Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46128.841ON32632616780.0
SAKL0D01452g8.841ON32732512771e-178
KLLA0D01551g8.841ON33132312481e-173
NCAS0D049408.841ON32732512141e-168
Kwal_27.102558.841ON32932812101e-167
KLTH0C03850g8.841ON32932812031e-166
KAFR0B00210singletonON32632311851e-164
Smik_6.4848.841ON32532411771e-162
TPHA0G03760singletonON33132311751e-162
YPL273W (SAM4)8.841ON32532411701e-161
Suva_13.515na 1ON32532411631e-160
NDAI0F00250singletonON32932511541e-159
KNAG0B06970singletonON33231411291e-155
TDEL0E05690singletonON32832410911e-149
ABL125W8.841ON33632410291e-140
TDEL0E00240singletonON32832410231e-139
Suva_16.17singletonON32432410171e-138
Smik_12.1na 2ON3243249931e-134
Skud_12.4na 2ON3253249931e-134
Suva_64.1singletonON2732739801e-133
YLL062C (MHT1)na 2ON3243249831e-133
KAFR0F04420singletonON3263249641e-130
Suva_16.328.841ON2592509431e-128
KAFR0L00150singletonON3263239391e-126
TPHA0I002608.841ON3233218681e-116
Kpol_1068.78.841ON3233258621e-115
TBLA0B032608.841ON3263228481e-112
ZYRO0G14212g8.841ON3253258371e-111
Skud_100.1singletonON2002007661e-102
Skud_101.1singletonON2002007651e-102
SAKL0D09306gna 3ON3263366743e-86
Kwal_0.322na 3ON3323345883e-73
AFR410WsingletonON3703315757e-71
KLTH0H12716gna 3ON3483385642e-69
YMR321Cna 1ON1051013552e-41
Skud_47.2singletonON96963185e-36
TPHA0O006301.386ON59449712.4
KLTH0E12298g8.529ON22653683.3
CAGL0B02387g8.850ON47150685.0
TPHA0K004105.558ON56679678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4612
         (326 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   650   0.0  
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   496   e-178
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   485   e-173
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               472   e-168
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   470   e-167
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   468   e-166
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       461   e-164
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   457   e-162
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     457   e-162
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   455   e-161
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   452   e-160
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       449   e-159
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             439   e-155
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   424   e-149
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   400   e-140
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       398   e-139
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   396   e-138
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   387   e-134
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   387   e-134
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        382   e-133
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   383   e-133
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               375   e-130
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   367   e-128
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      366   e-126
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   338   e-116
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   336   e-115
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   331   e-112
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   327   e-111
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   299   e-102
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   299   e-102
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   264   3e-86
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   231   3e-73
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   226   7e-71
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   221   2e-69
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   141   2e-41
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      127   5e-36
TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {...    32   2.4  
KLTH0E12298g Chr5 complement(1092238..1092918) [681 bp, 226 aa] ...    31   3.3  
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...    31   5.0  
TPHA0K00410 Chr11 complement(82127..83827) [1701 bp, 566 aa] {ON...    30   8.0  

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/326 (96%), Positives = 314/326 (96%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFIN            Q
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKYKP 326
           RIIGGCCRTTPNDIRQIVTAVKKYKP
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAVKKYKP 326

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  496 bits (1277), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 226/325 (69%), Positives = 269/325 (82%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +KQ  Q +PD+IL+MDGGQGTELENRGI VANPVWSTIPFI+            Q
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF+++I  G+ +LMT TYQ+SFKSVSENT IKTL+EYNQLL+RIVAFSR CIG D 
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG+WGAH+C EF+GDYG +PERI +L+YFRPQL NFN  E ID+IGFETIPN+HE
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDESII KPFYIG+SVHE+G LRDGTTM +VA + +SLG KLNPN + LGINC 
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF +SH+IL SLH+ELP +P+I YPNSGE+YDTVKKIWL NEN  VTWD++VKSY+++GA
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKYK 325
           RIIGGCCRT+P DI+ IV A++KYK
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAIEKYK 325

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  485 bits (1248), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 219/323 (67%), Positives = 266/323 (82%)

Query: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQI 61
           +R  +K+  + NPD +L+MDGGQGTELENRGINVANPVWST+PFIN             I
Sbjct: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRII 60

Query: 62  VAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNY 121
           V  MFE++I AGA++LMTITYQ+SFKSVSENT I+TLEEYN LLDRIV+FSR+CIG D Y
Sbjct: 61  VKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRY 120

Query: 122 LVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHEL 181
           L+GCIG+WGAH+C+EF+GDYG HP++I Y +YFRPQL NF   +DID+IGFETIPNIHEL
Sbjct: 121 LIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHEL 180

Query: 182 TAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCS 241
            AILSWDE+++ KPFYIG+SVHE+G LRDGT+M Q+A L  SLG KLN N + +GINCC+
Sbjct: 181 RAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCA 240

