Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46118.840ON63063034140.0
ABL126W8.840ON62462720570.0
SAKL0D01474g8.840ON62462220040.0
KLTH0C03872g8.840ON62162518850.0
Kwal_27.102588.840ON62062118700.0
YMR278W (PGM3)8.840ON62262818230.0
KAFR0B039208.840ON62462618230.0
Smik_13.4918.840ON62262818140.0
Suva_13.4668.840ON62262818060.0
TDEL0B005708.840ON63062618050.0
Kpol_1068.88.840ON63262918040.0
NCAS0C004108.840ON62562517730.0
ZYRO0G14190g8.840ON61062617550.0
Skud_13.4508.840ON62262617530.0
KLLA0D01573g8.840ON60762617450.0
KNAG0J002708.840ON62562517410.0
TPHA0I002508.840ON62963617210.0
CAGL0M02981g8.840ON61762317130.0
NDAI0K004108.840ON62662716830.0
TBLA0B032508.840ON64363716710.0
NCAS0F014702.445ON5694361054e-04
KNAG0E009406.11ON538117960.006
Kpol_1032.26.11ON53931950.008
ACR015W6.11ON55242920.017
TBLA0G009806.11ON55831910.021
Kpol_1033.542.445ON570440910.022
CAGL0K07480g2.445ON567595900.030
TDEL0G046006.11ON52843890.035
CAGL0B03597g6.11ON54029870.058
NDAI0H023502.445ON569309870.061
NCAS0F002006.11ON54935870.069
KNAG0E023902.445ON569435860.091
KAFR0L003406.11ON54043850.11
ZYRO0F00506g6.11ON55046850.11
Skud_5.316.11ON55752830.19
SAKL0E00902g6.11ON54479830.20
NDAI0K028906.11ON56129830.21
Suva_5.106.11ON55352820.23
Kwal_56.223556.11ON54144820.28
Smik_5.296.11ON55530820.29
YEL058W (PCM1)6.11ON55730820.30
Smik_13.2912.445ON569426810.32
KLTH0C11506g6.11ON54422810.37
Suva_13.2822.445ON569336800.50
KLLA0D00858g6.11ON54118771.0
TPHA0M002106.11ON54530771.1
KAFR0D030102.445ON569582761.6
CAGL0K03421g2.445ON568438761.6
NDAI0C02220singletonON308220751.6
TBLA0B090102.445ON569304752.0
Kpol_1018.1612.445ON569442742.4
NDAI0D011801.433ON148116712.5
KLTH0B04884g7.367ON57396732.8
Ecym_30146.11ON55122733.4
NDAI0A018107.367ON57096733.4
NCAS0A142307.367ON56997724.0
TDEL0C018007.367ON56997724.1
KNAG0A062802.445ON570213724.2
KAFR0K017007.367ON57996715.0
ZYRO0B02772g7.367ON56996715.1
CAGL0G04279gsingletonON66056707.3
SAKL0F11858g7.367ON56296707.4
Kwal_56.23417singletonOFF72376698.9
TBLA0B08350singletonON436138698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4611
         (630 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...  1319   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   796   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   776   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   730   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   724   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   706   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   706   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   703   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   700   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   699   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   699   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   687   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   680   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   679   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   676   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   675   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   667   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   664   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   652   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   648   0.0  
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    45   4e-04
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    42   0.006
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    41   0.008
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    40   0.017
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    40   0.021
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    40   0.022
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    39   0.030
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.035
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    38   0.058
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    38   0.061
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    38   0.069
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    38   0.091
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    37   0.11 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    37   0.11 
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.19 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    37   0.20 
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    37   0.21 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    36   0.23 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.28 
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    36   0.29 
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    36   0.30 
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    36   0.32 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    36   0.37 
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    35   0.50 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    34   1.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    34   1.1  
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    34   1.6  
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    34   1.6  
NDAI0C02220 Chr3 (494856..495781) [926 bp, 308.666666666667 aa] ...    33   1.6  
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    33   2.0  
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    33   2.4  
NDAI0D01180 Chr4 complement(274695..275141) [447 bp, 148 aa] {ON...    32   2.5  
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    33   2.8  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   3.4  
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    33   3.4  
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    32   4.0  
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    32   4.1  
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               32   4.2  
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    32   5.0  
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    32   5.1  
CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {...    32   7.3  
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    32   7.4  
Kwal_56.23417 s56 complement(528958..531126) [2169 bp, 723 aa] {...    31   8.9  
TBLA0B08350 Chr2 (1999702..2001012) [1311 bp, 436 aa] {ON}             31   8.9  

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 1319 bits (3414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/630 (100%), Positives = 630/630 (100%)

Query: 1   MPKTQVRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFG 60
           MPKTQVRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFG
Sbjct: 1   MPKTQVRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFG 60

Query: 61  TAGLRARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIA 120
           TAGLRARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIA
Sbjct: 61  TAGLRARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIA 120

Query: 121 AFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYK 180
           AFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYK
Sbjct: 121 AFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYK 180

Query: 181 VYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQ 240
           VYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQ
Sbjct: 181 VYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQ 240

Query: 241 RIQSSLVTTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDP 300
           RIQSSLVTTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDP
Sbjct: 241 RIQSSLVTTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDP 300

Query: 301 EFTTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLG 360
           EFTTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLG
Sbjct: 301 EFTTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLG 360

Query: 361 YLFAVGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAID 420
           YLFAVGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAID
Sbjct: 361 YLFAVGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAID 420

Query: 421 LENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEK 480
           LENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEK
Sbjct: 421 LENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEK 480

Query: 481 YGNFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSD 540
           YGNFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSD
Sbjct: 481 YGNFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSD 540

Query: 541 TGNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDK 600
           TGNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDK
Sbjct: 541 TGNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDK 600

Query: 601 EYATKLAKLTWDVLKREWFRPEVTGLQTKF 630
           EYATKLAKLTWDVLKREWFRPEVTGLQTKF
Sbjct: 601 EYATKLAKLTWDVLKREWFRPEVTGLQTKF 630

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/627 (60%), Positives = 468/627 (74%), Gaps = 5/627 (0%)

Query: 6   VRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLR 65
           +++  + +P  L+D + +W  +DKN +T  EI  LV +  W+ELR RL  RI+FGTAGLR
Sbjct: 1   MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLR 60

Query: 66  ARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQL 125
           ARMEAGF+RMNTLTVIQASQGLA YIKSQFP++LKVV+GHDHR++S+ FAE  IAAFLQL
Sbjct: 61  ARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQL 120

Query: 126 GFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGG-ASCGIMITASHNPKMDNGYKVYYS 184
            +++YYLNYVP   D + +VHTPMVPF ++N+EGG  SCG+MITASHNPKMDNGYKVYY+
Sbjct: 121 DYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYA 180

Query: 185 NGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQS 244
           NGCQI PPHD+ I   IDANL PW +AWD++ LIE+A  + +LHDV++E+++ Y   IQ+
Sbjct: 181 NGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQT 240

Query: 245 SLVTTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTT 304
            LV  ++L   G  WFVYTPMHGVGYE F   V + L ++ED+ Y+VV  QK+PDPEF T
Sbjct: 241 MLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPT 300

Query: 305 VSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFA 364
           VSFPNPEE GAL++A+++A  +G  +VLANDPDADRFS AVK   +W QLTGNQ+G LFA
Sbjct: 301 VSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFA 360

Query: 365 VGQLEK-FSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423
             +++  F     ++K LAML S VSSQ++ KMA+ EGF  VETLTGFKWL NRA +LE 
Sbjct: 361 QAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELEL 420

Query: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGN 483
           +G+YVPFAYEEAIGYMFS V HDKDG++AA  FLQM   WKK  K+  +VL   YEKYG 
Sbjct: 421 EGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGY 480

Query: 484 FVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGN 543
           FV+YNGYY     ++  +VF Y RN       PYPS IG EF V   RDLTVGYQSDT  
Sbjct: 481 FVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTAT 540

Query: 544 HIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYA 603
           +IP+LPV   S MITCVLKP+  E   T  + VRFT RGSGTEPKLKVYIES A + + A
Sbjct: 541 NIPDLPVDHNSQMITCVLKPVKME---TDCESVRFTARGSGTEPKLKVYIESCAANHQRA 597

Query: 604 TKLAKLTWDVLKREWFRPEVTGLQTKF 630
           + L+ L WDVLKREWFRP  TGLQT F
Sbjct: 598 SHLSHLAWDVLKREWFRPTETGLQTNF 624

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/622 (60%), Positives = 464/622 (74%), Gaps = 9/622 (1%)

Query: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72
           +PDDL++ ++ W  YDKNP+T +E+ +LV+ ++W EL GRL +RISFGTAGLR+RMEAGF
Sbjct: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67

Query: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132
           +RMNTLTV+QASQGLA+YIKSQFP NL V+VGHDHRY+S  FA V + AFLQLGF+VYYL
Sbjct: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127

Query: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192
           N + S    E++VHTPMVPFT++ +   AS GIMITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 128 N-LSSKDSTETFVHTPMVPFTINQL--NASAGIMITASHNPKMDNGYKVYYSNGCQIIPP 184

Query: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSL 252
           HD+ I+  ID NLVPW++AWD  ++I+ A  +  L DVK+++   Y++ +   LV    L
Sbjct: 185 HDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPML 244

Query: 253 ADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEE 312
            DC K WFVYTPMHGVG+EIF  I    L LKE +HY+ V  Q+ PDP F TVSFPNPEE
Sbjct: 245 -DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 313 EGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFS 372
           +GAL+L+I LA      LV+ANDPDADRFS AVK+G++W QLTGN++G+LFA  Q + + 
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQ 363

Query: 373 NQNENKK---PLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVP 429
              E+ K   PLAM+ STVSSQMI  +A+ E F + +TLTGFKWL NRA +LE  G+YVP
Sbjct: 364 KLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVP 423

Query: 430 FAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGNFVEYN 488
           FAYEEAIGYMF  V HDKDG+SAA  FLQM   W  K+  TPL VL+ G+ KYG F EYN
Sbjct: 424 FAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKEYN 483

Query: 489 GYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPNL 548
           GYY V  LS+  +VF YIR     +   YP  IG+EF+V SFRDLT GYQSDT +++PNL
Sbjct: 484 GYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVPNL 543

Query: 549 PVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLAK 608
           PV   S MIT  L+P   + + TS + VRFTIRGSGTEPKLKVYIE+ + D++ A  LA+
Sbjct: 544 PVDASSQMITATLRPSNGKES-TSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLAR 602

Query: 609 LTWDVLKREWFRPEVTGLQTKF 630
            TW VL+REWFRPE TGL+TKF
Sbjct: 603 ETWQVLRREWFRPERTGLETKF 624

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/625 (58%), Positives = 445/625 (71%), Gaps = 13/625 (2%)

Query: 10  NELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARME 69
           N  +P+DL+  ++ W KYDKN QT  +I  LV+ ++W ELR RL  RI+FGTAGLR+RME
Sbjct: 6   NAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRME 65

Query: 70  AGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEV 129
           AGF RMNTLTV+QASQGLA YI S FP+NL VVVGHDHR+NSK FAEV I AFLQLGF+V
Sbjct: 66  AGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKV 125

