----SQSFDK------LLEKE-----------RHALEVQKERRAAMAL 214

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQE 391
           ARN L  + + PY SW+ W DAD+   P SVIED+ +    V+  NV++    +   EQ+
Sbjct: 215 ARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQK 271

Query: 392 ------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLD 445
                 YD N+W ESD  L LA  +  D+++VEGY E AT+R  +A+  +        ++
Sbjct: 272 KESIRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEME 331

Query: 446 LDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           LDGVGG   L KA + R+G                  KMAK++GY V GL +Y ++HI E
Sbjct: 332 LDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  154 bits (390), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 127/463 (27%), Positives = 203/463 (43%), Gaps = 76/463 (16%)

Query: 48  KFNFRLSYKL-KNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYDTAVLEES 106
           K + RLSYKL KN+++++L    I   I  T   N     S+   L+I+ +  T   + S
Sbjct: 2   KASARLSYKLRKNLVLAILLPFTIIITIYLTFFHNRGGSSSFT--LNITKNRWTRETQAS 59

Query: 107 EYYNFEYRPLDLDTVRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLLSTT-VETYDLS 165
                 Y P      R     +K +           Q   F EH+D ++S   +  +DL+
Sbjct: 60  S----SYLPFT-SKFRIPKYSYKKV-----------QNWMFNEHIDEIISEGHIAEFDLN 103

Query: 166 KYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHT 225
           K   T + + N+E VLI  PL+         + +++ L+YP ELI+L F+V      D  
Sbjct: 104 KLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIELGFIVPRTQTGDLA 160

Query: 226 MDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVENALKE 285
           + SL                                                  E A+++
Sbjct: 161 LQSL--------------------------------------------------EKAVEK 170

Query: 286 PFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYH 345
                 ++ F  V I ++D          +RH + VQ  RR  M  ARN L  + + P+ 
Sbjct: 171 TQTDKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFSTIGPHT 230

Query: 346 SWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPL---PEFLGSEQEYDLNSWIESDN 402
           SWV W DAD+   P ++I+D+ +    V+  NV++      +   + + YD N+W ES+ 
Sbjct: 231 SWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNWQESEI 290

Query: 403 ALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFR 462
            L LA  +++D++IVEGY+E AT+R  +A   D      + + LDGVGG   L KA++ R
Sbjct: 291 GLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAEVHR 350

Query: 463 NGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           +G                  KMAK++GY + GL +Y ++HI E
Sbjct: 351 DGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  152 bits (385), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 106/366 (28%), Positives = 167/366 (45%), Gaps = 63/366 (17%)

Query: 147 FEEHLDMLLSTT-VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTY 205
           F++H+D ++    +  YDL+K   T++ A N+E +LI  P++         + +L+ LTY
Sbjct: 81  FDDHVDEIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTY 137

Query: 206 PHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGD 265
           P ELI+L F+       D  + +L                                    
Sbjct: 138 PRELIELGFIAPRTPTGDQALAAL------------------------------------ 161

Query: 266 LHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTR 325
                         E A+ +      ++ F  V I ++D          +RH ++VQ  R
Sbjct: 162 --------------EAAVDKVQSDKKNQRFSKVTILRQDSVGFNKLTEKERHALEVQKER 207

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEF 385
           R  M  ARN L  + + P+ SWV W DAD+   P S+I+D+ +    V+  NV++    +
Sbjct: 208 RASMALARNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ---RY 264

Query: 386 LGSEQE------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGN 439
              E++      YD N+W ESD  L LA  + +D++IVEGYAE AT+R  +A   DP  +
Sbjct: 265 YDEEKKQKAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNS 324

Query: 440 TMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYT 499
             + + LDGVGG   L KA++ R+G                  KMAK++ Y V GL +Y 
Sbjct: 325 VAEEMRLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYL 384

Query: 500 LWHIYE 505
           ++HI E
Sbjct: 385 VYHIEE 390

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  151 bits (382), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 107/366 (29%), Positives = 169/366 (46%), Gaps = 63/366 (17%)

Query: 147 FEEHL-DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTY 205
           F +H+ D++    +  YDL+K   T++ A N+EHVLI  P++         + +L+ L+Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSY 139

Query: 206 PHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGD 265
           P ELI+L F+    +                                           GD
Sbjct: 140 PRELIELGFITPRTAT------------------------------------------GD 157