Query: 242 FRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGAR 301
           F  SHMILESLH   P +PLI YPNSGE+YDTVKKIWLKNEN + TWD++VKSY+++GAR
Sbjct: 241 FNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGAR 300

Query: 302 IIGGCCRTTPNDIRQIVTAVKKY 324
           IIGGCCRTT +DI+++  AV KY
Sbjct: 301 IIGGCCRTTVDDIKEVRLAVNKY 323

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  472 bits (1214), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 214/325 (65%), Positives = 265/325 (81%), Gaps = 1/325 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R S+K+ LQ NPD++L++DGGQGTELENRGINVANPVWSTIPF++            Q
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MFE+++AAGA +LMT TYQ+SFKSVSENTDIKTL+EYN+LL+RIV+FSR CIG   
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG WGAH+CAEF+GDYG HPE I Y  YF+PQL+NF   E++D+IGFET+PN++E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE I+ KPFYIG+SVHE+G LRDGTTM ++  +F+SLG K+NPN L LGINC 
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWL-KNENCIVTWDEIVKSYLQSG 299
           SF +S  ILE +H+ LP +PLIAYPNSGE+YDTVKKIWL +N    +TW+++VK Y+++G
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 300 ARIIGGCCRTTPNDIRQIVTAVKKY 324
           ARIIGGCCRTTP DI +I  AVKK+
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKF 325

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  470 bits (1210), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 219/328 (66%), Positives = 263/328 (80%), Gaps = 2/328 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXX--XXXXXXXXX 58
           MVR S+K+ L+ NP ++L++DGGQGTELENRGI VANPVWSTIPFI+             
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 59  XQIVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGA 118
            QIV  M+ +++ AGA +LMT+TYQ+SFKSVSENT IKTLEEY+ LL+RIV FSR CIG 
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 119 DNYLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNI 178
           D +LVGCIG+WGAH C+EF+GDYG  PE+I +L YF+PQL+NF   E+ID+IGFETIPNI
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 179 HELTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGIN 238
           HEL AILSWDESII KPFYIG+SVHE+G LRDGTTM QVA+L +S G +LNPNF  LGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 239 CCSFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQS 298
           C S+  SH IL SLHEELP +PLIAYPNSGE+YDTVKKIW    +  ++W++IVKSY+ S
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 299 GARIIGGCCRTTPNDIRQIVTAVKKYKP 326
           GARIIGGCCRT+P DI  I  AV+KY+P
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKYRP 328

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  468 bits (1203), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 216/328 (65%), Positives = 264/328 (80%), Gaps = 2/328 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXX--XXXXXXXXX 58
           M R SVK+ L SNP+++L++DGGQGTELENRGI VANPVWSTIPFI+             
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 59  XQIVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGA 118
            QIV  M+E+++ AGA +LMT+TYQ+SFKSVSENT I TLEEY+ LL RIV+FSR+CIG 
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 119 DNYLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNI 178
           D +LVGCIG WGAH C+EF+GDYG  PE+I YL YF+PQL+NF + +D+D+IGFETIPNI
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 179 HELTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGIN 238
           HEL AILSWD +I+ KPFYIG+SVHEHG LRDGTTM +VA+L +SLG K+NPNF+ LGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 239 CCSFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQS 298
           C S+ +S  IL SLH+E+P +PLIAYPNSGE+YDTVKKIW    +  +TWD++VKSY+ S
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 299 GARIIGGCCRTTPNDIRQIVTAVKKYKP 326
           GARIIGGCCRT+P DI  I  AV KY+P
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKYRP 328

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  461 bits (1185), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 264/323 (81%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +K+ L+ NP ++L++DGGQGTELENRGI+VANPVWSTIPFI+            +
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV GMF++++ AGA++LMTITYQ+SFKSV+ENT IKTL+EYN+LL+RIV+FSR+CIG + 
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG WGAH+CAEF+GDYG HPE I Y  YF+PQL+NF   +D+D+IGFET+PN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWD++I+ KPFYIG+SVHE+G LRDGTTM+++    +SLG K+NPNFL LGINC 
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  ILES+H+ELP +PLIAYPNSGE+YDTVKKIWL N    +TW+++V  Y+++GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGA 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKK 323
           RIIGGCCRT P+DI Q+  AVKK
Sbjct: 301 RIIGGCCRTMPDDIEQVSAAVKK 323

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  457 bits (1177), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 212/324 (65%), Positives = 255/324 (78%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +KQLL  NP ++L++DGGQGTELENRGI VANPVWSTIPFI+            +
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF +++ AGA +LMT TYQ+S+KSVSENT IKTL EYN LL RIV FSR CIG D 
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG WGAHIC EF+GDYG +PE I +  YF+PQL+NFN  +++D+IGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDES++ KPFYIG+SVHEHG LRDGTTM +VA++ + LG K+NPNF  LGINC 
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  ILESLH+ LP + L+AYPNSGE+YDT KKIWL N + + +WD +VK Y+ SGA
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+P DI++I TAVKKY
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAVKKY 324