Query: 130 YYLNYVP-SNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188
           Y L +   +++DV   VHTPMVPF + ++   AS GIMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 126 YDLGFTEDASQDV--VVHTPMVPFGIDHLR--ASGGIMITASHNPKMDNGYKVYYSNGCQ 181

Query: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248
           I PPHD++I+  I ANL PWD+AWD   +  +A  +  L D K+ L+  YV  ++ SLV 
Sbjct: 182 IIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI 241

Query: 249 TNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308
           TN +      WFVYTP+HGVG+EIF  I+++   L +   YL V  QK+PDP F TVSFP
Sbjct: 242 TN-VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFP 300

Query: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQL 368
           NPEE+GAL+ AIELA +     VL NDPDADRFS A K   +W+QLTGN++G+LFA  + 
Sbjct: 301 NPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKW 360

Query: 369 EKF---SNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425
           E +   S++ +   PLAM+ STVSSQMI KMA+VEGF + +TLTGFKWL NRA +LEN G
Sbjct: 361 ETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAG 420

Query: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFV 485
           ++VPFAYEEAIGYMFS V HDKDG+SAA  FLQM   WK +  TP DVL   Y+KYG F 
Sbjct: 421 YFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFK 480

Query: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545
           EYNGYY V DLS+   VF  IR+  +      P+ IG EF V S+ DLT GYQS+T +  
Sbjct: 481 EYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSE 536

Query: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605
           P LPV P S MIT  L P      Q  S+ VRFT RGSGTEPKLKVYIE+ +  +E A+ 
Sbjct: 537 PRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASA 596

Query: 606 LAKLTWDVLKREWFRPEVTGLQTKF 630
           LAK  WDVL+REWF+PE TGL T F
Sbjct: 597 LAKKAWDVLRREWFKPEQTGLATNF 621

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/621 (57%), Positives = 442/621 (71%), Gaps = 11/621 (1%)

Query: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72
           IP DL+  ++ WF++DKN +T  EI  LV  QNWNEL  RL QRISFGTAGLR++MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132
           +RMNTLTV+QASQGLA YI  +FP N  V VGHDHR+NS+ FAEV   AFLQL F+VY L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192
            +    K  +++VHTPMVPF +  +  GAS G+MITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 128 GFNADPKK-DAFVHTPMVPFAIDRL--GASAGVMITASHNPKMDNGYKVYYSNGCQIIPP 184

Query: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSL 252
           HD+ IA  I  NL PW++AWD + +I +A       D+K+ ++ +YV+ I   LV+++ +
Sbjct: 185 HDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD-I 243

Query: 253 ADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEE 312
            D  K WFVYTP+HGVG+EIF  I +  L L E   Y  V   K PDP F TVSFPNPEE
Sbjct: 244 GDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEE 303

Query: 313 EGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFS 372
            GAL+LAI LA ++G   VL NDPDADRFSAAVK   KW+QLTGN++G+LFA    EK+ 
Sbjct: 304 AGALDLAIALADKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQ 363

Query: 373 NQNENKK---PLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVP 429
            ++   K   PLA++ STVSSQMI K+A VE F + +TLTGFKWL NRA  LE+ G+YVP
Sbjct: 364 KESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVP 423

Query: 430 FAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFVEYNG 489
           FAYEEAIG+MFS + HDKDGVSAA  FLQM   WKK+  +P+DVL + + KYG F EYNG
Sbjct: 424 FAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEYNG 483

Query: 490 YYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPNLP 549
           YY+V DLS+   +F  IR++ +     YP  IGN+F V SF DLT G+QSDT ++ P LP
Sbjct: 484 YYTVPDLSLTDRIFSDIRSSYDS----YPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLP 539

Query: 550 VSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLAKL 609
           V P S MI   L P     +    + VRFT RGSGTEPKLKVYIE+ ++++  A+ LA+ 
Sbjct: 540 VDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLART 599

Query: 610 TWDVLKREWFRPEVTGLQTKF 630
           TW+VL+ EWF+P+ TGL TKF
Sbjct: 600 TWNVLRDEWFKPKETGLSTKF 620

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/628 (55%), Positives = 446/628 (71%), Gaps = 20/628 (3%)

Query: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70
           E +P DL+D I  WFK D+NP+T  E+ +L    +WNEL  R   RI FGTAGLR++M+A
Sbjct: 7   ETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQA 66

Query: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130
           GF+RMNTL VIQASQGLATY++ QFP+NL  VVGHDHR++SK FA    AAFL  GF+V+
Sbjct: 67  GFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVH 126

Query: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190
           YLN  P ++    +VHTP+VPF V  ++  AS G+MITASHNPKMDNGYKVYYSNGCQI 
Sbjct: 127 YLN--PDHE----FVHTPLVPFAVDKLK--ASVGVMITASHNPKMDNGYKVYYSNGCQII 178

Query: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250
           PPHD  I+  IDANL PW   WD   ++  A    +L   ++E++K Y++ +  +LV  N
Sbjct: 179 PPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEIN 238

Query: 251 --SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308
              L    K WFVYTPMHGVG++IF+ IV  TL L E + YL V  Q+ PDP F TV FP
Sbjct: 239 PLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFP 298

Query: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVG 366
           NPEE+GAL++ I LA +   +L++ANDPDADRFS AVKD    +W+QLTGN++G+LFA  
Sbjct: 299 NPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFY 358

Query: 367 QLEKFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423
           + +K+ + +   ++  PLAML STVSSQMI KMA++EGF + +TLTGFKW+ NRAI LE 
Sbjct: 359 EYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEK 418

Query: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYG 482
            G+YVPF +EEAIGYMF ++ HDKDG+SA+  FLQ   +WK +    PL+VL  G++KYG
Sbjct: 419 KGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYG 478

Query: 483 NFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTG 542
            F EYNGYY V + ++  D+F YIRN        YPS+IG E  V  +RDLT GYQSDT 
Sbjct: 479 VFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTI 538

Query: 543 NHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEY 602
           NH P LPV P S MIT   +P    +  + ++++RFTIRGSGTEPKLKVYIE+ A +++ 
Sbjct: 539 NHKPTLPVDPTSQMITVSARP----SNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQR 594

Query: 603 ATKLAKLTWDVLKREWFRPEVTGLQTKF 630
           A+ LAKLTW+VL+REWFRP+   + TKF
Sbjct: 595 ASFLAKLTWNVLRREWFRPDEMNIVTKF 622

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/626 (54%), Positives = 438/626 (69%), Gaps = 16/626 (2%)

Query: 9   MNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARM 68
           ++E +P+ L+   D+W +YD+N +T +EI +++  ++W EL  RL  RI FGTAGLR RM
Sbjct: 11  IDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRM 70

Query: 69  EAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFE 128
           EAGF RMN+L ++Q SQGLA YI  +FP NL VVVGHDHRY+SK FA++ +A FL  GF+
Sbjct: 71  EAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFK 130

Query: 129 VYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188
           V+YLN          +VHTP+VP++V  +   ++CG+MITASHNPK DNGYKVYYSNGCQ
Sbjct: 131 VFYLN------TENEFVHTPLVPYSVDKLR--SACGVMITASHNPKDDNGYKVYYSNGCQ 182

Query: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248
           I PPHDK IA  I+ NL PW + W+ + L      N  L     ++   YVQ I   + T
Sbjct: 183 IIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFT 242

Query: 249 TNS-LADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSF 307
             S +   GK WFVYTPMHGVG++IF  I    L L E+  Y  V  Q  PDP F TVSF
Sbjct: 243 NGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSF 302

Query: 308 PNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAV 365
           PNPEE+GAL++AI+LA R G  L++ANDPDADRFSAAVKD   ++W+QL+GN++G LFA+
Sbjct: 303 PNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAI 362

Query: 366 GQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425
            +L++   +  ++KPLAML STVSSQM+ KMA VEGF + ETLTGFKW+ NRA+ LE  G
Sbjct: 363 FKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQG 422

Query: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGNF 484
           + V F YEEAIGYMF  + HDKDG+ A+  FL M ++W + EG  PLDVL+  +EKYG F
Sbjct: 423 YDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVF 482

Query: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544
            EYNGYY+V++ ++I  VF YIR+       PYP  +G EF + SFRDLT+GYQSDT + 
Sbjct: 483 SEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDF 542

Query: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604
            P LPV   S MIT  LKP          + +RFTIRGSGTEPKLKVYIES+A +KE A 
Sbjct: 543 KPTLPVDASSQMITATLKP----ERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAA 598

Query: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630
            LA LTW+VL+REWFRPE+TGL+T F
Sbjct: 599 NLAHLTWNVLRREWFRPEITGLKTSF 624

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/628 (54%), Positives = 441/628 (70%), Gaps = 20/628 (3%)

Query: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70
           E +P +L++ I  WF+ D+NP+T  E+ +L    +WNEL  R   RI FGTAGLR++M+A
Sbjct: 7   EAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQA 66

Query: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130
           GF RMNTL +IQASQGLATY K QFPNNL  VVGHDHR++SK FA     AFL  GF+V+
Sbjct: 67  GFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVH 126

Query: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190
           YLN  P ++    +VHTP+VPF V  ++  AS G+M+TASHNPKMDNGYKVYYSNGCQI 
Sbjct: 127 YLN--PDHE----FVHTPLVPFAVDKLK--ASVGVMVTASHNPKMDNGYKVYYSNGCQII 178

Query: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250
           PPHD  I+  ID NL PW   W+   ++       +L   ++E++K Y+  +  +LV T+
Sbjct: 179 PPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTD 238

Query: 251 SLA--DCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308
            L      K WFVYTPMHGVG++IF+ IV  T+ L E + YL V  Q+ PDP F TV+FP
Sbjct: 239 PLKFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFP 298

Query: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVG 366
           NPEE+GAL+L I LA   G  L++ANDPDADRFS A+KD    +W+QLTGN++G+LFA+ 
Sbjct: 299 NPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIF 358

Query: 367 QLEKFSN---QNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423
           + +KF +   Q ++  PLAML STVSSQMI KMA+VEGF + ETLTGFKW+ NRAI LE 
Sbjct: 359 EFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEK 418

Query: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYG 482
           +G+YVPF +EEAIGYMF ++ HDKDG+SA+  FLQ   +WK +    P+ +L  G++KYG
Sbjct: 419 EGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYG 478

Query: 483 NFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTG 542
            F EYNGYY V    +  ++F YIRNA     V YPS+IG E  V ++RDLT+GYQSDT 
Sbjct: 479 VFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTS 538

Query: 543 NHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEY 602
           NH P LP+ P S MIT   KP    +     +++RFTIRGSGTEPK+KVYIE+ A +++ 
Sbjct: 539 NHKPTLPIDPSSQMITVSAKP----SDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQR 594

Query: 603 ATKLAKLTWDVLKREWFRPEVTGLQTKF 630
           AT LAKLTW+VLKREWFRPE   + T F
Sbjct: 595 ATFLAKLTWNVLKREWFRPEKMDIVTHF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/628 (54%), Positives = 437/628 (69%), Gaps = 20/628 (3%)

Query: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70
           E +P DL+  I  WF  D+NP+T  E+ +L  + +W+EL  R   RI FGTAGLR+ M+A
Sbjct: 7   ETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQA 66

Query: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130
           GF+RMNTL +IQA+QGLATYIK QFP+NL VVVGHDHR++SK FA     AFL  GF+V+
Sbjct: 67  GFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVH 126

