Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46108.839ON75172839170.0
ABL127W8.839ON72865626870.0
SAKL0D01496g8.839ON68864225240.0
Kwal_27.102638.839ON74365024000.0
KLTH0C03894g8.839ON74564923540.0
KLLA0D01595g8.839ON71964921630.0
TDEL0B005808.839ON71364320820.0
ZYRO0G14168g8.839ON76464920550.0
NCAS0C004208.839ON72565120470.0
KAFR0B039108.839ON72465520350.0
CAGL0M02959g8.839ON75865720290.0
TBLA0D032608.839ON76863819590.0
Kpol_1068.98.839ON74565419300.0
TPHA0I002408.839ON73266619210.0
YMR277W (FCP1)8.839ON73266519100.0
Skud_13.4498.839ON73466918970.0
Smik_13.4908.839ON73265818890.0
NDAI0K004208.839ON77869818840.0
Suva_13.4658.839ON73266118780.0
KNAG0J002808.839ON74267018070.0
Kpol_1010.615.94ON9321531154e-05
KAFR0E021405.94ON9512181030.001
NDAI0C032305.94ON103479960.008
TPHA0H010705.94ON1015149950.011
KAFR0A065604.156ON555110940.012
Kpol_1050.635.94ON105881930.020
TPHA0E030705.202ON494147920.020
Smik_12.825.202ON39245890.048
NCAS0J008804.156ON566134880.056
YLR019W (PSR2)5.202ON39745850.13
ZYRO0B01958g2.530ON336106840.14
Skud_12.875.202ON39245830.23
NCAS0A068005.202ON47351830.24
TBLA0C060905.202ON484124820.28
ADR369C7.46ON82793830.30
NDAI0J016404.156ON698109820.39
SAKL0G12870g5.202ON39960810.41
Ecym_50527.46ON87393810.44
TDEL0G011705.94ON1035107800.58
TPHA0C012407.220ON62984780.94
NDAI0D018605.202ON51451781.0
Kwal_47.17438singletonOFF14258721.7
TPHA0A051105.94ON106560762.2
TDEL0D029504.156ON66380752.3
Smik_12.535.202ON41445742.5
Kwal_14.10425.94ON91292752.6
Suva_10.995.202ON38545742.6
YLL010C (PSR1)5.202ON42745742.7
Suva_10.655.202ON41545733.2
KLLA0E23101g8.527ON480110733.3
Skud_8.492.530ON447103724.5
TBLA0F021007.306ON12076684.7
KLLA0F15620g5.202ON41445725.0
SAKL0G15620g5.94ON879113725.4
TBLA0I014602.530ON393103715.9
Ecym_72764.156ON59363717.1
KLTH0D17512g4.370ON1429178717.8
KNAG0D050507.25ON16848688.1
TBLA0B073905.94ON103178718.3
TPHA0M002606.18ON96625718.4
TBLA0A005408.527ON485100699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4610
         (751 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...  1513   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...  1039   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   976   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   929   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   911   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   837   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   806   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   796   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   793   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   788   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   786   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   759   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   748   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   744   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   740   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   735   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   732   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   730   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   728   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   700   0.0  
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    49   4e-05
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    44   0.001
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    42   0.008
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    41   0.011
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    41   0.012
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    40   0.020
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    40   0.020
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    39   0.048
NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {...    39   0.056
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    37   0.13 
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...    37   0.14 
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    37   0.23 
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    37   0.24 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    36   0.28 
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    37   0.30 
NDAI0J01640 Chr10 (403145..405241) [2097 bp, 698 aa] {ON} Anc_4....    36   0.39 
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    36   0.41 
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    36   0.44 
TDEL0G01170 Chr7 complement(238219..241326) [3108 bp, 1035 aa] {...    35   0.58 
TPHA0C01240 Chr3 complement(282061..283950) [1890 bp, 629 aa] {O...    35   0.94 
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     35   1.0  
Kwal_47.17438 s47 complement(402545..402973) [429 bp, 142 aa] {O...    32   1.7  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    34   2.2  
TDEL0D02950 Chr4 complement(556701..558692) [1992 bp, 663 aa] {O...    33   2.3  
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    33   2.5  
Kwal_14.1042 s14 complement(168504..171242) [2739 bp, 912 aa] {O...    33   2.6  
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    33   2.6  
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    33   2.7  
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    33   3.2  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    33   3.3  
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    32   4.5  
TBLA0F02100 Chr6 complement(516681..517040,517329..517331) [363 ...    31   4.7  
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    32   5.0  
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    32   5.4  
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    32   5.9  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    32   7.1  
KLTH0D17512g Chr4 (1457372..1461661) [4290 bp, 1429 aa] {ON} hig...    32   7.8  
KNAG0D05050 Chr4 (923903..924409) [507 bp, 168 aa] {ON} Anc_7.25...    31   8.1  
TBLA0B07390 Chr2 complement(1758977..1762072) [3096 bp, 1031 aa]...    32   8.3  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...    32   8.4  
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    31   9.8  