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  457 bits (1175), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 256/323 (79%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +K  LQ NP+++L+MDGGQGTELENRGI VANPVWSTIPFI+            +
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF ++I AGA +LMT TYQ+SFKSVSENT IK  + YN+LL+RI+ FSR CIG + 
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIGSWGAHICAEF GDYGEHPE I + +YF+PQL+NF     +D+IGFET+PNIHE
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE I+ KPFYIG+SVHE+G LRDGT+M +VA L +  G+KLNPN   LGINC 
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           S+ +S+ I++S+H+ELP +PLIAYPNSGE+YDT KKIWL N+N I TWD+IVK Y+++G 
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGV 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKK 323
           RIIGGCCRTTPNDI+ +  AVK+
Sbjct: 301 RIIGGCCRTTPNDIKAVTIAVKE 323

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  455 bits (1170), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 209/324 (64%), Positives = 251/324 (77%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +KQ L  NP ++L++DGGQGTELENRGI VANPVWSTIPFI+            +
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF +++ AGA +LMT TYQ+S+KSVSENT I+TL EYN LL+RIV FSR CIG D 
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG WGAHIC EF+GDYG  PE I +  YF+PQL NFN  + +D+IGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDESI+ +PFYIG+SVHEHG LRDGTTM ++AQ+ + LG K+NPNF  LGINC 
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  ILESLH+ LP + L+AYPNSGE+YDT KKIWL N + + +WD +VK Y+ SGA
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+P DI++I  AVKKY
Sbjct: 301 RIIGGCCRTSPKDIQEISAAVKKY 324

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  452 bits (1163), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 254/324 (78%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +KQLL  +P ++L++DGGQGTELENRGI VANPVWSTIPFI+            +
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF +++AAGA +LMTITYQ+SFKSVSENT IKTL  Y+ LL RIV FSR CIG + 
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           +L+GCIG WGAH+C EF+G+YG +PE I +  YF+PQL+NFN  + +D++GFETIPNIHE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDESI+ KPFYIG+SVHEHG LRDGTTM  VA++ + LG K+NPNFL LGINC 
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  ILESLH  LP +PL+AYPNSGE+YDT KKIW+ N + + +WD +VK Y+ SGA
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGA 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRTTP DI+++  AVKKY
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAVKKY 324

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  449 bits (1154), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 210/325 (64%), Positives = 254/325 (78%), Gaps = 1/325 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +K  L  NP +ILI+DGGQGTELENRGINVANPVWSTIPF+N            +
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF +++ AGA +LMT TYQ+SFKSVSENT+IKTL+EY++LL RIV FSR CIG + 
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG WGAHIC+EF+G+YGEHPE I Y +YF+PQL NF   +D+D+IGFETIPN++E
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L  ILSW   I+ KPFYIG+SVHE+G LRDGTTMSQVA +  SL  KLNPN + LGINC 
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWL-KNENCIVTWDEIVKSYLQSG 299
           S  +S  IL+S+H  LP +PLI YPNSGE+YDTVKKIWL  N+   ++WDE+V+ YL++G
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300

Query: 300 ARIIGGCCRTTPNDIRQIVTAVKKY 324
           ARIIGGCCRTTPNDI+QI  AV KY
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHKY 325

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  439 bits (1129), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 248/314 (78%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +++ L+ NP ++L++DGGQGTELENRGINVANPVWST+PFI+             
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV GMF+ ++ AGA +LMT TYQ+SFKSVSENT I+ LEEY+ LLDRIV FSR CIG D 
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG WGAH+CAEF+GDYG +P  I YL YF+PQL+NF   +++D+IGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE+I+ KPFYIG+SVH +G LRDG+TM  VA L +S G KLN N   LGINC 
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  ILES+H+ELP +PLIAYPNSGE+YDTVKKIWL N + ++TW+E+V  Y+++GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGA 300

Query: 301 RIIGGCCRTTPNDI 314
           RI+GGCCRT+P DI
Sbjct: 301 RIVGGCCRTSPKDI 314

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  424 bits (1091), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 253/324 (78%), Gaps = 1/324 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           MVR  +K+L+  +  +IL++DGGQGTELENRGI VANPVWSTIPF++            +
Sbjct: 1   MVRIPIKKLVIESK-EILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  +F+++  +G+N+LMTITYQ+SF S+ ENT  KTL EYN LLDRIV FSR+CIG + 
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+G +G WGAH+C EF+G+YG HPE I Y +YF+PQL+NFN Q++ID+IGFET+PN HE
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE+ I KPFYIG+SVH +G LRDGTTM ++ +  + LG+K++ NFL LG+NC 
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  +++S+H+ LP +PL+AYPNSGE+YDT KKIW  N++ + +WD +V+SY+ +GA
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+P DI ++  AVKKY
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAVKKY 323