Query: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190
           YLN  P ++    +VHTP+VPF V  ++  AS G+MITASHNPKMDNGYKVYYSNGCQI 
Sbjct: 127 YLN--PDHE----FVHTPLVPFAVDKLK--ASVGVMITASHNPKMDNGYKVYYSNGCQII 178

Query: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250
           PPHD  I+  ID NL PW   W    ++  A    +L   ++E++  Y + +  +LV TN
Sbjct: 179 PPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETN 238

Query: 251 --SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308
              L    K WFVYTPMHGVG+ IF+ IV  T+ L E E YL V  Q+ PDP F TV FP
Sbjct: 239 PLKLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFP 298

Query: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVG 366
           NPEE+GAL++ + LA      L++ANDPDADRFS AVKD   +KW+QLTGN++G+LFA  
Sbjct: 299 NPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFF 358

Query: 367 QLEKFSNQNE---NKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423
           + +++ N++E      PLAML STVSSQMI KMA+VEGF + +TLTGFKW+ NRAI LE 
Sbjct: 359 EFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEK 418

Query: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYG 482
           +G+YVPF +EEAIGYMF ++ HDKDG+SAA   LQ   +WK +    P+D+L  G++KYG
Sbjct: 419 EGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYG 478

Query: 483 NFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTG 542
            F EYNGYY V    +  ++F+YIRN      VPYP +IG E  V  +RDLT GYQSDT 
Sbjct: 479 VFKEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTP 538

Query: 543 NHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEY 602
           +H P LPV P S MIT   KP    +    ++++RFTIRGSGTEPKLKVYIE+ A +++ 
Sbjct: 539 DHKPVLPVDPTSQMITLSGKP----SDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKR 594

Query: 603 ATKLAKLTWDVLKREWFRPEVTGLQTKF 630
           A+ LAKLTWDVL+R WFRPE+  + T F
Sbjct: 595 ASYLAKLTWDVLRRGWFRPEIMNITTDF 622

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/626 (56%), Positives = 437/626 (69%), Gaps = 20/626 (3%)

Query: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72
           +P DL   +  W   D N QT  EI +L  +++W EL  RL  RI FGTAGLR+RMEAGF
Sbjct: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76

Query: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132
           +RMNTL V+QA+QGLA +IK QFP+ L  VVGHDHR+NS+ FA   +A FLQ GF+V +L
Sbjct: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136

Query: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192
           N      D + +VHTP+VPFTV+ +  GAS G+MITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 137 N------DGDKFVHTPIVPFTVNEV--GASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 188

Query: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLV--TTN 250
           HD +IA  I+ NL  W +AW   +L+++  +   L    +E+I+ Y +++  SLV  TT 
Sbjct: 189 HDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTI 248

Query: 251 SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310
           S    GK WFVYTP+HGVGY+IF  I   T++L     YL V  Q+ PDP F TV FPNP
Sbjct: 249 SAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNP 308

Query: 311 EEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGN--KWKQLTGNQLGYLFAVGQL 368
           EE+GAL++AI +A ++G  LVLANDPDADRFSAAVKD     W+QLTGN++G LFA  + 
Sbjct: 309 EEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEF 368

Query: 369 EKFSNQNE---NKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425
           +K+  +NE    K PLAML STVSSQ+I KMA++E F +++TLTGFKW+ NR +DLE   
Sbjct: 369 QKYQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMN 428

Query: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGNF 484
           +YVPF +EEAIGYMF  + HDKDG+SAA+ FLQM  +W     KT L VL   +EKYG F
Sbjct: 429 YYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVF 488

Query: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544
            EYNGYYSV D  +I +VF +IRN  +    PYPS IG E  V  FRDLT+GYQSDT N 
Sbjct: 489 KEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQ 548

Query: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604
            P+LPV P S MIT       K       + VRFTIRGSGTEPKLKVYIE+ +  +E A+
Sbjct: 549 RPDLPVDPNSQMITA----WTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERAS 604

Query: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630
           +LA+LTW VLKREWFRP+VTGL T F
Sbjct: 605 ELAQLTWRVLKREWFRPDVTGLTTTF 630

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/629 (55%), Positives = 441/629 (70%), Gaps = 18/629 (2%)

Query: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70
           E +P DLRDK+  W   DKNP+T  E+  L  + + NEL  R   RI FGTAGLR++MEA
Sbjct: 13  ETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEA 72

Query: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130
           GF+RMNTL V+QA+QGLATYIK QFP+NLK V+GHDHRY+SK FAE+A + FL  GF VY
Sbjct: 73  GFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVY 132

Query: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190
            LN  P      ++VHTP+VPFTV  I  GAS G+MITASHNPKMDNGYKVYYSNGCQI 
Sbjct: 133 NLN--PPG----TFVHTPLVPFTVDQI--GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

Query: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLV--- 247
           PP D  IA  ID NL PW  +WD+ K IE   +N +L  ++ E++  Y  ++ ++++   
Sbjct: 185 PPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKK 244

Query: 248 TTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSF 307
           T     +  K WFVYTPMHGVGYEIF ++V   ++LKE+  YL V  Q  PDP F T+SF
Sbjct: 245 TIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISF 304

Query: 308 PNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGN--KWKQLTGNQLGYLFAV 365
           PNPEE+GAL++AI LA  +   LV+ANDPDADRFSAA+ + +  +W+QLTGN++G+LF  
Sbjct: 305 PNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGY 364

Query: 366 GQLEKFSNQN-ENKK--PLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLE 422
               K++N + E KK  PLAML STVSS+M+  MAD E F F++TLTGFKW+ N+AIDL+
Sbjct: 365 YLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLK 424

Query: 423 NDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGK-TPLDVLNAGYEKY 481
            +G++V F YEEAIGYMF ++ HDKDG++A+  FLQ    W    K T +D+L  G EKY
Sbjct: 425 KEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKY 484

Query: 482 GNFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDT 541
           G F EYNGYY V +  +  D+F YIRN    N   YP  IG    V SFRDLT G+QSDT
Sbjct: 485 GAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDT 544

Query: 542 GNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKE 601
            ++IP+LPV P S MIT   K +  +  Q S   VRFT+RGSGTEPKLK+YIE ++ D  
Sbjct: 545 VDNIPSLPVDPSSQMITITAK-ICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPI 603

Query: 602 YATKLAKLTWDVLKREWFRPEVTGLQTKF 630
            A+K+AKLTWDVLK+EW RPEVTG+ T +
Sbjct: 604 AASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/625 (54%), Positives = 438/625 (70%), Gaps = 19/625 (3%)

Query: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73
           P++LR+ I+ W + D+N +T  E+  L +++NW EL  R   RI FGTAGLR+RMEAGF+
Sbjct: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGFS 71

Query: 74  RMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYLN 133
           RMN+L ++Q++QGLA YIK QFPNNL  VVGHDHR++SK FA V  + FL+ GF+V+YL 
Sbjct: 72  RMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYL- 130

Query: 134 YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPPH 193
             P ++    +VHTP+VPF+V N++  AS G+MITASHNPKMDNGYKVYY N CQI PPH
Sbjct: 131 -TPDDQ----FVHTPLVPFSVLNLK--ASVGVMITASHNPKMDNGYKVYYDNACQIIPPH 183

Query: 194 DKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN--S 251
           DK IA  I  NL PW  +WD     +     N+L  +K  + + Y+ +++  L+ ++  S
Sbjct: 184 DKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLS 243

Query: 252 LADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPE 311
           L D    +FVYTPMHGVG EIF  + +  L+L E+  YLVV  Q+ PDP F TVSFPNPE
Sbjct: 244 LKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPE 303

Query: 312 EEGALNLAIELAARSGAELVLANDPDADRFSAAV--KDGNKWKQLTGNQLGYLFAVGQLE 369
           E+GAL+LAI+LA  +G  LV+ANDPDADRFSAAV  K   KW+QLTGN++G+L    + +
Sbjct: 304 EKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQ 363

Query: 370 KFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGF 426
            +  Q+       PLAM+ STVSSQMI +MAD+ GF + +TLTGFKW+ N+AIDL  +G+
Sbjct: 364 LYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGY 423

Query: 427 YVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGK-TPLDVLNAGYEKYGNFV 485
           YVPF +EEAIGYMF  +  DKDG+SAAT FLQ    W  + + +P D++  G+ K+G F 
Sbjct: 424 YVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFK 483

Query: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545
           EYNGYY ++DLSI   VF +IR+     +  YPS IGNE  V  FRDLTVGYQS+T ++I
Sbjct: 484 EYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNI 543

Query: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605
           PNLPV P S MIT   KP      + +   VR T+RGSGTEPKLKVYIE+ +  +E AT 
Sbjct: 544 PNLPVDPTSQMITVEAKPSEFSNLEGT---VRLTMRGSGTEPKLKVYIEACSKSEESATN 600

Query: 606 LAKLTWDVLKREWFRPEVTGLQTKF 630
           LA+ TWD+LKREWFRPEVTGL T F
Sbjct: 601 LARSTWDILKREWFRPEVTGLTTSF 625

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/626 (54%), Positives = 430/626 (68%), Gaps = 20/626 (3%)

Query: 9   MNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARM 68
           M+  IP++L+  I  W   D+N +T  EI  L D++NW+EL  RL  R+ FGTAGLRARM
Sbjct: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60

Query: 69  EAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFE 128
           EAGF+RMNTL VIQA+QGLA YIK QFP++L  VVGHDHR+NS  FA+      L+ GFE
Sbjct: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120

Query: 129 VYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188
           V+YLN        +SYVHTPMVPFTV  ++  AS G+MITASHNPK+DNGYKVYY+NGCQ
Sbjct: 121 VHYLN------QGDSYVHTPMVPFTVDRVK--ASVGVMITASHNPKLDNGYKVYYANGCQ 172

Query: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248
           I PPHD  IA  I++NL P +  WD  + ++ A +  +L   + ++++ Y+  ++ S VT
Sbjct: 173 IIPPHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVT 232

Query: 249 TNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308
                  GK WFVYTPMHGVGY++F+ I +  L L+ +  +LVV  Q  PDPEF TV FP
Sbjct: 233 ELDSLPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFP 292

Query: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQL 368
           NPEE+GAL+LAI+LA   G +LV+A+DPDADRFS A K  + W+QL+GN +G+LFA  +L
Sbjct: 293 NPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYEL 352

Query: 369 EK---FSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425
           +K   F  + +   PLAML STVSSQMI  MA +EGF   +TLTGFKW+ NRA++LE  G
Sbjct: 353 QKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARG 412

Query: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFV 485
           +YVPF +EEAIGYMF +  HDKDG+SAA  FLQ    W  +GK+PLD+L+    KYG F 
Sbjct: 413 YYVPFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFR 472

Query: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545
           EYNGYY V + S+    F YIR         YP TIG +  V +FRDLT GYQSDT N+I
Sbjct: 473 EYNGYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNI 531

Query: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605
           PNL V P S MIT V +P        S ++VRFT+RGSGTEPKLKVYIE+ A     A +
Sbjct: 532 PNLHVDPSSQMITIVAQP----KGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARE 587

Query: 606 LAKLTWDVLKREWF-RPEVTGLQTKF 630
           LA+ TWD+L+ EWF RP   GL TKF
Sbjct: 588 LARQTWDILREEWFNRP---GLTTKF 610