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score = 1513 bits (3917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/728 (100%), Positives = 728/728 (100%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60
           MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60

Query: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120
           QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE
Sbjct: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120

Query: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180
           DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH
Sbjct: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180

Query: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240
           CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL
Sbjct: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240

Query: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300
           QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF
Sbjct: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300

Query: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360
           PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK
Sbjct: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360

Query: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNAS 420
           LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNAS
Sbjct: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNAS 420

Query: 421 LEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSP 480
           LEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSP
Sbjct: 421 LEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSP 480

Query: 481 DIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLIT 540
           DIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLIT
Sbjct: 481 DIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLIT 540

Query: 541 KTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKE 600
           KTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKE
Sbjct: 541 KTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKE 600

Query: 601 LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDNDDEMDEFLNDSDSEDHRNEGE 660
           LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDNDDEMDEFLNDSDSEDHRNEGE
Sbjct: 601 LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDNDDEMDEFLNDSDSEDHRNEGE 660

Query: 661 NGGDKSTTNSHESVNNIQHNKLTENLKNQHIQQNQKPLSRTVMETKDKRPLDEHVGSDEA 720
           NGGDKSTTNSHESVNNIQHNKLTENLKNQHIQQNQKPLSRTVMETKDKRPLDEHVGSDEA
Sbjct: 661 NGGDKSTTNSHESVNNIQHNKLTENLKNQHIQQNQKPLSRTVMETKDKRPLDEHVGSDEA 720

Query: 721 PKVKRQHI 728
           PKVKRQHI
Sbjct: 721 PKVKRQHI 728

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score = 1039 bits (2687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/656 (76%), Positives = 570/656 (86%), Gaps = 17/656 (2%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60
           MSTPIRLPD+LPYPIT+AQL VS GD VE+GQRL AYKYWD   ++T+PG+E AG K+++
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAG-KARK 59

Query: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120
           QR+DLVGTFDSPV+G VVSL++ +GDEFVNSQ  V EI+Q C HDVTYGGLCVQCGQ VE
Sbjct: 60  QRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVE 119

Query: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180
           DE  +   ++ QAKLT+SHTN +IR+SE+QA +L +SAQ +LREARKLVLVVDLDQTVIH
Sbjct: 120 DEAGAADGVE-QAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIH 178

Query: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240
           CGVDPTIGEWSKDP+NPNYE+LKDV+SFSL EEPVLPPFYMGPKPPTRKCWYYVKLRPGL
Sbjct: 179 CGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 238

Query: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300
           ++FF+ IAPHFELHIYTMATR YALEIAKIIDPDG LFGDRILSRDENGSLTQKSLERLF
Sbjct: 239 KEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLF 298

Query: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360
           PMDQSMVV+IDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLP QQNSMLHLGRRNRKK
Sbjct: 299 PMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKK 358

Query: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNAS 420
            KQ+EELLTDILDTEKKLK KI+EEVKRQE++M +L++EK+PD      DIAKKLEHNAS
Sbjct: 359 PKQEEELLTDILDTEKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNAS 414