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  400 bits (1029), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 237/324 (73%), Gaps = 2/324 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  ++Q L+ +P ++L+MDGGQGTELENRGI VA+PVWS  PF++             
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IVA +  +++AAGA ++MTITYQ+SF SV+ NT I TL++YN LLDRIV F R  +G D 
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YLVG IG+WGAH+CAEF+GDYG  P+ I YL YF+PQL+NFN Q  +D+IGFETIPN HE
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDES+I KPFY+ +SVH+ GTLRDGT M+ VA +  +    LNPNFL LGINC 
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAA-APLNPNFLGLGINCS 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           S   +  IL  LH  LP +P+  YPNSGE+YD VKK+W  + + +V W  +V SY++SGA
Sbjct: 240 SLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGA 298

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT PNDIRQI  AV+ +
Sbjct: 299 RIIGGCCRTIPNDIRQIADAVRTH 322

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 243/324 (75%), Gaps = 1/324 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  ++++L ++  +IL++DGGQGTE+ENRGI VANPVWS+IPF++            +
Sbjct: 1   MGRVPLRKVL-TDSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  ++++++++G+++LMT+TYQ+SFK+++ENT+++TL EYN LLDRIVAFSR CIG + 
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YLVG +G W A+  +E++GDYG H + I Y  Y++PQL+NFN QE+ID+IG ET+PN HE
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE  I KPFY+ ++ H+ G LRDGT M  +AQ  + LG  LNPNF+ LGINC 
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  ILE LH  LP + L+AYPNSGE+Y+  KKIWL N+    +WD +VKS++ SGA
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGA 299

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+P DI  +  AVKKY
Sbjct: 300 RIIGGCCRTSPQDIADVSIAVKKY 323

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  396 bits (1017), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 245/324 (75%), Gaps = 1/324 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R ++++L+  +P ++L++DGGQGTELENRGI++ +PVWS  PFI+             
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWESTSSDRT- 59

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           +V  M+ +++ AGAN+LMT+TYQ++F S+SENT IKTL +YN+ LDR+V+F+R  IG D 
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+G IG W AH+ +E++GDYG HPE I YL +F+ QL+NFN   +ID+IGFET+PN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE+II KPFY+G+SVH++G LRDGTTM ++A   +SLG+K+N +FL LG+NC 
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S  IL+SLH+ LP +PL+AYPNSGE+YDT  K W + +    +W+ +V+ ++ +GA
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGA 299

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+  DI +I +AV K+
Sbjct: 300 RIIGGCCRTSAKDISEIASAVDKH 323

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  387 bits (993), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 174/324 (53%), Positives = 237/324 (73%), Gaps = 1/324 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +++LL  +P ++L++DGGQGTELENRGIN+ +PVWS  PF++            +
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEKSSRER-K 59

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           +V  M+ +++ AGAN+LMTITYQ++FKS+S+NT IKTL  Y + LD+IV FSR  IG + 
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+G IG W AH+ +E++G+YG HPE I Y ++FRPQL+ FN  EDID+IGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSW E II +PFY+G+SVH++G LRDGTT+ +++   + LG K+N NFL LG+NC 
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S +IL++LHE LP  PL+ YPNSGE+YD  +K W    + + +WD  V+ ++ SGA
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGA 299

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+P DI +I  +V  Y
Sbjct: 300 RIIGGCCRTSPKDIAEIAASVDTY 323

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  387 bits (993), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 238/324 (73%), Gaps = 1/324 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R S+++L+   P ++L++DGGQGTELENRGIN+  PVWS  PF +            +
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWEQSSHDR-E 59

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           +V  M+ +++ AGAN+LMTITYQ++FKS+SENT I+TL  YN  LDRIV+F+R  IG + 
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YLVG IG W AH+ +E++G+YG HPE I Y ++F+PQL++FN  +DID+IGFET+PN HE
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSW E II KPFY+G+SVH++G LRDGTTM +V+   + LG ++N + L +G+NC 
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S +IL +LHE LP  PL+ YPNSGE+YD  +K W    +   +WD  VK+++ SGA
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGA 299

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+P DI +I TAV++Y
Sbjct: 300 RIIGGCCRTSPKDIAEIATAVRRY 323

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/273 (64%), Positives = 214/273 (78%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +KQLL  +P ++L++DGGQGTELENRGI VANPVWSTIPFI+            +
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF +++AAGA +LMTITYQ+SFKSVSENT IKTL  Y+ LL RIV FSR CIG + 
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           +L+GCIG WGAH+C EF+G+YG +PE I +  YF+PQL+NFN  + +D++GFETIPNIHE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDESI+ KPFYIG+SVHEHG LRDGTTM  VA++ + LG K+NPNFL LGINC 
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDT 273
           SF  S  ILESLH  LP +PL+AYPNSGE+YDT
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  383 bits (983), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 174/324 (53%), Positives = 234/324 (72%), Gaps = 1/324 (0%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +K+L+  +P ++LI+DGGQGTELENRGIN+ +PVWS  PF +            +
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWEPSSQER-K 59