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/626 (54%), Positives = 436/626 (69%), Gaps = 20/626 (3%)

Query: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72
           IP DL+  I  WF  D++P+T  E+ +L    +W+EL  R   RI FGTAGLR++M+AGF
Sbjct: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68

Query: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132
           +RMN L +IQASQGLATYI+ QFPNNL  VVGHDHR++SK FA     AFL  GF+V+YL
Sbjct: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128

Query: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192
           N  P     + +VHTP+VPF V   E  AS G+MITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 129 N--PG----QEFVHTPLVPFAVD--ELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 180

Query: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN-- 250
           HD+ I++ ID NL PW  AW+   ++       +L   ++E++K Y+++I  +LV T   
Sbjct: 181 HDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPL 240

Query: 251 SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310
            L    K WFVYTPMHGVG++IF+ IV  ++ L E + YL V  Q+ PDP F TV FPNP
Sbjct: 241 KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 311 EEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVGQL 368
           EE+GALN+ + LA +    L++ANDPDADRFS A+KD     W+QLTGN++G+LFA  + 
Sbjct: 301 EEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEF 360

Query: 369 EKFSNQNE---NKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425
           EKF + +E      PLAML STVSSQMI +MA+VEGF + +TLTGFKW+ NRAI LE +G
Sbjct: 361 EKFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEG 420

Query: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGYEKYGNF 484
           +YVPF +EEAIGYMF ++ HDKDG+SA+  FLQ   +WK      P++VL  G++KYG F
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVF 480

Query: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544
            EYNGYY V +  +  ++FKYIR+     +VPYP  IG E  V  +RDLT GYQSDT +H
Sbjct: 481 KEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDH 540

Query: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604
            P LPV P S MIT   +P         ++++RFTIRGSGTEPKLKVYIE+ A ++  A+
Sbjct: 541 KPTLPVDPTSQMITVFARP----NDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRAS 596

Query: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630
            LAKLTWDVL+REWFRPE T + T F
Sbjct: 597 FLAKLTWDVLRREWFRPEKTNITTNF 622

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/626 (54%), Positives = 436/626 (69%), Gaps = 33/626 (5%)

Query: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70
           E +P DL+ K+  W KYDK  +T  EI  L    +  EL  RL   I+FGTAGLR RMEA
Sbjct: 8   ESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEA 67

Query: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130
           GF RMN LTV QASQGLA YIK QFP NL VVVGHDHR+NS+ F +V +  FLQLGF+V+
Sbjct: 68  GFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVF 127

Query: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190
           +LN+    ++ +S VHTP+VPFTV+    GAS GIMITASHNPKMDNGYKVYY+NGCQI 
Sbjct: 128 HLNH----ENEKSLVHTPLVPFTVNAT--GASVGIMITASHNPKMDNGYKVYYTNGCQII 181

Query: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN 250
           PPHDK IA  I  NL P+            +     + D K+++ K Y+  I S+L+   
Sbjct: 182 PPHDKLIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGA 230

Query: 251 SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310
                 + WFVYTPMHGVG+EIF +I    L L+E + YLVV  QK+PD +F TVSFPNP
Sbjct: 231 VNKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNP 290

Query: 311 EEEGALNLAIELAARSG-AELVLANDPDADRFSAAVKDGNK-----WKQLTGNQLGYLFA 364
           EE+GAL+LA+E   ++   +L++ANDPDADRFS AV+D ++     W+QLTGN++G+LFA
Sbjct: 291 EEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFA 350

Query: 365 VGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEND 424
             + E++ +   ++ PLAML STVSSQMI +MA++EGF + +TLTGFKWL NRA++LE +
Sbjct: 351 YYEWERYKHSPIDE-PLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQE 409

Query: 425 GFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNF 484
           G+Y PFAYEEAIGYMFSSV HDKDG+SAA  FLQ  ++W+  G+T LD+L     KYG+F
Sbjct: 410 GYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHF 469

Query: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544
            E+NGYY V DL+I   VF  IR+     + PYP  +G+ F +  FRDLT GYQSDT +H
Sbjct: 470 KEFNGYYIVPDLAITKQVFDAIRSI----ESPYPKKLGSSFEIIKFRDLTNGYQSDTPDH 525

Query: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604
           IP L   P S MITC +  + + T++     VRFTIRGSGTEPKLKVYIE+    +  + 
Sbjct: 526 IPELASDPSSQMITCEMLLVEQPTSR-----VRFTIRGSGTEPKLKVYIEARTNTEPNSI 580

Query: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630
            LAK TWDVL++EWF+PE+TGL T F
Sbjct: 581 ALAKFTWDVLRQEWFKPELTGLLTPF 606

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/625 (54%), Positives = 429/625 (68%), Gaps = 20/625 (3%)

Query: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73
           P+ L+ +I +W + DKN +T  E+  L   Q+W+EL  R  QRI FGTAGLR+RMEAG  
Sbjct: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72

Query: 74  RMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYLN 133
           R+N+L ++QA+QGLA YI SQFP N   VVGHDHR++SK FA V  A FL+ GF+V YLN
Sbjct: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132

Query: 134 YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPPH 193
             P +    + VHTP+VPFTV ++   AS G+MITASHNPKMDNGYKVY++NGCQI PPH
Sbjct: 133 --PGD----TLVHTPLVPFTVDHL--NASVGVMITASHNPKMDNGYKVYFANGCQIIPPH 184

Query: 194 DKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNS-L 252
           D  IA  ID NL PW+ +WD   +I+ A   +R+  VK ++ + Y +  +  L+     L
Sbjct: 185 DLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVL 244

Query: 253 ADCGKN-WFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPE 311
            + G   WFVYTPMHGVG EIF+ I  + L +KE+E YL V  QK PDP F TVSFPNPE
Sbjct: 245 RNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPE 304

Query: 312 EEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGN--KWKQLTGNQLGYLFAVGQLE 369
           E+GAL+ AIELA+++G  LV+ANDPDADRFS AV D     W+QLTGN++G+LFA  Q E
Sbjct: 305 EKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFE 364

Query: 370 KFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGF 426
            +   +   + + PL +L STVSSQMI KMA+VEGF + +TLTGFKW+ NRA DLE  GF
Sbjct: 365 MYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGF 424

Query: 427 YVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEG-KTPLDVLNAGYEKYGNFV 485
           + PF YEEAIGYMF+ + HDKDG+SA+  FL     W  +  K PLD+L  GY+KYG F 
Sbjct: 425 FAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFK 484

Query: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545
           EYNGYY V +  I+ + F YIRN        YP  IG+EF V SFRDLT+G+QSDT +HI
Sbjct: 485 EYNGYYIVDNPKIMKETFDYIRNDRKPG-TQYPEAIGSEFQVVSFRDLTLGFQSDTSDHI 543

Query: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605
           P LPV P S MIT   KP      +   D+VRFTIRGSGTEPKLKVYIE+ +  +  A +
Sbjct: 544 PTLPVDPNSQMITVCAKPTHDNVER---DHVRFTIRGSGTEPKLKVYIEACSGSETGAQQ 600

Query: 606 LAKLTWDVLKREWFRPEVTGLQTKF 630
           LAK  WD L+  WFRP+ TGL T F
Sbjct: 601 LAKQMWDTLQEVWFRPQTTGLVTDF 625

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/636 (53%), Positives = 444/636 (69%), Gaps = 23/636 (3%)

Query: 5   QVRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGL 64
           ++ ++   IP+DL++KI  WF+YD N +T  E++ L  +++ +EL  R  QRI FGTAGL
Sbjct: 7   EIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGL 66

Query: 65  RARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQ 124
           R+RMEAGF RMN LTV+Q++QGLA+YIKSQFP+NL  VVGHDHRY+SK FA++  A FL 
Sbjct: 67  RSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLN 126

Query: 125 LGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYS 184
            GF+VYYLN  P+++    +VHTPMVPF ++     AS G+MITASHNP+MDNGYKVYY+
Sbjct: 127 AGFKVYYLN--PNDE----FVHTPMVPFGINLY--SASIGVMITASHNPEMDNGYKVYYN 178

Query: 185 NGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQS 244
           NGCQI PPHDK IA  I+ NL P    W+ + +I  A  N +L   K+++++ Y+  +  
Sbjct: 179 NGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDK 238

Query: 245 SLVTTN----SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDP 300
            ++  N    +     K WFVYTPMHGVGY+IF+ I +  L+L ED  Y+ V  Q  PDP
Sbjct: 239 YIIPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDP 298

Query: 301 EFTTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQ 358
            F TVSFPNPEE+GAL+L I+ A +   +LV+ANDPDADRFS AV++   ++++QLTGN+
Sbjct: 299 SFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNE 358

Query: 359 LGYLFAVGQLEKFS---NQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLA 415
           +G+LFA    E++S      ++K PLAM+ STVSSQMI KMA+VEGF + +TLTGFKW+ 
Sbjct: 359 IGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIG 418

Query: 416 NRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPL-DVL 474
           N+A +LE +G+YVPF +EEAIGYMF  +  DKDG++A   FLQ    W    K  L D++
Sbjct: 419 NKARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDII 478

Query: 475 NAGYEKYGNFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLT 534
             G++KYG F EYNGYY V DLS+   +F  IR   N  +  Y S IG EF V +FRDLT
Sbjct: 479 ETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLT 537

Query: 535 VGYQSDTGNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIE 594
           +GYQSDT  ++P LPV P S MIT  + P    T+   +  VRFTIRGSGTEPKLKVYIE
Sbjct: 538 LGYQSDTIGNVPTLPVDPSSQMITMTIIP----TSLPENGSVRFTIRGSGTEPKLKVYIE 593

Query: 595 SNALDKEYATKLAKLTWDVLKREWFRPEVTGLQTKF 630
           +NA  +  A +LAKLTWDVLKREWF  E TGL T F
Sbjct: 594 ANAKTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/623 (52%), Positives = 427/623 (68%), Gaps = 16/623 (2%)

Query: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72
           IP +LR  I+ W + DKN +T  E+  L + QNW+EL  R   RI FGTAGLRARMEAG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132
            R+N L ++QASQGLATYIK +FP NL  VVGHDHRY+S+ FA+V  A F++ GF+VYYL
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192
           N  P ++    +VHTPMVP++V ++   AS G+MITASHNPKMDNGYKVYY+NGCQI PP
Sbjct: 126 N--PHDE----FVHTPMVPYSVDHL--NASVGVMITASHNPKMDNGYKVYYTNGCQIIPP 177

Query: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSL 252
           HD  IA  I+ NL PW   W+  K++ +A  + ++  V++ ++ +Y+  + + L+  +  
Sbjct: 178 HDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFA 237

Query: 253 ADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEE 312
           A   K WFVYTPMHGVG++IF+ I+  +L+LK++  Y+ V  QK PDP F TVSFPNPEE
Sbjct: 238 APDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEE 297

Query: 313 EGALNLAIELAARSGAELVLANDPDADRFSAAVKDG--NKWKQLTGNQLGYLFAVGQL-- 368
           +GALNLAI LA  +G +LVLANDP+ADRFS AV+D   N+WKQLTGN++G LFA  +   
Sbjct: 298 KGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKM 357

Query: 369 -EKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFY 427
            +K +++    KPLAML STVS+Q+I +MA+ EGF + +TLTGFKW+ N A  LE  G++
Sbjct: 358 YQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYF 417