Query: 421 LEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSP 480
           LEVQQQNRPLAELQKH+ NERLL DDDDELPHL +ILL+VHSAYYDQL++   G   + P
Sbjct: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPI-P 473

Query: 481 DIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLIT 540
           DIK L+P LKE VF+GC FVFSGLIPLHTNI+RADIVLWTN FGA TT N+DYNTTHLIT
Sbjct: 474 DIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLIT 533

Query: 541 KTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKE 600
           +TPGTMKARLA SFN  IKIVHPDWIFEC+V W+RV+E PYELIVEEPV +EYLENFK++
Sbjct: 534 RTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRD 593

Query: 601 LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD-NDDEMDEFLN-DSDSED 654
           L E +K    VD      +      +++LL G+ SWLD +DDEMDEFLN +SD+E+
Sbjct: 594 LAEAQK---KVDPPAQDSR-----SSLLLLDGNGSWLDYDDDEMDEFLNEESDNEE 641

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/642 (72%), Positives = 549/642 (85%), Gaps = 13/642 (2%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60
           M+T ++LPDNLPYPIT+AQL  S GD +++GQRLFAYKYW+F+ +VTSP D S   K K+
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST--KPKK 58

Query: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120
           QR+DL+GTFDSPV G +VS N++LGDEFVNS   VAEIKQ CTHDVTYGGLCV CG++VE
Sbjct: 59  QRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVE 118

Query: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180
           +  ++ +   +Q KLTMSHTN NI+ISE+QA  +E++AQKQLR+ +KLVLVVDLDQTVIH
Sbjct: 119 EYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIH 178

Query: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240
           CGVDPTIGEWS+DP NPNYE+LKD++SF+L EEP+LPPFYMGPKPP RKCWYYVKLRPGL
Sbjct: 179 CGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGL 238

Query: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300
           ++FF  IAPHFELHIYTMATR YALEIAKIIDPDG LFGDRILSRDENGS+T KSLERLF
Sbjct: 239 KEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLF 298

Query: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360
           PMDQSMVVIIDDRGDVWNWCENLIKVVPY FFVG+GDINSNFLPRQQNSMLHLGRR+RKK
Sbjct: 299 PMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKK 358

Query: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNAS 420
             ++EELLTDILDTEKKL+ KI EEVKRQEE++ K++EEK P+ T SKED+AKKLEH+AS
Sbjct: 359 -AEEEELLTDILDTEKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSAS 417

Query: 421 LEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSP 480
           LEVQQQNRPLAELQKHLHN++LLIDDDDELPHL+ ILL+VH  YY+ L  +KH +    P
Sbjct: 418 LEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDL--SKHSS---PP 472

Query: 481 DIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLIT 540
           +IK+L+P LK+ VF  C+FVFSGLIPL T++ +ADI LWT+ FGAKTT +ID  TTH+IT
Sbjct: 473 NIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIIT 532

Query: 541 KTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKE 600
           KTPGT KARLA +FN +IK+VHPDWIFEC+VNWKRVDEK YEL++E+PVS+E L++FKK+
Sbjct: 533 KTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKK 592

Query: 601 LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDNDDE 642
           LE  +K     DA I  +     +D + LL G+DSWLDNDD+
Sbjct: 593 LENEKK-----DAQIQEEVDRVSSDEINLLAGNDSWLDNDDD 629

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/650 (67%), Positives = 537/650 (82%), Gaps = 17/650 (2%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60
           M+TPIRLP NLP+PIT+A+L VS G+ V +GQRLF YKYW+ + ++T+P +E++    K+
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEAS---KKK 57

Query: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120
           +R+DL+GTFDSP+ G +VSL + +GDEFVN    +AE++QPC+H+VTYG LCV CG+ V+
Sbjct: 58  RRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVD 117

Query: 121 --DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTV 178
             D   SGS + N  KLT++H N NI++SE+QA ++EK+AQK+LRE +KLVLVVDLDQTV
Sbjct: 118 EDDSNMSGSGVSN-GKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTV 176