Query: 266 LHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTR 325
           L LK +        ENA+K+       + F  + I +++          +RH + VQ  R
Sbjct: 158 LALKNL--------ENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKERHALDVQKER 209

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEF 385
           R  M  ARN L  + + P+ SW+ W DAD+   P S+I+D+      V+  N+++    F
Sbjct: 210 RAAMALARNELLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RF 266

Query: 386 LGSEQE------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGN 439
              E++      YD N+W ESD  L +A  + +D++IVEGYAE AT+R  +A++ +  G 
Sbjct: 267 YDQEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGL 326

Query: 440 TMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYT 499
             + + LDGVGG   L KA + R+G                  KMAK++ Y V GL +Y 
Sbjct: 327 PNEEMALDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYL 386

Query: 500 LWHIYE 505
           ++HI E
Sbjct: 387 VYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  151 bits (381), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 107/366 (29%), Positives = 167/366 (45%), Gaps = 63/366 (17%)

Query: 147 FEEHL-DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTY 205
           F +H+ D++    +  YDL+K   T+  A N+EH+LI  P++         + +L+ L Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNY 139

Query: 206 PHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGD 265
           P ELI+L F+    +                                           GD
Sbjct: 140 PRELIELGFITPRTAT------------------------------------------GD 157

Query: 266 LHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTR 325
           L LK +        ENA+K+       + F  + I +++          +RH + VQ  R
Sbjct: 158 LALKKL--------ENAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKERHALDVQKER 209

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEF 385
           R  M  ARN L  + + P+ SWV W DAD+   P S+I+D+      ++  N+++    F
Sbjct: 210 RAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RF 266

Query: 386 LGSEQE------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGN 439
              E++      YD N+W ESD  L +A  + +D++IVEGYAE AT+R  +A+  D  G 
Sbjct: 267 YDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGV 326

Query: 440 TMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYT 499
             + + LDGVGG   L KA++ R+G                  KMAK++ Y V GL +Y 
Sbjct: 327 PGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYL 386

Query: 500 LWHIYE 505
           ++HI E
Sbjct: 387 VYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  151 bits (381), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 163/366 (44%), Gaps = 63/366 (17%)

Query: 147 FEEHLDMLLSTT-VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTY 205
           F +H+D ++    +  YDL+K   T   A N+E VLI  P++         + +++++TY
Sbjct: 84  FNDHVDDIIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTY 140

Query: 206 PHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGD 265
           P ELI+L F+       D  +  L                                    
Sbjct: 141 PRELIELGFIAPRTPTGDAALKKL------------------------------------ 164

Query: 266 LHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTR 325
                         E A+K+      ++ F  + I +++          DRH + VQ  R
Sbjct: 165 --------------EAAIKKIQSGKKNERFAKIIILRQESQSFDMLAEKDRHALAVQKQR 210

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEF 385
           R  M  ARN L  + L P+ SWV W DAD+   P +VI+DL +    V+  NV++    F
Sbjct: 211 RSAMALARNELLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RF 267

Query: 386 LGSE------QEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGN 439
              E      + YD N+W ES+  L LA +L  D++IVEGYAE AT+R  +A+  D    
Sbjct: 268 FNDELSKADIRPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKP 327

Query: 440 TMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYT 499
             + + LDGVGG   L KA++ R+G                  KMAK++GY V GL +Y 
Sbjct: 328 VSEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYL 387

Query: 500 LWHIYE 505
           ++HI E
Sbjct: 388 VYHIEE 393

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  150 bits (379), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 166/366 (45%), Gaps = 63/366 (17%)

Query: 147 FEEHL-DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTY 205
           F +H+ D++    +  YDL+K   T + A N+EHVLI  P++         + +L+ LTY
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTY 139

Query: 206 PHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGD 265
           P ELI+L F+    +                                           GD
Sbjct: 140 PRELIELGFITPRTAT------------------------------------------GD 157

Query: 266 LHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTR 325
           L LK +        ENA+K+       + F  + I +++          +RH + VQ  R
Sbjct: 158 LALKKL--------ENAVKKVQADKKAQRFSKITIMRQNSQSFDKLMEKERHALDVQKER 209