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           +V  M+ +++ AGAN+LMTITYQ++F+S+SENT IKTL  Y + LD+IV+F+R  IG + 
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+G IG W AH+  E++GDYG HPE I Y  +F+PQL NFN   DID+IGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE II KPFYIG+SV ++  LRDGTT+ +++   + LG K+N N L +G+NC 
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF  S +IL+ LHE LP +PL+ YPNSGE+Y+  +K W +  N +  W+  VK ++ +GA
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGA 299

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RIIGGCCRT+P DI +I +AV KY
Sbjct: 300 RIIGGCCRTSPKDIAEIASAVDKY 323

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  375 bits (964), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 171/324 (52%), Positives = 232/324 (71%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  +K+ L  N D+IL++DGGQGTELE RGIN+++PVWST+PFIN            +
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           I+  M+ ++I+AGA++L T TYQ+SF S+SENT+I+TL++Y++LL+RI  F+R CIG   
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YLVG IG++ A++ AE++GD+G+  + I Y  YF+PQL+NFN   +ID+IGFETIPNIHE
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILS ++  + KPFYI +S +    LRDGT++  V  + +S    LNPN + LGINC 
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
               SH+ +E L+  LP  PLI YPNSGE YD V+KIWL +E+   TW+ IV  YL +GA
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGA 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324
           RI+GGCCRTTP+DIR I  A+K Y
Sbjct: 301 RIVGGCCRTTPSDIRSISEAIKCY 324

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  367 bits (943), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 169/250 (67%), Positives = 202/250 (80%)

Query: 75  NLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNYLVGCIGSWGAHIC 134
           N LMTITYQ+SFKSVSENT IKTL  Y+ LL RIV FSR CIG + +L+GCIG WGAH+C
Sbjct: 9   NSLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVC 68

Query: 135 AEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHELTAILSWDESIIKK 194
            EF+G+YG +PE I +  YF+PQL+NFN  + +D++GFETIPNIHEL AILSWDESI+ K
Sbjct: 69  CEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSK 128

Query: 195 PFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCSFRYSHMILESLHE 254
           PFYIG+SVHEHG LRDGTTM  VA++ + LG K+NPNFL LGINC SF  S  ILESLH 
Sbjct: 129 PFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHR 188

Query: 255 ELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGARIIGGCCRTTPNDI 314
            LP +PL+AYPNSGE+YDT KKIWL N + + +WD +VK Y+ SGARIIGGCCRTTP DI
Sbjct: 189 ALPNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248

Query: 315 RQIVTAVKKY 324
           +++  AVKKY
Sbjct: 249 QEVSAAVKKY 258

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  366 bits (939), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 160/323 (49%), Positives = 230/323 (71%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           MVR  +K+ L+ NP+++L+ DGGQG ELE RG+++ + +WST PF++            +
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV GMFE+++ AGA +LMT TYQ+SFK+VSE+T++K+L EYN+LLD+IV F+R CIG + 
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+G IGS+GA +  E+SGDYG+ PE + +  YF+PQL+NF   ++ID++GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L ++LSWDE  + KPFYI +SVH++G LRDGT M  +    +SL   +NPN   LG+NC 
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           ++  +  I++S+H  LP +PL  +PNSGE+++  K IW  N     +W+ +VK ++ SG 
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 301 RIIGGCCRTTPNDIRQIVTAVKK 323
           RI+GGCCRT P+DI QI  AVKK
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVKK 323

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  338 bits (868), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 221/321 (68%), Gaps = 2/321 (0%)

Query: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXX-XXXXXXXXXQ 60
           +R   ++ +  +P++IL++DGGQGTELENRG+N+ +P+WSTI F+N             +
Sbjct: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
            +  MF ++  AGAN+  T+TYQ+SF SVSENTDIK+L+EY++LL +I  F R CI  D+
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+GCIG++ A I AE+ G+YG    +I YL YF+PQL+ FN   +ID+IGFETIPN HE
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWDE II +PF+I +S+ +   LRDGT+  ++ +LF    K  N N + +G NC 
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKY-KGRNKNLVYVGGNCI 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           S+ YS   +  LH+ +P++ LIAYPNSGE+YD   K W       ++W+E+V  Y  +G 
Sbjct: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299

Query: 301 RIIGGCCRTTPNDIRQIVTAV 321
           +IIGGCCRTTP+DI+QI  AV
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAV 320