Query: 179 IHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRP 238
           IHCGVDPTI EW+ DP NPNY++LK+V++FSL E+P+LPPFYMGP+PP R+C YYVKLRP
Sbjct: 177 IHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRP 236

Query: 239 GLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLER 298
           GLQ+FF  +APHFELHIYTMATR YALEIAKIIDP   LFGDRILSRDENGSLT KSLER
Sbjct: 237 GLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLER 296

Query: 299 LFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNR 358
           LFPMDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLPRQQNSMLH+GRR+R
Sbjct: 297 LFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHR 356

Query: 359 KKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHN 418
           KK  ++EELLTDI+DTEKKL+ KI +EVK+QEE+  K+SEE  PD + SKED+ KKLEHN
Sbjct: 357 KK-AEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHN 415

Query: 419 ASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATEL 478
           ASLEVQQQNRPLAELQKH++N++LLIDDDDELPHL++ILL VH  YY++L K     TE+
Sbjct: 416 ASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-----TEV 470

Query: 479 SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHL 538
            PDIK L+P +K  VF  C+FVFSGLIPL TNI  ADIVLWTN FGA+T+ +ID NTTH+
Sbjct: 471 FPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHV 530

Query: 539 ITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFK 598
           ITKTPGT KARLA S+N DIKIVHPDWIFEC+V W R DEKPYELI+E+ VS + LE F+
Sbjct: 531 ITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQ 590

Query: 599 KELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDN-DDEMDEFL 647
           + L++ + ++ +   ++  +  E  N    LL G+D WLDN DDEMDEFL
Sbjct: 591 RNLKKRQMAEKAARESLQQETGEELN----LLAGNDMWLDNDDDEMDEFL 636

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/649 (66%), Positives = 532/649 (81%), Gaps = 15/649 (2%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60
           M+TPIRLP NLP+P+T+A+L VS GD V++GQRLF YKYW+ + I+T+P +E+     K+
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAP---KKK 57

Query: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120
           +R+DL+GTFDSPV G +VSLNI LGDEFVN    +AE+ Q C+H+VTYGGLCV CG+TVE
Sbjct: 58  RRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVE 117

Query: 121 --DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTV 178
             D+  S + + N +KLT++H N NI++SE+QA T+EK+AQK LRE +KLVLVVDLDQTV
Sbjct: 118 EDDQNVSDNGISN-SKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTV 176

Query: 179 IHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRP 238
           IHCGVDPTI EW+ DP NPNY++LK+V++FSL E+P+LPPFYMGP+PP RKC YYVKLRP
Sbjct: 177 IHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRP 236

Query: 239 GLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLER 298
           GLQ+FF  IAPHFELHIYTMATR YALEIAKIIDP G LFGDRILSRDENGSLT KSLER
Sbjct: 237 GLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLER 296

Query: 299 LFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNR 358
           LFPMDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLPRQQNSMLHLGRRNR
Sbjct: 297 LFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNR 356

Query: 359 KKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHN 418
           KK  ++EELLTDI+DTEKKL+ KI +EVK+QEE+  K++EE  P+   SKED+ KKLEHN
Sbjct: 357 KK-AEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHN 415

Query: 419 ASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATEL 478
           ASLEVQQQNRPLAELQKH++N++LL DDDDELPHL++ILL VH  YYD+L +        
Sbjct: 416 ASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ----- 470

Query: 479 SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHL 538
            PDIK L+P +K  VFK C+FVFSGLIPL TN+ +ADIVLWT+ FGA T++++D  TTH+
Sbjct: 471 PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHV 530

Query: 539 ITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFK 598
           ITKTPGT KARLA ++N +IK++HPDWIFEC+V W RV+EKPYEL  E+ VS E LE FK
Sbjct: 531 ITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFK 590