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEF 385
           R  M  ARN L  + + P+ SWV W DAD+   P ++I+D+      V+  N+++    F
Sbjct: 210 RAAMALARNELLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RF 266

Query: 386 LGSEQE------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGN 439
              E++      YD N+W ESD  L +A  +D+D++IVEGYAE AT+R  +A+       
Sbjct: 267 YDQEKKQSSIRPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANEL 326

Query: 440 TMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYT 499
               + LDGVGG   L KA++ R+G                  KMAK++ Y V GL +Y 
Sbjct: 327 PSKEMVLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYL 386

Query: 500 LWHIYE 505
           ++HI E
Sbjct: 387 VYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  149 bits (375), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 164/357 (45%), Gaps = 56/357 (15%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D++    +  YDL+K   TA  A N+EHVLI  P++         + +L+ LTYP E  +
Sbjct: 90  DIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YWDNLLQLTYPREFTE 146

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F++   S                                           GD+ L   
Sbjct: 147 LGFILPRTS------------------------------------------SGDIAL--- 161

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                + +E A+K+      ++ F  + I +++          +RH ++VQ  RR  M  
Sbjct: 162 -----SKLEAAVKKVQTDKKNQRFSKITILRQNSAGFDKLMEKERHALEVQKERRSAMAS 216

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSE-- 389
           ARN L  ++L P  SWV W DAD+   P ++I+D+ S    V+  NV++   +    +  
Sbjct: 217 ARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQ 276

Query: 390 -QEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDG 448
            + YD N+W ESD AL LAK + +D+++VEGY + AT+R  +A   D  G T   ++LDG
Sbjct: 277 IRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDG 336

Query: 449 VGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           VGG   L KA + R+G                  KMA+++ Y + GL +Y ++HI E
Sbjct: 337 VGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  148 bits (374), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 100/360 (27%), Positives = 161/360 (44%), Gaps = 62/360 (17%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D++    +  YDL+K   T++   ++EHVL+  P++         + +L+ L+YP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIE 145

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F++      D  +  L                                          
Sbjct: 146 LGFIIPRSDAGDAALKKL------------------------------------------ 163

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                   E A+K       +  F  + I +++          +RH + VQ  RR  M  
Sbjct: 164 --------ETAVKNVQSDKKNNRFSKITILRQESQSFDKLEEKERHSLAVQKERRAAMAL 215

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQE 391
           ARN L  + L P+ SWV W D+D+   P +VIE +      V+  NV++    F  ++++
Sbjct: 216 ARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQ---RFFDNDKQ 272

Query: 392 ------YDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLD 445
                 YD N+W ESD  L LA  + +D++IVEGYAE AT+R  +A+  +P G+  + + 
Sbjct: 273 QDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMA 332

Query: 446 LDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           LDGVGG   L KA++ R+G                  KMAK++ Y V GL ++ ++HI E
Sbjct: 333 LDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  147 bits (370), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/353 (27%), Positives = 159/353 (45%), Gaps = 62/353 (17%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           +  YDL+K   T     N+E VLI  P++   +     + +L+ LTYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
            +  D  +  L +  +  Q G                                       
Sbjct: 153 TATGDTALRKLEAAVKRTQLG--------------------------------------- 173

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
                        D+ F  + I ++D          +RH +KVQ  RR  M  ARN L  
Sbjct: 174 -----------KKDQRFSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNELLF 222

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLG------SEQEY 392
           + + P+ SW+ W DAD+   P S+I+D+ +    V+  NV++   +++       +E+ Y
Sbjct: 223 STIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEETKKIAERPY 279

Query: 393 DLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGV 452
           D N+W +S+ AL +A  + +D+V+ EGYAE  T+R  +A+  D  G+    + LDGVGG 
Sbjct: 280 DFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGG 339

Query: 453 SILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
             L KA++ R+G                  KMA+++ Y + GL +Y ++HI E
Sbjct: 340 CTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  147 bits (370), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 164/363 (45%), Gaps = 57/363 (15%)

Query: 147 FEEHL-DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTY 205
           F +H+ D++    +  YDL+K   T + A N+EH+LI  P++         + +L+ L Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNY 139

Query: 206 PHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGD 265
           P ELI+L F+    +  D  +  L                                    
Sbjct: 140 PRELIELGFITPRTATGDSALKKL------------------------------------ 163