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  336 bits (862), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 149/325 (45%), Positives = 228/325 (70%), Gaps = 3/325 (0%)

Query: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFI-NXXXXXXXXXXXXQ 60
           +R  +++L+++ PD++L+ DGG GT LE+RGINV++P+WST+PF+ +             
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           I+ G++ +YI +G+ +L TITYQ+SF  +S +T++KT+E Y QL+  I +F R+ IG DN
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+G IG +GA + AE++G+YG+ P  I YL+YF+PQL  FN  +DID+IGFET+PN +E
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L AILSWD+S+I KP+Y+ +S+ ++G LRDGT+  ++A +F+      N N +  G NC 
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300
           SF+Y+   +  LH+ +P +PLI YPNSGE+YD + K W  ++   +TW++++K    S  
Sbjct: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298

Query: 301 RIIGGCCRTTPNDIRQIVTAVKKYK 325
           RI+GGCCRTTP+DI +I   + K K
Sbjct: 299 RIVGGCCRTTPDDINKIKDMITKVK 323

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  331 bits (848), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 228/322 (70%), Gaps = 3/322 (0%)

Query: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXX-XXXXXXXXXQ 60
           +R S K+   ++P+ +++MDGGQGTELE RG++V++ VWST+PFI               
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120
           IV  MF+ ++AAG+  LM+ITYQ SF ++S NT I+ LEEYN+LL++IV F R CIG   
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180
           YL+G IG + +H+ AE++GDYG HPE + YL+YF+PQL+NFN  +DID+I  ET+PN +E
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           L A+LSWD + IKKPFYI +SV + G LRDGT+M  ++ +F++   K NPN + +G+NC 
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 239

Query: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENC-IVTWDEIVKSYLQSG 299
           S+  + MI++ L   +P +PL+ YPNSGE+YD + + W  N +  + +W+ +VK  + +G
Sbjct: 240 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 299

Query: 300 ARIIGGCCRTTPNDIRQIVTAV 321
            R++GGCCRTTP+DI +I  AV
Sbjct: 300 VRMVGGCCRTTPDDIHKIAQAV 321

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  327 bits (837), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 216/325 (66%), Gaps = 11/325 (3%)

Query: 7   KQLLQ--SNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ-IVA 63
           +QLL+   + D++L+MDGGQGTELENRG+N++ P+WST+PF              + +V 
Sbjct: 3   QQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDVVN 62

Query: 64  GMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNYLV 123
            MF+ Y+ AGA LL T+TYQ+S+K++  +TDI T  +Y+QLLDRIV F R CIG D+YLV
Sbjct: 63  SMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLV 122

Query: 124 GCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHELTA 183
           G IG + AH+ AE++GDYG  PE I Y  YF PQ+ NFN  E ID+IG ET+PN+HEL +
Sbjct: 123 GSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKS 182

Query: 184 ILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCSFR 243
           ILSWDE+ I KPFY+ + V + G LRDGT + Q+  LF     + N N L +GINCCS  
Sbjct: 183 ILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLF---ANRSNKNLLLVGINCCSLS 239

Query: 244 YSHMILESLHEELPYIP--LIAYPNSGELYDTVKKIWLKN---ENCIVTWDEIVKSYLQS 298
            S   L  L+E L   P  L+ YPNSGE+YD   + W +    ++  ++W  +V+ Y + 
Sbjct: 240 VSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKF 299

Query: 299 GARIIGGCCRTTPNDIRQIVTAVKK 323
           GAR IGGCCRTTP DI++I   V +
Sbjct: 300 GARAIGGCCRTTPLDIQEICKVVDR 324

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  299 bits (766), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 162/200 (81%)

Query: 78  MTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNYLVGCIGSWGAHICAEF 137
           MT TYQ+S+KSVSENT IKTL EYN LL RIV FSR CIG D YL+GCIG WGAHIC EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 SGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHELTAILSWDESIIKKPFY 197
           +GDYG  P+ I +  YF+PQL+NFN  + +D+IGFETIPN+HEL AILSWDESI+ KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCSFRYSHMILESLHEELP 257
           IG+SVHEHG LRDGTTM +VA++ + LG K+NPNF  LGINC SF  S  ILESLH+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 258 YIPLIAYPNSGELYDTVKKI 277
            + L+AYPNSGE+YDT KKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 163/200 (81%)

Query: 78  MTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADNYLVGCIGSWGAHICAEF 137
           MT TYQ+S+KSVSENT IKTL EYN LL RIV FSR CIG + YL+GCIG WGAHIC EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 SGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHELTAILSWDESIIKKPFY 197
           +GDYG  PE I + +YF+PQL+NFN  + +D+IGFETIPN+HEL AILSWDESI+ KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCCSFRYSHMILESLHEELP 257
           IG+SVHEHG LRDGTTM +VA++ + LG K+NPNF  LGINC SF  S  ILESLH+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 258 YIPLIAYPNSGELYDTVKKI 277
            + L+AYPNSGE+YDT KKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  264 bits (674), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 207/336 (61%), Gaps = 24/336 (7%)