Query: 428 VPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFVEY 487
           VPF YEEAIGYMF ++ HDKDGVSAA  FLQ  A W +    P+D+++  Y+KYG   EY
Sbjct: 418 VPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEY 477

Query: 488 NGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPN 547
           NGYY V D S    VF+ IR++     + +P +IG  F V  FRDLT+G+ S T +  P 
Sbjct: 478 NGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPL 537

Query: 548 LPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLA 607
           LPV   S MIT    P     A  + + VRFTIRGSGTEPKLKVYIE  +  +  A  LA
Sbjct: 538 LPVDKNSQMITITAVP---SGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILA 594

Query: 608 KLTWDVLKREWFRPEVTGLQTKF 630
           K  W+ LK EWF+P   GL T F
Sbjct: 595 KSLWETLKHEWFKPSSNGLSTDF 617

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/627 (53%), Positives = 430/627 (68%), Gaps = 23/627 (3%)

Query: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73
           P +LR+ ID W + DK  +T  E+  L    NW EL  R   RI FGTAGLR+RMEAGF+
Sbjct: 13  PANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGFS 72

Query: 74  RMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYLN 133
           RMN L ++QASQGLA YIK+QFP NL  VVGHDHR++SK FA +  + FL++GF+VYYLN
Sbjct: 73  RMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLN 132

Query: 134 YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPPH 193
             P     +S+VHTP+VPF+V+++   AS G+MITASHNPKMDNGYKVYYSNGCQI PPH
Sbjct: 133 --PE----DSFVHTPLVPFSVNHL--NASIGVMITASHNPKMDNGYKVYYSNGCQIIPPH 184

Query: 194 DKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSLA 253
           DK IA+ ID NL PW   W+     E      +L  V++E+   Y+Q ++  LV++ S++
Sbjct: 185 DKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS-SIS 243

Query: 254 DCGKN----WFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPN 309
               N    WFVYTPMHGVGY IF  I  N LH +E+  Y VV  Q +PDP F TVSFPN
Sbjct: 244 RPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPN 303

Query: 310 PEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVGQ 367
           PEE+GAL+LA +LA  +   LV+ANDPDADRFS A K+    +W+QL+GN++G+LFA  +
Sbjct: 304 PEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFE 363

Query: 368 LEKFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEND 424
           LEK+ +Q+       PLAM+ STVSSQMI KMA VE F + +TLTGFKW+ NRA+DL+  
Sbjct: 364 LEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQ 423

Query: 425 GFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGN 483
           G+YVPF +EEAIGYMF ++  DKDGVSAA  FL   + W   +G  P D+L  G++K+G 
Sbjct: 424 GYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGF 483

Query: 484 FVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGN 543
           F EYNGYY   D      +F ++R   + +  PYP  IG EF +  FRDLT GYQS+T +
Sbjct: 484 FKEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTID 543

Query: 544 HIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYA 603
           ++PNLPV P S MIT    P  K+    S   VRFT+RGSGTEPKLK+YIE+ A +++ A
Sbjct: 544 NLPNLPVDPHSEMITIEAVP--KQDIGKSK--VRFTMRGSGTEPKLKLYIEAVADNEKCA 599

Query: 604 TKLAKLTWDVLKREWFRPEVTGLQTKF 630
             LA   W+VLK+EW RP+VTGL T F
Sbjct: 600 IDLAYEMWNVLKKEWIRPDVTGLTTTF 626

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/637 (52%), Positives = 423/637 (66%), Gaps = 28/637 (4%)

Query: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73
           P+DL+ K+  W + DK+  T  EI  L  S N  EL  R   RI+FGTAGLR+ MEAGF+
Sbjct: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74

Query: 74  RMNTLTVIQASQGLATYIKSQFPNN---LKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130
           RMNTLTV+QASQGLATY+K+   N    L  V+GHDHRY+SK FA++A   FL  GF+VY
Sbjct: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134

Query: 131 YLN--YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188
           YLN   +   +D   +VHTPMVPFTV N++  AS G+M+TASHNPKMDNGYKVYYSNGCQ
Sbjct: 135 YLNDDSLEDPRD-NKFVHTPMVPFTVKNLK--ASVGVMVTASHNPKMDNGYKVYYSNGCQ 191

Query: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248
           I PPHD  I+  IDANL PW+ +W+ ++++ +A +   L   +  ++ +Y+ +++  L +
Sbjct: 192 IIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTS 251

Query: 249 ------TNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEF 302
                 +  +    K WFVYTPMHGVGYEIF  I    LH+KE E ++VV  QK PDP F
Sbjct: 252 KDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGF 311

Query: 303 TTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNK---WKQLTGNQL 359
            TVSFPNPEE+GA+++ I+LA  +G  LV+ANDPDADRFS AVK       W Q TGN++
Sbjct: 312 PTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEI 371

Query: 360 GYLFAVGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAI 419
           GYLFA  + +K+    ++   L M+ STVSSQMI KMA++EGF + ETLTGFKW+ NRAI
Sbjct: 372 GYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAI 431

Query: 420 DLENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGY 478
           DL N G  VPF YEEAIGYMF ++  DKDG++A   F+Q    W +  K  P +++  G+
Sbjct: 432 DLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQLGF 491

Query: 479 EKYGNFVEYNGYYSVQDLSIIGDVFKYIR-----NACNGNDVPYPSTIGNEFAVASFRDL 533
           +KYG F+EYNGYY   DL I   +F Y+R         GN   YP  IG EF +  +RDL
Sbjct: 492 KKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNK-KYPDHIGEEFKIIKYRDL 550

Query: 534 TVGYQSDTGNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYI 593
           T GYQSDT ++ P LPV P S MIT  + P    T   S   +R TIRGSGTEPKLKVYI
Sbjct: 551 TTGYQSDTPDNKPLLPVDPSSQMITVEMIP----TDNESDGSIRLTIRGSGTEPKLKVYI 606

Query: 594 ESNALDKEYATKLAKLTWDVLKREWFRPEVTGLQTKF 630
           E+ +     A+ LAK  W+VLKREW RPE TG+ T F
Sbjct: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 107/436 (24%), Positives = 162/436 (37%), Gaps = 73/436 (16%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFA 115
           GT+GLR + +      N T   IQA       I    P   K   +VVG D RY    + 
Sbjct: 19  GTSGLRKKTKIFKDTPNYTENFIQA-------IMDAIPEGSKGATLVVGGDGRY----YN 67

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNP-- 173
           +V +     +G        V   + + S   TP     +   E     GI++TASHNP  
Sbjct: 68  DVILHKIAAIGAANGVKKLVIGQRGLLS---TPAASHIMRTYEEKTQGGIILTASHNPGG 124

Query: 174 -KMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHD--- 229
            K D G K   SNG     P   KI  EI   +  +    D  +L  +    N+ +    
Sbjct: 125 IKNDMGIKFNLSNGGPAPEPVTNKIW-EISKKMTSFKIIKDFPELELETLGKNKKYGPLL 183

Query: 230 -------------VKQ----ELIKNYVQRIQSSLVTTNSLADCGKNW-FVYTPMHGVGYE 271
                        VKQ    +LIK +V + + +           K+W  ++  M+GV   
Sbjct: 184 VDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDT-----------KHWKLLFDGMNGVTGP 232

Query: 272 IFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELV 331
               I  + L L  DE    V  Q  P P+F  V  P+P    A  L ++   R   E  
Sbjct: 233 YGKAIFVDELGLPADE----VLQQWHPSPDFGGVH-PDPNLTYAKAL-VDRVDRENIEFG 286

Query: 332 LANDPDADRFSAAVKDGNKWKQLTGNQLGYLFA-VGQLEKFSNQNENKKPLAMLGSTVSS 390
            A+D D DR    +          G+ +  +     ++  F+ Q        +  S  +S
Sbjct: 287 AASDGDGDR--NMIYGAGPAFVSPGDSVAIIAEYAAEIPYFAKQG----IYGLARSFPTS 340

Query: 391 QMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDGV 450
             I ++A   G    E  TG+K+          D   +    EE+ G   S+   +KDG+
Sbjct: 341 SAIDRVAKAHGLNCYEVPTGWKFFCALF-----DAKKLSICGEESFG-TGSNHVREKDGI 394

Query: 451 SAATEFLQMAARWKKE 466
            A   +L + A + K 
Sbjct: 395 WAILAWLNLLAIYNKH 410

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 17/117 (14%)

Query: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASEIDANLVP---WDQAWDA-Q 215
           GA  G+M+TASHNP  DNG KV    G  + P   + +A+ + ANL     +DQ W+   
Sbjct: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGML-PEQWEPLATRL-ANLAANGTFDQWWEYWT 112

Query: 216 KLIEDAR--NNNRL---HDVKQ---ELIKNYVQRIQSSLVTTNSLADCGKNWFVYTP 264
            L+E+       RL   HD ++    L+KN    + ++L  +       K W    P
Sbjct: 113 SLVEEGNYTGGARLCVGHDTRESSPRLLKNL---MDAALAVSGGSITISKPWITNHP 166

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 159 GGASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           GG + G+MITASHNP  DNG K+   NG  +
Sbjct: 50  GGKAVGVMITASHNPPEDNGVKIVEPNGAML 80

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 8/42 (19%)

Query: 159 GGASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASE 200
           GGA  G+M+TASHNP  DNG K        +  PH + +A+E
Sbjct: 54  GGAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAE 87

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQIT 190
           G + G+M+TASHNP +DNG K+   NG  ++
Sbjct: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSMLS 89

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 105/440 (23%), Positives = 173/440 (39%), Gaps = 82/440 (18%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFA 115
           GT+GLR + +   +  N T   IQ+       I +  PN +K   +VVG D R+    + 
Sbjct: 19  GTSGLRKKTKIFMSEKNYTENFIQS-------ILNSIPNGVKNSTIVVGGDGRF----YN 67

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASC---GIMITASHN 172
           ++ +   +Q+         V     + S   TP   + + N +   SC   GI++TASHN
Sbjct: 68  DIILDKIMQISAANGVRKLVIGQNGILS---TPAASYIIRNYK--ESCNGGGIILTASHN 122

Query: 173 ---PKMDNGYKVYYSNGCQITPPHDKKIASEI--------DANLVPWDQAWDAQKLIEDA 221
              P+ D G K   SNG     P  + I  EI           ++      D  K+ E+ 
Sbjct: 123 PGGPENDIGIKYNLSNGG----PAPESITDEIWEASKHLTHYKIIENLPQLDTTKVSENV 178

Query: 222 RNNNRLHDVKQELIKNYVQRIQS--------SLVTTNSLADCGKNW-FVYTPMHGVGYEI 272
           +    L D+     K+YV+ ++         + + T    +   NW  ++  ++GV    
Sbjct: 179 KYGPLLVDIIDS-TKSYVELMKEIFDFPLIRNFIHTQREKN---NWKLLFDSLNGVTGPY 234

Query: 273 FNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELV- 331
              I  + L L  DE          P P+F  +  P+P     L  A  L  R   E++ 
Sbjct: 235 GKTIFVDELGLLADETL----QNWHPLPDFGGLH-PDPN----LTYAHTLVERVDREMIN 285