Query: 266 LHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTR 325
                         E+A+K+       + F  + I +++          +RH ++VQ  R
Sbjct: 164 --------------ESAIKKVQTDKKTQRFSKITILRQNSQSFDKLMEKERHALEVQKER 209

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPL--- 382
           R  M  ARN L  + + P+ SWV W DAD+   P S+I+D+      V+  N+++     
Sbjct: 210 RAAMALARNELLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQRFYDQ 269

Query: 383 PEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMD 442
            +   S + YD N+W ESD  L++A  + +D++IVEGYAE AT+R  +A+  D      +
Sbjct: 270 EKKQASIRPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNE 329

Query: 443 VLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWH 502
            + LDGVGG   L KA++ R+G                  KMAK++ Y V GL +Y ++H
Sbjct: 330 EMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYH 389

Query: 503 IYE 505
           I E
Sbjct: 390 IEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  145 bits (367), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 161/357 (45%), Gaps = 56/357 (15%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D + +  V  YDL+K   T++ A N+E VLI  P++         + +L+ LTYP +L++
Sbjct: 87  DRIPNGHVAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQAY---WDNLLQLTYPRDLLE 143

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F++   +                                           GD  LK  
Sbjct: 144 LGFIIPKSA------------------------------------------SGDAALK-- 159

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                  +E A+K       +  F  V I ++D          +RH + VQ  RR  M  
Sbjct: 160 ------QLEAAVKRAQTDKKNNRFGKVTILRQDSKGFDKLQEKERHALAVQKERRSAMAL 213

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPL---PEFLGS 388
           ARN L  + + P+ SWV W DAD+     S+I+D+ ++   V+  NV++      E   S
Sbjct: 214 ARNELLFSTIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPS 273

Query: 389 EQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDG 448
            + YD N+W +S  A  L   + +D++IVEGYAE AT+R  +A+   P G   +++ LDG
Sbjct: 274 IRPYDFNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDG 333

Query: 449 VGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           VGG   L KA++ R+G                  KMAK++ Y V GL +Y ++HI E
Sbjct: 334 VGGGCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEE 390

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  145 bits (367), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 158/357 (44%), Gaps = 56/357 (15%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D++    +  YDL+K   TA  A N+E VLI  P++         + +L+ LTYP ELI+
Sbjct: 90  DIIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIE 146

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F+V      D  +  L                                          
Sbjct: 147 LGFIVPRTQSGDVALAKL------------------------------------------ 164

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGK 331
                   E A+K+      ++ F  V I ++D          +RH + VQ  RR  M  
Sbjct: 165 --------EEAVKKVQTDKKNQRFVKVTILRQDSKSFDKLQEKERHALAVQKERRAAMAL 216

Query: 332 ARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSE-- 389
           ARN L  + + P+ SWV W DAD+   P ++I+D+ +    V+  NV++   +    E  
Sbjct: 217 ARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESS 276

Query: 390 -QEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDG 448
            + YD N+W ES+  L LA  + ED++IVEGY+E AT+R  +A   D  G+    + LDG
Sbjct: 277 IRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDG 336

Query: 449 VGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           VGG   L +A + R+G                  KMAK++ + V GL +Y ++HI E
Sbjct: 337 VGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEE 393

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  146 bits (369), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 100/347 (28%), Positives = 159/347 (45%), Gaps = 56/347 (16%)

Query: 162 YDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSK 221
           YDL+K   TAN A N+E VLI  P++         + +L+ LTYP EL++L F++   + 
Sbjct: 158 YDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPRTTS 214

Query: 222 DDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVEN 281
            D+ +  L                                                  E 
Sbjct: 215 GDNALRKL--------------------------------------------------EA 224

Query: 282 ALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANAL 341
           A+K+      D+ F  + I ++D          DRH ++VQ  RR  M  ARN L  + +
Sbjct: 225 AVKKTQLSKKDQRFLKITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTI 284

Query: 342 KPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWR-PLPEFLGSEQE--YDLNSWI 398
            PY SWV W DAD+   P ++I+D+ +    V+  NV++  + +  G + +  YD N+W 
Sbjct: 285 GPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWA 344

Query: 399 ESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKA 458
           +SD AL +A ++ +D V+ EGY E AT+R  +A+      +    + LDGVGG   L KA
Sbjct: 345 DSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKA 404