Query: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
           M R  + + L+S+   IL++DGGQGTE+E RGI+V +P+WST+PFI              
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKNPTHLNH----- 52

Query: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTD--IKTLEEYNQLLDRIVAFSR-TCIG 117
            + GM+ ++  +GA  L TITYQ+SF ++ + +D  + T ++Y Q L+ I+ F+R  CI 
Sbjct: 53  -IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 118 ADNYLVGCIGSWGAHIC--AEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETI 175
              YL+GC+G + A++C  AE+SGDYG   E+I +  YF+PQL+ F+  + ID++GFETI
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 176 PNIHELTAILSWDESII--KKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFL 233
           PNI EL  +LS D + +   KPFYI +S   +G LRDGT ++++ +  +   K   PN L
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 234 ALGINCCSFRYSHMILESLH----EELPYIPLIAYPNSGELYDTVKKIWLKNENCI--VT 287
            LGINC  + +S+ IL  L+    ++   +    YPNSGE+YD     W  N      +T
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELT 289

Query: 288 WDEIVKSYLQSGARIIGGCCRTTPNDIRQIVTAVKK 323
           W+ +V  + +   ++IGGCCRTTP+DI+QI  AV K
Sbjct: 290 WNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  231 bits (588), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/334 (38%), Positives = 193/334 (57%), Gaps = 24/334 (7%)

Query: 8   QLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQIVAGMFE 67
           QL +    +IL++DGGQGTELE RGIN+A+P+WST+P++             +I+  M+ 
Sbjct: 4   QLEEYLKHEILLLDGGQGTELEKRGINIAHPLWSTLPYVT------KDKKHLKIIKEMYS 57

Query: 68  EYIAAGANLLMTITYQSSFKSVSENTD--IKTLEEYNQLLDRIVAFSRT-CIGADNYLVG 124
            + +AG N LMTITYQ+SF S+  ++D  I   +EY + LD ++ ++   CI  ++YLVG
Sbjct: 58  AFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPNSYLVG 117

Query: 125 CIGSWGAHIC--AEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHELT 182
            +G + A++   AE+SG Y E  + I ++++FRPQ+ +F +   ID+IG ETIPN  E  
Sbjct: 118 SVGPYAAYLSNGAEYSGHYIE--DNIDFIEFFRPQVQHFAVSSRIDLIGIETIPNFEEFK 175

Query: 183 AILSWDESII--KKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240
           A+L  + S +   KP+YI ++    G LRDGT    + +  +   + L PN +  GINC 
Sbjct: 176 ALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFFGINCV 235

Query: 241 SFRYSHMILESLHEELPYIPL-------IAYPNSGELYDTVKKIWLKNENC--IVTWDEI 291
           SF +   IL+ L++ L  I +         YPNSGE+Y      W  N       TW+ +
Sbjct: 236 SFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPADTWENL 295

Query: 292 VKSYLQSGARIIGGCCRTTPNDIRQIVTAVKKYK 325
               +Q G  +IGGCCRT+P D+RQI + V   K
Sbjct: 296 ASKVVQQGCLMIGGCCRTSPADLRQIASVVSDIK 329

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  226 bits (575), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 191/331 (57%), Gaps = 22/331 (6%)

Query: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQI 61
            + ++ + L+ N   +L+MDGG G ELE RG++V +P+WST PF+               
Sbjct: 47  AKCAITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLRGDRAAL------DT 97

Query: 62  VAGMFEEYIAAGANLLMTITYQSSFKS-VSENTDIKTLEEYNQLLDRIVAFS-RTCIG-A 118
           + G++ E+ AAG+  + T+TYQ+SF S V  +  + +  +Y + L+++V F+ R C+  A
Sbjct: 98  IRGLYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPA 157

Query: 119 DNYLVGCIGSWGAHIC--AEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIP 176
            +Y++G +G + A +C  AE++GDYG   E I + +YF PQ++ F     ID I FET+P
Sbjct: 158 RDYIIGSVGPYAAFLCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVP 215

Query: 177 NIHELTAILSWD-ESIIK-KPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLA 234
           N+ EL A+L  +  +++K KPFYI +S  +   LRDGT ++ V QL R     L PN L 
Sbjct: 216 NVVELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLC 275

Query: 235 LGINCCSFRYSHMILESLHEELPYIPL---IAYPNSGELYDTVKKIWLKNENC-IVTWDE 290
            G+NC     S  +L  L+ +L   P+     YPN   ++D     W  +++   +TW E
Sbjct: 276 FGLNCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAE 335