Query: 332 --LANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVG-QLEKFSNQNENKKPLAMLG--- 385
              A+D D DR +     G  +    G+ L  +     ++  F+ Q        M G   
Sbjct: 286 FGAASDGDGDR-NMIYGYGPSFVS-PGDSLAIISEYADEIPYFAKQ-------GMFGVAR 336

Query: 386 STVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTH 445
           S  +S  I ++A  +G    E  TG+K+          D   +    EE+ G   S+   
Sbjct: 337 SFPTSSAIDRVAKAKGLNCYEVPTGWKFFCALF-----DAQKLSICGEESFG-TGSNHIR 390

Query: 446 DKDGVSAATEFLQMAARWKK 465
           +KDG+ A   +L + A + K
Sbjct: 391 EKDGLWAIVAWLNILAIYNK 410

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 137/595 (23%), Positives = 223/595 (37%), Gaps = 121/595 (20%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFA 115
           GT+GLR + +      N T   IQA       I    P   K   +VVG D R+    + 
Sbjct: 17  GTSGLRKKTKVFMEEPNYTENFIQA-------IMDAIPEGAKDAVLVVGGDGRF----YN 65

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHN--- 172
           +V +     +G        +     + S   TP     + +     + GI++TASHN   
Sbjct: 66  DVIMQKIAAIGAANGVRKLIIGQNGLLS---TPAASHVIRSYAEKCTGGIILTASHNPGG 122

Query: 173 PKMDNGYKVYYSNGCQITPP-------------HDKKIAS--EIDANLVPWDQAW----- 212
           P+ D G K   +NG     P             H K I    ++D + +  DQ +     
Sbjct: 123 PENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLV 182

Query: 213 DAQKLIED-ARNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNW-FVYTPMHGVGY 270
           D     ED  +    + D K  LIK ++ + + +           KNW  ++  ++G+  
Sbjct: 183 DIIDTTEDYVKFMKEIFDFK--LIKEFIHKQREA-----------KNWKLLFDSLNGITG 229

Query: 271 EIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAEL 330
                I  +   L  DE    V     P P+F  +  P+P    A  L +E   R   E 
Sbjct: 230 PYGKAIFVDEFDLPADE----VLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVDREKIEF 283

Query: 331 VLANDPDADR------FSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFSNQNENKKPLAML 384
             A+D D DR        A V  G+            +  + +  K     + +    + 
Sbjct: 284 GAASDGDGDRNMIYGAGPAFVSPGDS-----------VAIIAEYAKEIPYFQKQGIYGLA 332

Query: 385 GSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVT 444
            S  +S  I ++A  +G    E  TG+K+          D   +    EE+ G   S+  
Sbjct: 333 RSFPTSGAIDRVAKAQGLNCYEVPTGWKFFCALF-----DAKKLSICGEESFG-TGSNHI 386

Query: 445 HDKDGVSAATEFLQMAARWKK---EGKTPLDVLNAGY-EKYGNFV----EYNGYYSVQDL 496
            +KDGV A   +L + A + K   E +  +  +   +  KYG       +Y G  + +  
Sbjct: 387 REKDGVWAICAWLNILALYNKHNPEKEASIKTIQEEFWAKYGRTFFTRYDYEGITTEKAN 446

Query: 497 SIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGN-HIPNLPVSPGSH 555
            ++  + K++ +  + N  P+P   G+E        LTV   SD G+    +L  S   H
Sbjct: 447 KVVDLLDKFVNDPKSKN-APFP---GDE-------SLTV---SDCGDFSYTDLDGSVSDH 492

Query: 556 MITCVLKPLIKETAQTSSDYVRFTIRGSGT---EPKLKVYIESNALDKEYATKLA 607
               V            S+  RF +R SGT      +++YIE  + DK   T+ A
Sbjct: 493 QGLFV----------KLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSA 537

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%)

Query: 147 TPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           T +V    S +  G   G+MITASHNP  DNG KV   +G  +
Sbjct: 41  TGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKVVEPDGSML 83

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 161 ASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           A  G+MITASHNP  DNG K+  S+G  +
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSML 80

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 114/309 (36%), Gaps = 60/309 (19%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFA 115
           GT+GLR +      + + T   IQA       I    P   K   +VVG D RY    + 
Sbjct: 19  GTSGLRKKTRVFKDKPHYTENFIQA-------IMDAIPEGAKGATLVVGGDGRY----YN 67

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNP-- 173
           +V +     +G        V     + S   TP     +   E   + GI++TASHNP  
Sbjct: 68  DVILHKIAAIGAANGVKKLVVGQHGLLS---TPAASHIMRTYEEKTTGGIILTASHNPGG 124

Query: 174 -KMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLH---- 228
            + D G K   SNG     P   KI  EI   +  +    D  +L  +    N+ +    
Sbjct: 125 LENDMGIKYNLSNGGPAPEPVTNKIW-EISKKMTHYKIIKDFPELELETLGKNKKYGPLL 183

Query: 229 ----DVKQ------------ELIKNYVQRIQSSLVTTNSLADCGKNW-FVYTPMHGVGYE 271
               D+ +            ELIK ++   +             K+W  ++  M+GV   
Sbjct: 184 VDVIDITKAYVDFLKEIFDFELIKKFIHNQREK-----------KHWKLLFDGMNGVTGP 232

Query: 272 IFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELV 331
               I  +   L  DE    V  Q  P P+F  V  P+P    A  L ++   R   E  
Sbjct: 233 YGKAIFVDEFGLPADE----VLQQWHPQPDFGGVH-PDPNLTYAKAL-VDRVNREKIEFG 286

Query: 332 LANDPDADR 340
            A+D D DR
Sbjct: 287 AASDGDGDR 295

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 155 SNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           S +  G   G+M+TASHNP +DNG KV    G  +
Sbjct: 52  SMVLCGTPVGVMVTASHNPPLDNGVKVVEPTGAML 86

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 100/435 (22%), Positives = 162/435 (37%), Gaps = 73/435 (16%)

Query: 60  GTAGLRARMEAGFARMNTLT--VIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSF 114
           GT+GLR +  A F      T   IQA       +    P   K   +VVG D RY    +
Sbjct: 19  GTSGLRKKT-AVFTNEPHYTENFIQA-------VMEAIPEGCKGATLVVGGDGRY----Y 66

Query: 115 AEVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHN-- 172
            +V +     +G        V     + S   TP     +   +   + GI++TASHN  
Sbjct: 67  NDVILHKIAAIGAANGVRKLVIGQNGLLS---TPAASHIMRTYKEKCTGGIILTASHNPG 123

Query: 173 -PKMDNGYKVYYSNGCQITPPHDKKI---ASEIDA-NLVPWDQAWDAQKLIEDARNNNRL 227
            PK D G K   SNG     P   KI   + ++D   ++P         L E+ +    L
Sbjct: 124 GPKNDMGIKYNLSNGGPAPEPVTNKIWEVSKQLDHYKIIPDLPELALDTLAENVQYGPLL 183

Query: 228 HDVKQE---------------LIKNYVQRIQSSLVTTNSLADCGKNW-FVYTPMHGVGYE 271
            DV                  LIK+++ + +S            K+W  ++  M+GV   
Sbjct: 184 VDVVDTTRDYVEFLKEIFDFPLIKSFIHKQRSQ-----------KHWKLLFDGMNGVTGP 232

Query: 272 IFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELV 331
               I  +   L  +E    V     P P+F  +  P+P    A +L ++   R   E  
Sbjct: 233 YGKAIFVDEFELPAEE----VLQNWHPQPDFGGIH-PDPNLTYARSL-VDRVDRENIEFG 286

Query: 332 LANDPDADRFSAAVKDGNKWKQLTGNQLGYLFA-VGQLEKFSNQNENKKPLAMLGSTVSS 390
            A+D D DR    +          G+ +  +     ++  F+ Q        +  S  ++
Sbjct: 287 AASDGDGDR--NMIYGAGPAFVSPGDSVAIIAEYAAEIPYFAKQG----IYGLARSFPTA 340

Query: 391 QMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDGV 450
             I ++A+  G    E  TG+K+          D   +    EE+ G   S+   +KDGV
Sbjct: 341 SAIDRVAEKHGLKCYEVPTGWKFFCALF-----DAKKLSICGEESFG-TGSNHVREKDGV 394

Query: 451 SAATEFLQMAARWKK 465
            A   +L + A + +
Sbjct: 395 WAIIAWLNLLAIYNR 409

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 147 TPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           T +V    S +  G   G+MITASHNP  DNG K+   +G  +
Sbjct: 43  TGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPSGAML 85

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASEIDANL 205
           G   G+M+TASHNP +DNG KV   +G  + P   + +A+E+   L
Sbjct: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTL 100

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 139 KDVESYVHTPMVPFTVSNIE-GGASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           KD+++ + T  +   + +++  G   G+MITASHNP  DNG K+   +G  +
Sbjct: 35  KDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 33/79 (41%), Gaps = 27/79 (34%)

Query: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWD--AQKL 217
           G   G+MITASHNP  DNG K+                   +D      DQAW+  A +L
Sbjct: 55  GQYVGVMITASHNPPQDNGVKI-------------------VDPKGEMLDQAWEPFATEL 95

Query: 218 IEDARNNNRLHDVKQELIK 236
              A         KQELIK
Sbjct: 96  ANSASKG------KQELIK 108

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 161 ASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           ++ G+M+TASHNP  DNG K+   NG  +
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSML 94

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 139 KDVESYVHTPMVPFTVSNIE-GGASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           KD+++ + T  +   + +++  G   G+MITASHNP  DNG K+   +G  +
Sbjct: 35  KDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 150 VPFTVSNIEG-------GASCGIMITASHNPKMDNGYKVYYSNG 186
           V FT   + G       G + G+MITASHNP  DNG K+    G
Sbjct: 38  VMFTTGVVAGLRSIFLEGKTVGVMITASHNPPEDNGVKIVDPKG 81

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           G   G+MITASHNP  DNG K+   +G  +
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSML 86

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           G   G+MITASHNP  DNG K+   +G  +
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSML 86

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 102/426 (23%), Positives = 160/426 (37%), Gaps = 53/426 (12%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFA 115
           GT+GLR + +    + N T   IQ+       I    P   K   +VVG D RY    + 
Sbjct: 19  GTSGLRKKTKVFKDQPNYTENFIQS-------IMEAIPEGSKGATLVVGGDGRY----YN 67

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHN--- 172
           +V +     +G        V     + S   TP     +   E   + GI++TASHN   
Sbjct: 68  DVILHKIAAIGAANGVKKLVIGQHGLLS---TPAASHIMRTYEEKCTGGIILTASHNPGG 124

Query: 173 PKMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNR-----L 227
           P+ D G K   SNG    P     +  +I   L  +    D  +L       N+     L
Sbjct: 125 PENDMGIKYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYGPLL 183

Query: 228 HDVKQELIKNYVQRIQS--SLVTTNSLAD---CGKNW-FVYTPMHGVGYEIFNNIVTNTL 281
            D+  ++ K+YV  ++            D     KNW  ++  M+GV       I  +  
Sbjct: 184 VDI-IDITKDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEF 242

Query: 282 HLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRF 341
            L  DE    V     P P+F  +  P+P    A  L ++   R   E   A+D D DR 
Sbjct: 243 GLPADE----VLQNWHPSPDFGGMH-PDPNLTYASTL-VKRVDREKIEFGAASDGDGDR- 295