Query: 459 KLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           ++ R+G                  KMA+++ Y + GL +Y ++HI E
Sbjct: 405 EVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  140 bits (353), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 101/346 (29%), Positives = 153/346 (44%), Gaps = 61/346 (17%)

Query: 162 YDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSK 221
           YDL+    TA  A N E VLI  P++         + +L+ LTYP + I L FL+   S 
Sbjct: 97  YDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFLLPRTSS 153

Query: 222 DDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNMVEN 281
            +  +  L     ++Q G                                          
Sbjct: 154 GNTALRKLEKAVRKVQTGP----------------------------------------- 172

Query: 282 ALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANAL 341
                     D+ F  + I ++DF        S RH   VQ  RR  M  ARN L  + +
Sbjct: 173 ---------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFSTI 223

Query: 342 KPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVW-RPLPEFLGSEQEYDLNSWIES 400
            PY SWV W D+D+   P ++IED+ S    ++  NV+ R +     + + YDLN+W ES
Sbjct: 224 GPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVENGEPAIRAYDLNNWAES 283

Query: 401 DNALNLAKTLDEDDVIVEGYA-EYATWR---FHLANNRDPQGNTMDVLDLDGVGGVSILA 456
           +  L +A  L ED +IVEGY  E+AT+R    H+ +++ P+    +++ LDGVGG   L 
Sbjct: 284 ELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKD---ELMALDGVGGGCTLV 340

Query: 457 KAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWH 502
           KA++ R+G                  KMAK++ Y + GL +Y ++H
Sbjct: 341 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  133 bits (335), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 92/349 (26%), Positives = 150/349 (42%), Gaps = 55/349 (15%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           +  YD++    T++   N+E VLI  P++   +     + +L++LTYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 219 CSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYMNKDYLNM 278
               D  M  L                                                 
Sbjct: 152 TPTGDVAMKRL------------------------------------------------- 162

Query: 279 VENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTA 338
            E+A+K+      ++ F  + I ++D          +RH   VQ  RR  M  ARN L  
Sbjct: 163 -EDAVKKVQSGKENQRFLKITILRQDSQSFNKLDEKERHAFNVQKERRAAMALARNELVF 221

Query: 339 NALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSE--QEYDLNS 396
           + + P  SW+ W DAD+   P +VI+D+ +    ++  NV++   +    E  + YD N+
Sbjct: 222 STIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNN 281

Query: 397 WIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILA 456
           W ES   L +A ++ +D++IVE Y E  T+R  +A   DP G+    + LDGVGG   L 
Sbjct: 282 WQESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLV 341

Query: 457 KAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWHIYE 505
           KA++ R+G                   MAK++ Y V GL +Y ++H  E
Sbjct: 342 KAQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  131 bits (330), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 100/360 (27%), Positives = 160/360 (44%), Gaps = 67/360 (18%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D +    +  YDL+K   +AN AEN+EHVLI  PL++ E      + +L+ L+YP + I+
Sbjct: 96  DTIPEGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIE 152

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F++    K DH++                   KL+ A                     
Sbjct: 153 LGFIIPRTKKGDHSLK------------------KLESA--------------------- 173

Query: 272 NKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGF------SDRHHVKVQGTR 325
               +  V+ A      K  DK F  + I +++      +GF       +   ++ +   
Sbjct: 174 ----IKKVQTA------KQGDK-FSKITILRQN-----SKGFETVPEKKEVSEIEYEKQI 217

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEF 385
           R  M  ARN L A+ L P  +W+ W D+D+   P S+I+D+      V+  NV+    + 
Sbjct: 218 RAEMALARNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDR 277

Query: 386 LGSE---QEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMD 442
              E   + YD  +WIES  AL LA  + ED++IVEG A  +T R  + +     G+   
Sbjct: 278 ESGELSIRPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSS 337

Query: 443 VLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTLWH 502
            + LDGVG   +L K+++ R+G                  KMAK++ Y V GL +Y ++H
Sbjct: 338 EISLDGVGASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  129 bits (325), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 163/364 (44%), Gaps = 72/364 (19%)

Query: 152 DMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELID 211
           D++    +  YDL+K   +AN  EN+EHVLI  PL++ +      + +L+NL+YP +LI+
Sbjct: 95  DIIPEGHIAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIE 151