Query: 291 IVKSYLQSGARIIGGCCRTTPNDIRQIVTAV 321
            VK YL    R+IGGCC TTP D+RQI  A+
Sbjct: 336 AVKLYLNQDCRMIGGCCGTTPQDMRQIAEAL 366

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  221 bits (564), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/338 (36%), Positives = 195/338 (57%), Gaps = 27/338 (7%)

Query: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQI 61
           +R  +K+  ++N   IL++DGGQGTELE +G+++++P+WST+PFI             + 
Sbjct: 1   MRKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFI------IKNKTHLEA 51

Query: 62  VAGMFEEYIAAGANLLMTITYQSSFKSVSENTD--IKTLEEYNQLLDRIVAFS-RTCIGA 118
           +  M+ ++  AG+N LMTITYQ+SF S+ + ++  + + E+Y   LD ++ F+ R CI  
Sbjct: 52  IKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITP 111

Query: 119 DNYLVGCIGSWGAHIC--AEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIP 176
           D YLVG +G +   +   AE+SG YGE   +I ++DY+ PQ+ +F L   ID+IG ETIP
Sbjct: 112 DKYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETIP 169

Query: 177 NIHELTAILSWDESII--KKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLA 234
           NI E  A+LS + S +   KP+YI ++   +G LRDGT+++++ +  +     L  NF+ 
Sbjct: 170 NIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVF 229

Query: 235 LGINCCSFRYSHMILESLHEELPYIPLI-------AYPNSGELYDTVKKIWLKNENCIV- 286
             INC  F +   IL+SL++ L    +        AYPNSGE+Y      W  N      
Sbjct: 230 FAINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPE 289

Query: 287 -TWDEIVKSYLQSGARIIGGCCRTTPNDIRQIVTAVKK 323
            TW+ +    L     ++GGCCRT   +IRQ+    KK
Sbjct: 290 DTWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  141 bits (355), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%)

Query: 224 LGKKLNPNFLALGINCCSFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNEN 283
           LG K+NPN   LGINC SF  S  ILESLH+ LP + L+AYPNSGE+YDT KKIWL N +
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD 63

Query: 284 CIVTWDEIVKSYLQSGARIIGGCCRTTPNDIRQIVTAVKKY 324
            + +WD +VK Y+ SGARIIGGCCRT+P DI++I  AVKKY
Sbjct: 64  KLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  127 bits (318), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 73/96 (76%)

Query: 1  MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINXXXXXXXXXXXXQ 60
          MVR  +KQLL+ NP ++L++DGGQGTELENRGI VANPVWSTIPFI+            +
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 61 IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIK 96
          IV GMF +++ AGA +LMT TYQ+S+KSVSENT IK
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {ON}
           Anc_1.386 YLR173W
          Length = 594

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 259 IPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIV-----KSYLQSGARI 302
           I L+  PN+  + D +KKIW K+ + +  W ++      KSYL  GA +
Sbjct: 186 ITLLLKPNTKNIVDVLKKIWKKDYDHLNIWSDMSLKLSKKSYLLFGANL 234

>KLTH0E12298g Chr5 complement(1092238..1092918) [681 bp, 226 aa]
           {ON} similar to uniprot|Q02767 Saccharomyces cerevisiae
           YPL065W VPS28 Component of the ESCRT-I complex which is
           involved in ubiquitin-dependent sorting of proteins into
           the endosome involved in transport of precursors for
           soluble vacuolar hydrolases from the late endosome to
           the vacuole
          Length = 226

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 245 SHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQ 297
           S  + E LH E+P       P   E  +T+ +++    + I+T D++ K+YL+
Sbjct: 4   SDFLTEKLHAEVPLFDHYTSPQQRETIETLAEVY----SLIITLDQVEKAYLK 52

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 112 SRTCIGADNYLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRP--QLN 159
           +R C+     ++   G+     C  F+GD+   P  +PYL   +P  QLN
Sbjct: 243 TRQCLVIKKKILEFAGTVKGDYCKMFTGDFNSQPNSVPYLVLTQPRAQLN 292

>TPHA0K00410 Chr11 complement(82127..83827) [1701 bp, 566 aa] {ON}
           Anc_5.558 YML023C
          Length = 566

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 233 LALGINCCSFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIV 292
           L L  N   F+    I++ L  EL +IPL+A    GELY  +    +K++  IV + +  
Sbjct: 396 LCLFDNINQFKAFFYIVD-LSHELFFIPLLAEMTIGELYHDMNPSKIKDQLQIVDYLDNF 454

Query: 293 KSYLQSGARIIGGCCRTTP 311
             +L+   ++I     T P
Sbjct: 455 NKFLEYSIKLIDQGFFTMP 473

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,549,194
Number of extensions: 1474581
Number of successful extensions: 3741
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3787
Number of HSP's successfully gapped: 40
Length of query: 326
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 216
Effective length of database: 40,868,139
Effective search space: 8827518024
Effective search space used: 8827518024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)