Query: 342 SAAVKDGNKWKQLTGNQLGYLFA-VGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVE 400
           +     G  +    G+ +  +     ++  F+ Q        +  S  +S  I ++A   
Sbjct: 296 NMIYGYGPSFVS-PGDSVAIIAEYAAEIPYFAKQG----IYGLARSFPTSAAIDRVAKAH 350

Query: 401 GFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMA 460
           G    E  TG+K+          D   +    EE+ G   S+   +KDGV A   +L + 
Sbjct: 351 GLNCYEVPTGWKFFCALF-----DAKKLSICGEESFG-TGSNHVREKDGVWAIMAWLNIL 404

Query: 461 ARWKKE 466
           A + K 
Sbjct: 405 AIYNKH 410

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 17/22 (77%)

Query: 160 GASCGIMITASHNPKMDNGYKV 181
           G + G+MITASHNP  DNG K+
Sbjct: 55  GRTVGVMITASHNPPEDNGVKI 76

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 129/336 (38%), Gaps = 35/336 (10%)

Query: 145 VHTPMVPFTVSNIEGGASCGIMITASHN---PKMDNGYKVYYSNGCQITPPHDKKIASEI 201
           + TP     +   E   + GI++TASHN   P+ D G K   SNG    P        EI
Sbjct: 94  LSTPAASHIMRTYEDKCTGGIILTASHNPGGPENDMGIKYNLSNGGP-APESVTNAIWEI 152

Query: 202 DANLVPWD-----QAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQS--SLVTTNSLAD 254
              L  +         D Q + +D +    L D+  ++ K YV+ ++            D
Sbjct: 153 SKKLTSYKIVKDFPELDLQTIGKDRKYGPLLIDI-IDVTKAYVELMEEIFDFNLIKKFID 211

Query: 255 ---CGKNW-FVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310
                KNW  ++  M+GV       I  +   L  +E    V     P P+F  +  P+P
Sbjct: 212 NQRSTKNWKLLFDSMNGVTGPYGKAIFVDKFGLPAEE----VLQNWHPSPDFGGMH-PDP 266

Query: 311 EEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFA-VGQLE 369
               A +L ++   R   E   A+D D DR +     G  +    G+ +  +     ++ 
Sbjct: 267 NLTYASSL-VKRVDREQIEFGAASDGDGDR-NMIYGYGPSFVS-PGDSVAIIAEYAAEIP 323

Query: 370 KFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVP 429
            F+ Q        +  S  +S  I ++A   G    E  TG+K+          D   + 
Sbjct: 324 YFAKQG----IYGLARSFPTSAAIDRVAKAHGLNCYEVPTGWKFFCALF-----DAKKLS 374

Query: 430 FAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKK 465
              EE+ G   S+   +KDGV A   +L + A + K
Sbjct: 375 ICGEESFG-TGSNHVREKDGVWAIMAWLNILAIYNK 409

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 164 GIMITASHNPKMDNGYKV 181
           G+MITASHNP  DNG KV
Sbjct: 55  GVMITASHNPPEDNGVKV 72

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQI 189
           G + G+MITASHN   DNG K+   +G  +
Sbjct: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 133/582 (22%), Positives = 220/582 (37%), Gaps = 109/582 (18%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFP---NNLKVVVGHDHRYNSKSFA 115
           GT+GLR +        N T   IQA       I    P   +   +VVG D RY    + 
Sbjct: 19  GTSGLRKKTVIFKDEPNYTENFIQA-------IMESIPEGSDGATLVVGGDGRY----YN 67

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHN--- 172
           +V +    ++G        V     + S   TP     + +     + GI++TASHN   
Sbjct: 68  DVILEKIAKIGAANGVKKLVVGQNGLLS---TPAASHIIRSYHEKVTGGIILTASHNPGG 124

Query: 173 PKMDNGYKVYYSNGCQITPPHDKKIASEIDAN--------LVPWDQAWDAQKLIEDARNN 224
           PK D G K   +NG     P  + +  +I  N        ++      D  K+ E+ +  
Sbjct: 125 PKNDMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYG 180

Query: 225 NRLHDVKQELIKNYVQRIQS--------SLVTTNSLADCGKNW-FVYTPMHGVGYEIFNN 275
             L DV  ++ K YV+ ++           + T       KNW  ++  ++G+       
Sbjct: 181 PILIDV-IDVTKAYVEFLKEIFDFELIKKFIHTQRKT---KNWKLLFDGLNGITGPYGKA 236

Query: 276 IVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELVLAND 335
           I  +   L E+E    V     P P+F  +  P+P    A +L ++   +   E   A+D
Sbjct: 237 IFVDEFELPENE----VLQNYHPQPDFGGLH-PDPNLTYARSL-VDRVDKEKIEFGAASD 290

Query: 336 PDADR------FSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFSNQNENKKPLAMLGSTVS 389
            D DR        A V  G+    +            ++  F+ Q        +  S  +
Sbjct: 291 GDGDRNMIYGYGPAFVSPGDSVAIIAE-------YASEIPYFAKQG----IYGLARSFPT 339

Query: 390 SQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDKDG 449
           S  I ++A   G    E  TG+K+          D   +    EE+ G   S+   +KDG
Sbjct: 340 SAAIDRVAKAHGLECYEVPTGWKFFCALF-----DAKKLSICGEESFG-TGSNHVREKDG 393

Query: 450 VSAATEFLQMAARWKK---EGKTPLDVLNAGY-EKYGN--FVEYN-GYYSVQDLSIIGDV 502
           + A   +L + A + K   E +  +  +   +  KYG   F  Y+  + + +D + + D+
Sbjct: 394 LWAIVAWLNVLAIFNKHHPEREASIKTIQDDFWLKYGRTFFTRYDYEHVTSEDANKVVDL 453

Query: 503 FKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGN-HIPNLPVSPGSHMITCVL 561
                +     + P+P   G+E        LTV   +D GN    +L  S  S     V 
Sbjct: 454 LTEFTSNSKTKNAPFP---GDE-------SLTV---TDCGNFSYTDLDGSVSSKQGLSV- 499

Query: 562 KPLIKETAQTSSDYVRFTIRGSGTEPK---LKVYIESNALDK 600
                      SD  RF +R SGT      +++Y+E  + DK
Sbjct: 500 ---------KLSDGSRFVLRLSGTGSSGATIRLYVEKYSGDK 532

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 99/438 (22%), Positives = 156/438 (35%), Gaps = 87/438 (19%)

Query: 60  GTAGLRARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFAE 116
           GT+GLR + +    + N +      +     +    P   K   +VVG D RY    + +
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRY----YND 67

Query: 117 VAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHN---P 173
           V +     +G        V     + S   TP     +   +   + GI++TASHN   P
Sbjct: 68  VILQKIAAIGAANGVKKLVIGQNGLLS---TPAASHIMRTYKEKCTGGIILTASHNPGGP 124

Query: 174 KMDNGYKVYYSNGCQITPPHDKKIASEIDANLVPWD-----QAWDAQKLIEDARNNNRLH 228
           + D G K   SNG     P   KI  EI   L  +         D  KL+E+ +    L 
Sbjct: 125 ENDMGIKYNLSNGGPAPEPVTNKIW-EISKKLTHYKIVKDFPELDLTKLVENKKYGPLLV 183

Query: 229 DVKQ---------------ELIKNYVQRIQSSLVTTNSLADCGKNW-FVYTPMHGVGYEI 272
           DV                 ELI  ++ + +             K W  +   M+GV    
Sbjct: 184 DVIDTTDAYIQLLKEIFDFELIHKFIAKQRKE-----------KGWKLLVDSMNGVTGPY 232

Query: 273 FNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELVL 332
              I  +   L   E    V     P P+F  +  P+P    A  L +E   +   E   
Sbjct: 233 AKAIFVDEFGLDSKE----VLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVNKEKIEFGA 286

Query: 333 ANDPDADR------FSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFSNQNENKKPLAMLG- 385
           A+D D DR        A V  G+              +V  + +++N+    K   + G 
Sbjct: 287 ASDGDGDRNMIYGYGPAFVSPGD--------------SVAIIAEYANEIPYFKKQGIYGL 332

Query: 386 --STVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSV 443
             S  ++  I ++A   G    E  TG+K+          D   +    EE+ G   S+ 
Sbjct: 333 ARSFPTASAIDRVAKKHGLNCYEVPTGWKFFCALF-----DAKKLSICGEESFG-TGSNH 386

Query: 444 THDKDGVSAATEFLQMAA 461
             +KDG+ A   +L + A
Sbjct: 387 VREKDGIWAIMAWLNILA 404

>NDAI0C02220 Chr3 (494856..495781) [926 bp, 308.666666666667 aa]
           {ON} 
          Length = 308

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 84/220 (38%), Gaps = 42/220 (19%)

Query: 145 VHTPMVPFTVSNIEGGASCGIMITASHN---PKMDNGYKVYYSNGCQITPPHDKKIASEI 201
           + TP     + +     + GI++TASHN   P+ D G K   +NG    P        E+
Sbjct: 24  LSTPAASHIIRSYHEKVTGGIILTASHNPGGPENDLGIKYNLANGGP-APESVTNAIWEV 82

Query: 202 DANLVPWDQAWDAQKLIEDARNNNR--------LHDVKQ------------ELIKNYVQR 241
              L  +    D  KL      N++        + DV +            +LIKN++Q+
Sbjct: 83  SKKLTSYKIVKDLPKLNLSKIGNDQKYGPLLVDIIDVTKAYVELLKEIFDFDLIKNFIQK 142

Query: 242 IQSSLVTTNSLADCGKNW-FVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDP 300
            + +           KNW  ++  ++G+     + I      L  DE    V     P P
Sbjct: 143 QRET-----------KNWKLLFDSLNGITGPYGHAIFVEEFGLPADE----VLQNWHPKP 187

Query: 301 EFTTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADR 340
           +F  +  P+P    A  L +E   +   E   A+D D DR
Sbjct: 188 DFGGLH-PDPNLTYAKTL-VERVDKEKIEFGAASDGDGDR 225

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 112/304 (36%), Gaps = 50/304 (16%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFA 115
           GT+GLR + +      N T   IQA       I    P   K   +VVG D R+    + 
Sbjct: 19  GTSGLRKKTKVFMDEPNYTENFIQA-------IMDAIPEGSKDATLVVGGDGRF----YN 67

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHN--- 172
           +V +     +G        +     + S   TP     +   +   + GI++TASHN   
Sbjct: 68  DVIMNKIAAIGAANGVKKLIIGQNGILS---TPAASHIIRTYKDKVTGGIILTASHNPGG 124

Query: 173 PKMDNGYKVYYSNGCQITPPHDKKIASEI--------DANLVPWDQAWDAQKLIEDARNN 224
           P  D G K    NG     P  + +   I        D  +V      D   ++E+ +  
Sbjct: 125 PTNDLGIKYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYG 180

Query: 225 NRLHDV--KQELIKNYVQRIQSSLVTTNSLADC--GKNW-FVYTPMHGVGYEIFNNIVTN 279
           N L D+    E    Y++ I    +    +      KNW  ++  ++GV       I  +
Sbjct: 181 NLLVDIIDSTEAYVKYMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFAD 240

Query: 280 TLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELV---LANDP 336
              L  DE    V     P P+F  +  P+P     L  A  L +R   E +    A+D 
Sbjct: 241 EFGLPADE----VLQNYVPKPDFGGLH-PDPN----LTYAKTLVSRVDKEKIEFGAASDG 291