Query: 212 LAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYXXXXXXXXXXXEGDLHLKYM 271
           L F+V +  K D                                                
Sbjct: 152 LGFMVPNTKKGDQI---------------------------------------------- 165

Query: 272 NKDYLNMVENALKEPFHKNYDKP-----FRSVQIF-QKDFGQIIGQGFSDR------HHV 319
               L  +ENA+K    +  DK      F  + I  QKD G      F+DR      + +
Sbjct: 166 ----LKQLENAVKNV--QGIDKKLGSNKFAKITILRQKDSG---FHKFNDRKDKKEMNDI 216

Query: 320 KVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVW 379
           +++  +R  M  ARN L ++ L    +W+ W D++V   P ++I+D+      V+  NV+
Sbjct: 217 ELEKEKRAEMALARNELLSSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVY 276

Query: 380 RPLP--EFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQ 437
                 +   + + YD  +WIESD AL LA  + ED++IVEG A  AT R  + N  +  
Sbjct: 277 MKDSNDKDKANIRPYDFRNWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESD 336

Query: 438 GNTMDVLDLDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSH 497
           G+  + L LDG+G    L K+++ R+G                  KMAK++ Y V GL +
Sbjct: 337 GSPTEELALDGIGAACTLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPN 396

Query: 498 YTLW 501
           Y ++
Sbjct: 397 YLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 81/175 (46%), Gaps = 3/175 (1%)

Query: 326 RKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEF 385
           RK +   +N L  + L PY SWV W D+ +   P ++++DL + G  ++  +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFN---NS 239

Query: 386 LGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLD 445
            GS     LN+W+ SD   +LA  +    V++EG +   T R  +    D   + +  ++
Sbjct: 240 DGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 446 LDGVGGVSILAKAKLFRNGVHXXXXXXXXXXXXXXXGKMAKKMGYRVGGLSHYTL 500
           LD V     L KA++ R+G                  +MA+ + ++  GL +Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 159 VETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSD 218
           +  Y+L++ A + +   + EH+L+ +PL N  +     F +L  LTYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 219 CSKDDHTMDSLISYAEELQ 237
                  + +L     ++Q
Sbjct: 136 SKNATGILQALQETLAKVQ 154

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 75/164 (45%), Gaps = 25/164 (15%)

Query: 315 DRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVI 374
           DRH   VQ  RRK + K RN+L  N       +    D+D+ + P  ++E  + +G ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 375 VPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFH----- 429
           VP + R     +GS++EYD N+WI         +T  ED      Y  Y     +     
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGE-------RTKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 430 LANNRD-------PQGNTMDVLDLDGVGGVSILAKAKLFRNGVH 466
           L +  D       P+  T +V++LD VGG  +    K+F  G+ 
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQ 518

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 178 EHVLICV-PLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEEL 236
           E +L C+  +RN +     +F+H+ +L +  E +++ FL +   K+ +   SLI Y E+ 
Sbjct: 744 ETILTCLGKVRNEK-----LFKHVFDLLFKIETMNVQFLATAFGKNPYVQKSLIEYVEQN 798

Query: 237 QKGTLSK 243
           +   L++
Sbjct: 799 KDELLTR 805

>CAGL0M06061g Chr13 (633324..634628) [1305 bp, 434 aa] {ON} weakly
           similar to uniprot|P38292 Saccharomyces cerevisiae
           YBR168w
          Length = 434

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 23/115 (20%)

Query: 313 FSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYD 372
           F ++   K +G   K++   R   T N    Y+             PG+ I +      D
Sbjct: 337 FENQRKWKYKGWISKMLPYERPQFTTNCNNKYND------------PGAYITE-SPEQLD 383

Query: 373 VIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWR 427
           + VP      P++   E+E+ ++SW+ SD   N+  T+D     +EGY     W+
Sbjct: 384 LQVP------PDWSWIEKEWTVSSWVYSDTDWNVTGTMDS----LEGYTRSRIWK 428

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,810,720
Number of extensions: 2536999
Number of successful extensions: 6534
Number of sequences better than 10.0: 73
Number of HSP's gapped: 6587
Number of HSP's successfully gapped: 117
Length of query: 524
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 410
Effective length of database: 40,409,475
Effective search space: 16567884750
Effective search space used: 16567884750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)