Query: 599 KELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDNDDEMDEFL 647
           K L++ ++S+ ++  +I  +  +  N   +L G      ++DDEMDEFL
Sbjct: 591 KRLDKKKQSEKALSESIQQEATQELN---LLTGNDLWLDNDDDEMDEFL 636

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/649 (62%), Positives = 508/649 (78%), Gaps = 27/649 (4%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60
           + T +++  +LPYPITVAQL V  GD VE+GQRLFAY+YWDF+ ++    +     K+K+
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEE-----KTKK 57

Query: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120
           QR+D V TFDSPVSG V   + ++ DEF ++   V  I+Q C HD+TYGGLCVQCG TV+
Sbjct: 58  QRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVD 117

Query: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180
           +E       DN   LT+SH N NI++SE+QA TLE+S+  +LRE +KLVLVVDLDQTVIH
Sbjct: 118 EE-------DNSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIH 170

Query: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240
           CGVDPTIGEW +DP NPNY++L+DV+SF+L +EP++P FY GPKPP RK WYYVKLRPGL
Sbjct: 171 CGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGL 230

Query: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300
           ++FF  ++PHFE+HIYTMATR+YA EIAKIIDP G LFGDRILSRDENGSLT KSLERLF
Sbjct: 231 KEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLF 290

Query: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360
           PMDQSMVV+IDDRGDVWNW ENLIKVVPY FFVGIGDINSNFLPRQQNS+LHLGR +R+K
Sbjct: 291 PMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK 350

Query: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDH--TTSKEDIAKKLEHN 418
            +++E+L++DI+D EKKLK KI EEVKRQEE +  + ++         +KEDI+KKLEH+
Sbjct: 351 -QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHS 409

Query: 419 ASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATEL 478
           ASLEVQQQNRPLAELQKHLHN+ LLIDDDDELPHL+ ILLRVH  Y++Q  +    A + 
Sbjct: 410 ASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTE----APKN 465

Query: 479 SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHL 538
            PDIK+L+P +K  VF+GC+FVFSGLIPL T++ +ADIVLWT+ FGA T+ +I+Y TTH+
Sbjct: 466 PPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHI 525

Query: 539 ITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFK 598
           IT T  T KARLA SFN DIKIVHPDW+FEC+V W+RV E PYEL++++PV ++ ++ FK
Sbjct: 526 ITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFK 585

Query: 599 KELEETEKSKNSV-----DANISSQKYETFNDAMILLGGSDSWLDNDDE 642
           ++L++   + +S      D N   +  E   D   LL G+DSWLDNDD+
Sbjct: 586 EKLDKKISNPSSSVNPFEDGN---EDEEVLGDEFHLLAGNDSWLDNDDD 631

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/643 (60%), Positives = 496/643 (77%), Gaps = 22/643 (3%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60
           M+TP+  P+ LPYPIT+ QL    G  VE+GQRLFA+K+W   +I +SP DE+ GG  K+
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP-DENEGGHRKK 59

Query: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTV- 119
              + +  F++P  G ++S N+ +GDE V     + EI +PC HD+ YGGLC  CG+ V 
Sbjct: 60  TVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVD 119

Query: 120 EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVI 179
           E EQ +G+L        +SHT++N+++S K+A  +E + + +LRE++KLVLVVDLDQTVI
Sbjct: 120 ESEQFNGNL-------AISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVI 172

Query: 180 HCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPG 239
           HCGVDPTIGEW +D  NPNYE+LKDV+SF+L EEP+LP  YMGPKPP RKCWYYVK+RPG
Sbjct: 173 HCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPG 232

Query: 240 LQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERL 299
           L++FF  +AP FE+HIYTMATR YALEIAKIIDPDG+LFGDRILSRDENGS+TQKSLERL
Sbjct: 233 LKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERL 292

Query: 300 FPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRK 359
           FP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLPRQQN+ML LGR  RK
Sbjct: 293 FPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARK 352

Query: 360 KLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM--QKLSEEKIPDHTTSKEDIAKKLEH 417
           K ++ +EL+TDI+DTEKKL+ KI EEVKRQEE++  Q  S E++P    SK+ +AKKLE+
Sbjct: 353 KTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVP-APESKDQLAKKLEY 411