Query: 337 DADR 340
           D DR
Sbjct: 292 DGDR 295

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 98/442 (22%), Positives = 162/442 (36%), Gaps = 79/442 (17%)

Query: 60  GTAGLRARMEAGFARMN-TLTVIQASQGLATYIKSQFPNNLK---VVVGHDHRYNSKSFA 115
           GT+GLR + +      N T   IQA+           P   K   +VVG D RY +    
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATM-------DAIPEGCKGATLVVGGDGRYYNDVIM 71

Query: 116 EVAIAAFLQLGFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHN--- 172
              ++     G     + +          + TP     + + +   + GI++TASHN   
Sbjct: 72  NKIVSIAGANGVRKLIIGH-------NGILSTPAASHVIRSYKEKCTGGIILTASHNPGG 124

Query: 173 PKMDNGYKVYYSNGCQITPPHDKKIASEI--------DANLVPWDQAWDAQKLIEDARNN 224
           PK D G K   +NG     P  + + + I        +  ++      D  K+  D +  
Sbjct: 125 PKNDIGIKYNLANGG----PAPESVTNAIWEASKKLTEYKVIEGLPELDTSKIAVDIKYG 180

Query: 225 NRLHDV--KQELIKNYVQRI-----QSSLVTTNSLADCGKNW-FVYTPMHGVGYEIFNNI 276
             L D+    E   +Y++ I         VT        K W  ++  ++GV       I
Sbjct: 181 PLLVDIIDSTEAYVDYLKEIFDFKLIKEFVTKQRET---KGWKLLFDSLNGVTGPYGEAI 237

Query: 277 VTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALNLAIELAARSGAELVLANDP 336
               L L  DE    V     P P+F  +  P+P    A  L +E   +   +   A+D 
Sbjct: 238 FVKELGLPADE----VLQNWHPLPDFGGLH-PDPNLTYAHTL-VERVDKENIQFGAASDG 291

Query: 337 DADR------FSAAVKDGNKWKQLTGNQLGYLFAVGQLEKFSNQNENKKPLAMLG---ST 387
           D DR        A V  G+              +V  + +++++        + G   S 
Sbjct: 292 DGDRNMIYGAGPAFVSPGD--------------SVAIISEYADEIPYFAKQGIYGVARSF 337

Query: 388 VSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDK 447
            +S  + ++A  +G    E  TG+K+      D +     V    EE+ G   S+   +K
Sbjct: 338 PTSSALDRVAKAKGLNCYEVPTGWKFFCALFDDQK-----VSICGEESFG-TGSNHIREK 391

Query: 448 DGVSAATEFLQMAARWKKEGKT 469
           DGV A   +L + A + K   T
Sbjct: 392 DGVWAIVAWLNILAIYNKHNPT 413

>NDAI0D01180 Chr4 complement(274695..275141) [447 bp, 148 aa] {ON}
           Anc_1.433 YNR004W
          Length = 148

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 15/116 (12%)

Query: 202 DANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKN--- 258
           D NL+  +         E    +N+L  + ++  KNY +R     V+TN      +    
Sbjct: 23  DLNLISENYTEFLLPYFEAISKDNKLRRLAKKKCKNYFER----WVSTNDKEISTRYQEF 78

Query: 259 WFVYTPMHGVGYEI----FNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310
           WF+   ++G  YE+    F+N++ N + +KE E+ L   A+K  +P+ T    PNP
Sbjct: 79  WFI---LNGTFYELEGNLFHNLIINEVDIKEYENVLNNQAKKEFEPD-TGKPLPNP 130

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 12/96 (12%)

Query: 222 RNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNWF-VYTPMHGVGYEIFNNIVTNT 280
           R N   H    ++ K Y+        T+ S+ D  K    V   +HG+G++  +  +++ 
Sbjct: 421 RYNEHRHSSASDVPKAYI-------YTSFSVVDREKEIKQVLQQLHGLGFDAVD--ISDN 471

Query: 281 LHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGAL 316
              K    YLV GA K P+ +   VSF  PE  GAL
Sbjct: 472 EMAKSHGRYLVGGASKVPNEKI--VSFEFPERPGAL 505

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 15/22 (68%)

Query: 160 GASCGIMITASHNPKMDNGYKV 181
           G   G MITASHNP  DNG K+
Sbjct: 55  GQYVGAMITASHNPPQDNGVKL 76

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 222 RNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNWF-VYTPMHGVGYEIFNNIVTNT 280
           R N   H+   E+ K Y+        T+ S+ D  K    V   +H +G+E  +  +++ 
Sbjct: 418 RYNEHRHESSSEVPKAYI-------YTSFSVVDREKEIKQVIQQLHTLGFEAVD--ISDN 468

Query: 281 LHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGAL 316
              K    YLV GA K P+     VSF  PE  GAL
Sbjct: 469 EMAKSHGRYLVGGASKVPNERI--VSFEFPERPGAL 502

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 222 RNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNWF-VYTPMHGVGYEIFNNIVTNT 280
           R N   H+   E+ K YV        T+ S+ D  K    V   +H +G+E  +  +++ 
Sbjct: 417 RYNEHRHESTSEVPKAYVY-------TSFSVVDREKEIKQVIQQLHTLGFEAVD--ISDN 467

Query: 281 LHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALN 317
              K    YLV GA K P+     +SF  PE  GAL 
Sbjct: 468 EMAKSHGRYLVGGASKVPNER--VISFEFPERPGALT 502

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 12/97 (12%)

Query: 222 RNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNWF-VYTPMHGVGYEIFNNIVTNT 280
           R N   H+   E+ K Y+        T+ S+ D  K    V   +H +G+E  +  +++ 
Sbjct: 417 RYNEHRHESTSEVPKAYI-------YTSFSVVDREKEIKQVMQQIHSLGFEAVD--ISDN 467

Query: 281 LHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGALN 317
              K    YLV GA K P+     +SF  PE  GAL 
Sbjct: 468 EMAKSHGRYLVGGASKVPNER--VISFEFPERPGALT 502

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 84/213 (39%), Gaps = 28/213 (13%)

Query: 145 VHTPMVPFTVSNIEGGASCGIMITASHN---PKMDNGYKVYYSNGCQITPPHDKKIASEI 201
           + TP   + + + +  A+ GI++TASHN   P+ D G K   +NG    P        EI
Sbjct: 95  LSTPATSYIIRSYKDKATGGIILTASHNPGGPENDMGIKYNLANGGP-APESVTNAMWEI 153

Query: 202 DANLVPWD-----QAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQS--------SLVT 248
              L  +         D  K+  D +    L D+  +  K YV+ +++        + +T
Sbjct: 154 SKKLTSYKIIKDFPTLDLSKIGNDQKYGPLLVDI-IDTTKEYVEFLKTIFDFPLIKAFIT 212

Query: 249 TNSLADCGKNW-FVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSF 307
                +   NW  ++  ++G+       I  +   L  +E          P P+F  +  
Sbjct: 213 KQRETN---NWKLLFDSLNGITGPYGKAIFVDEFGLPAEEAL----QNWHPQPDFGGLH- 264

Query: 308 PNPEEEGALNLAIELAARSGAELVLANDPDADR 340
           P+P    A  L +E   R   +   A+D D DR
Sbjct: 265 PDPNLTYAKTL-VERVDREKIQFGAASDGDGDR 296

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 222 RNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNWF-VYTPMHGVGYEIFNNIVTNT 280
           R N   H    ++ K Y+        T+ S+ D  K    V   +H +G+E  +  +++ 
Sbjct: 427 RYNEHRHQSSNDVPKAYI-------YTSFSVVDREKEIKQVLQQLHSLGFEAID--ISDN 477

Query: 281 LHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGAL 316
              K    YLV GA K P+ +  + SF  PE  GAL
Sbjct: 478 EMAKSHGRYLVGGASKVPNEKIVSFSF--PERPGAL 511

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 222 RNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNWF-VYTPMHGVGYEIFNNIVTNT 280
           R N   H+   E+ K Y+        T+ S+ D  K    V   +H +G+E  +  ++  
Sbjct: 417 RYNEHRHESSSEVPKAYI-------YTSFSVVDREKEIKQVMQQIHSLGFEAVD--ISEN 467

Query: 281 LHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGAL 316
              K    YLV GA K P+     VSF  PE  GAL
Sbjct: 468 EMAKSHGRYLVGGASKVPNER--VVSFEFPERPGAL 501

>CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 660

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 495 DLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPNLPV 550
           +L I+  +FK+++   NGN +P          +A F+D  + Y  ++  H+  + +
Sbjct: 266 NLHILRKLFKFLKE--NGNTLPIQLVFKRNVTLARFKDAIISYAEESDQHVTIIEI 319

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 222 RNNNRLHDVKQELIKNYVQRIQSSLVTTNSLADCGKNWF-VYTPMHGVGYEIFNNIVTNT 280
           R N   H+   E+ K Y+        T+ ++ D  K    V   +H +G+E  +  +++ 
Sbjct: 410 RYNEHRHESSSEVPKAYI-------YTSFNVVDREKEIKQVMQQLHSLGFEAVD--ISDN 460

Query: 281 LHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEEEGAL 316
              K    YLV GA K P+     +SF  PE  GAL
Sbjct: 461 EMAKSHGRYLVGGASKVPNERI--ISFEFPERPGAL 494

>Kwal_56.23417 s56 complement(528958..531126) [2169 bp, 723 aa]
           {OFF} YER162C (RAD4) - 1:1 [contig 179] PARTIAL
          Length = 723

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 29/76 (38%)

Query: 388 VSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFYVPFAYEEAIGYMFSSVTHDK 447
           + S +  K A   G  F + +TGFK+   R    +  G  V   Y EA+  M   V +  
Sbjct: 595 IESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYREAVESMIDGVEYSL 654

Query: 448 DGVSAATEFLQMAARW 463
           +        L+    W
Sbjct: 655 EEDERQERELEALQHW 670

>TBLA0B08350 Chr2 (1999702..2001012) [1311 bp, 436 aa] {ON} 
          Length = 436

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 64/138 (46%), Gaps = 7/138 (5%)

Query: 179 YKVYYSNGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNY 238
           Y   ++ G  ++   +K+IA+ +D  ++  D   D  ++IE  +N     ++K  +I N 
Sbjct: 33  YDTEFAPGLFVSSDGNKRIAAYVDDCVLAADTEEDLDEIIEMFKNT---FEIKAIVIMNE 89

Query: 239 VQRIQSSLVTTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFP 298
            +++++ ++  +   D  K     +    +  + FNN     L LKE E+ L    +K  
Sbjct: 90  EKQLETDILGIDLKYDLNKGIITLSMKSYI--DKFNNDFP-LLKLKEYENNLTTEQKKDL 146

Query: 299 DPEFTTVSFPNPEEEGAL 316
            P F+  +  NP E+  L
Sbjct: 147 TPHFSEYNL-NPNEDTLL 163

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,213,987
Number of extensions: 3235203
Number of successful extensions: 8565
Number of sequences better than 10.0: 76
Number of HSP's gapped: 8649
Number of HSP's successfully gapped: 76
Length of query: 630
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 514
Effective length of database: 40,180,143
Effective search space: 20652593502
Effective search space used: 20652593502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)