Query: 418 NASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATE 477
           +ASLEVQQQNRPLA LQKH+HN+RLL+DDDDEL +L +IL +VH  YY  L ++    +E
Sbjct: 412 SASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQD----SE 467

Query: 478 LSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTH 537
              DIK L+P +K  VF+ C+FVFSGLIPL TNI+RADIVLWTN FGA+++  ID +TTH
Sbjct: 468 KKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTH 527

Query: 538 LITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENF 597
           +IT+TPGT KAR+A +FN +IK+VHPDW+FEC+V+WK VDEKPYELIVE+  + E L ++
Sbjct: 528 VITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDY 587

Query: 598 KKEL--EETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD 638
           K++L    +  ++  ++  + S K  T N    L  G  SWL+
Sbjct: 588 KQKLARRSSALAEQEMELAMESAKNGTIN----LFAGGTSWLN 626

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/649 (58%), Positives = 489/649 (75%), Gaps = 26/649 (4%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGK--- 57
           M+TP+  P++LPYPIT+ QL    G  V++GQRLFAYK+W   +I +SP +    G    
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 58  SKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQ 117
           SK+   + +  F+SP  G +VS  +  GDE  +++  + EI +PC HDV YGGLC  CG+
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 118 TV-EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQ 176
            V E++Q        +A L +SHT+ N+++S K+A  +E   +++LR+++KLVLVVDLDQ
Sbjct: 121 EVDENDQM-------EANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQ 173

Query: 177 TVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKL 236
           TVIHCGVDPTIGEW KDP NPNYE+LKDV+ FSL EEP++PP YMGP+ P RKCWY+VK+
Sbjct: 174 TVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKV 233

Query: 237 RPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSL 296
           RPGL++FF+ +AP +E+HIYTMATRTYALEIAKIIDPDG+LFGDRILSRDENGSLTQKSL
Sbjct: 234 RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSL 293

Query: 297 ERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRR 356
           ERLFP DQSMV++IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLPRQQ+ +L LGRR
Sbjct: 294 ERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRR 353

Query: 357 NRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLSEEKIPDHTTSKEDIAKKL 415
             KK ++ +ELLTDI+DTEK+L+ KI EEVKRQEE++  +L+    P    SKE + KKL
Sbjct: 354 THKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKL 413

Query: 416 EHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGA 475
           E++ASLEVQQQNRPLA LQKH+HN+RLL+DDDDEL +L D L ++H  YY  L++     
Sbjct: 414 EYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDE----G 469

Query: 476 TELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNT 535
            E S DI+ L+P++K  VFK C FVFSGLIPL TNI RADIVLWT  FGA T+  ID NT
Sbjct: 470 NENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENT 529

Query: 536 THLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLE 595
           TH+ITKTPGT KAR+A  FN ++K+VHPDW+FEC+V W  VDEKPYELI+++P ++E ++
Sbjct: 530 THVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQ 589

Query: 596 NFKKE------LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD 638
           +FK++      +EE  + +   +A + + +  T N    L  G  SWL+
Sbjct: 590 DFKRKIEQRHLIEEQRREQFESEALMKTAQDSTLN----LFAGGTSWLN 634

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/651 (60%), Positives = 486/651 (74%), Gaps = 22/651 (3%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDE------SA 54
           MST I  P  LPYPIT+ QL    GD V++G RL AYK+W    + +SP D       +A
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 55  GGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114
           G KS R+ I+    F+SP  GQ++S N+ +GDE  +    +AEI +PC HDV YGGLC  
Sbjct: 61  GKKSIRESIEF---FESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117

Query: 115 CGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDL 174
           CG+ V+++    S   + A LT+SHT+ N++IS ++A  +  + + +LR+ +KLVLVVDL
Sbjct: 118 CGEEVDEDDNDAS--GSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDL 175

Query: 175 DQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYV 234
           DQTVIHCGVDPTIGEW  DP NPN+E+LKDV+ FSL EEP+LP  YMGPKPP RKCWYYV
Sbjct: 176 DQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYV 235

Query: 235 KLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQK 294
           K+RPGL++F   IAP FE+HIYTMATR YA EIAKIIDP+G LFGDRILSRDENGS+T K
Sbjct: 236 KVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTK 295

Query: 295 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLG 354
           SLERLFP DQSMV++IDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ +ML LG
Sbjct: 296 SLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLG 355

Query: 355 RRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM--QKLSEEKIPDHTT-SKEDI 411
           RR+R+K K  E+LL DI+D+EKKLK KI +EVKRQEEE+  Q  + E+ P     +KE+I
Sbjct: 356 RRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEI 415

Query: 412 AKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKN 471
           +KK+E++ASLEVQQQNRPLA LQKH H++RLLIDDDDEL HL D L+R+H  YY+ L+K+
Sbjct: 416 SKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKD 475

Query: 472 KHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINI 531
                EL  DIK ++P++K+ V   C FVFSGLIPL T+I RADIV+WTNTFGA +T +I
Sbjct: 476 ----GELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDI 531

Query: 532 DYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSK 591
           D  TTH+ITKTPGT KARLA SFN  IKI+HPDW+FEC+ +WK VDEKPYELIVE+PVS+
Sbjct: 532 DEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSE 591

Query: 592 EYLENFKKELEETEKSKNSVDANISSQKYETFNDAMI-LLGGSDSWLDNDD 641
             LE FKK+L    K +    AN +       N A + L  G  SWLD+D+
Sbjct: 592 TELEEFKKKL---AKRQLLATANENLSPANGTNSAELELFSGGMSWLDDDE 639

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/655 (58%), Positives = 487/655 (74%), Gaps = 22/655 (3%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGD------ESA 54
           M+TP+  P+ LPYPIT+ +L    G  +E+G RLFAYK+W   +I +SP D      ++ 
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 55  GGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114
               K++  + +  FD+P  G ++S NI +GDE  ++   + EIK+PC HD+ YGGLC Q
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 115 CGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDL 174
           CG+ V++ + S       +  T+SHT+ N++IS K+A  + +  +K+LR  +KLVLVVDL
Sbjct: 121 CGKEVDESEQSQF----GSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDL 176

Query: 175 DQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYV 234
           DQTVIHCGVDPTIGEW  DP+NPNY++LKDV+ F+L EEPVLP  YMGPKP  RKCWYYV
Sbjct: 177 DQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYV 236

Query: 235 KLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQK 294
           K+RPGL++FF  +AP FE+HIYTMATR YALEI KIIDP G LFG+RILSRDENGSLT K
Sbjct: 237 KVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSK 296

Query: 295 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLG 354
           SLERLFP DQSMV+IIDDRGDVWNW  NLIKVVPY FFVG+GDINSNFLP+QQ +ML LG
Sbjct: 297 SLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLG 356

Query: 355 RRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTT----SKED 410
           RR+R+K K+ +ELLTDI+DTEKKL+ KI EEVKRQE   + LS + +P   +    +KE+
Sbjct: 357 RRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQE---KNLSHQVVPTEESVSNETKEE 413

Query: 411 IAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEK 470
             KKLEH+AS+EVQQQNRPLA LQ+HLHN+RLLIDDDDEL  L D L +VH+ YY  LE 
Sbjct: 414 WTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILE- 472

Query: 471 NKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTIN 530
           NK    E   DIK ++P LK+ VF+GC+FVFSGLIPLHT+I RADIV+WT+ FGA+++  
Sbjct: 473 NK-SLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSE 531

Query: 531 IDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVS 590
           I+  TTH+ITKTPGT KARLA SFN DIKIVHPDW+FEC++ W  VDEKPY LIVEEP+S
Sbjct: 532 INEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPIS 591

Query: 591 KEYLENFKKELEE---TEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDNDDE 642
              L+ F+++L     TE++      +I+    E F++ + L     SWL+++DE
Sbjct: 592 DRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLNDEDE 646

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/657 (59%), Positives = 483/657 (73%), Gaps = 21/657 (3%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAG----- 55
           MSTP+  P  LPYPITV +L V  G  VE+GQRLFAYK+W   +I  SP D         
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 56  -GKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114
             KSKR+  + +  +++P  G ++S N+   DE       V EIK+PC HD+ YGGLC  
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 115 CGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDL 174
           CG+ V++           A LT+SHT+ N+R+S K+A  L+K    +L+  +KLVLVVDL
Sbjct: 121 CGKEVDEYDQV------DANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDL 174

Query: 175 DQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYV 234
           DQTVIHCGVDPTIGEW  DP NPNYE+LKDV+ FSL EEP+LP  YMGPKPP R CWYYV
Sbjct: 175 DQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYV 234

Query: 235 KLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQK 294
           K+RPGL++FF  IAP +E+HIYTMATR YALEIAKIIDPD +LFGDRILSRDENGSLTQK
Sbjct: 235 KIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQK 294

Query: 295 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLG 354
           SL RLFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP+QQ +ML LG
Sbjct: 295 SLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLG 354

Query: 355 RRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM--QKLSEEKIPDHTTSKEDIA 412
           RR R+K+K+ EELLTDI+DTEKKL+ KI EEVKRQEE++  Q  + E+  D   SKE IA
Sbjct: 355 RRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQ-ESKEKIA 413

Query: 413 KKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNK 472
           KKLE +ASLEVQQQNRPLA+LQKHLH++RLLIDDDDEL +L D L  +H  +Y  LE   
Sbjct: 414 KKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLE--- 470

Query: 473 HGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINID 532
             + +   DI  L+P LK+ VFK C+FVFSGLIPL T+I RADIV+WT+ FGA++T +ID
Sbjct: 471 DASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDID 530

Query: 533 YNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKE 592
            +TTH++TKTPGT KARLA +FN DIK+VHPDWIFEC+ +WKR+DEKPY LIVE+PVS++
Sbjct: 531 EHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSED 590

Query: 593 YL---ENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDNDDEMDEF 646
            L   +   ++ ++  +     +    +++       M L GG  SWL++D++  EF
Sbjct: 591 ELIEFKKKLEQKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWLNDDEDEVEF 647

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/638 (58%), Positives = 466/638 (73%), Gaps = 61/638 (9%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSP----------- 49
           MSTP+  P +LP+PIT+ QL    G  VE+GQRLFAYK+W   +I  SP           
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 50  ------GDESAGG-------KSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVA 96
                  D +  G       KS R+ I+    F+SP  G ++  N+  GDE ++    + 
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEF---FESPFEGDLIGWNVDKGDEIISENQLLC 117

Query: 97  EIKQPCTHDVTYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEK 156
           +IK+PC HD+ Y G+C QCG+ V+D      ++D  A L++SHT+ N++IS K+A  +++
Sbjct: 118 DIKRPCNHDIVYAGICTQCGKEVDD----SDIMD--ASLSISHTDTNLKISRKEARDIDQ 171

Query: 157 SAQKQLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVL 216
           S+  +L++ +KL+LVVDLDQTVIHCGVDPTIGEW  DP NPNYE+LKDVRSFSL EEP+L
Sbjct: 172 SSMSRLKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPIL 231

Query: 217 PPFYMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGT 276
           PP YMGP+PP RKCWYYVK+RPGL++FF+ IAP +E+HIYTMATR YALEIAKIIDPDG+
Sbjct: 232 PPSYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGS 291

Query: 277 LFGDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIG 336
           LFG RILSRDENGSLTQKSLERLFP DQSMV+IIDDRGDVWNWC NLIKV+PY+FFVGIG
Sbjct: 292 LFGSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIG 351

Query: 337 DINSNFLPRQQNSMLHLGRRNRKKLKQD----------------------EELLTDILDT 374
           DINSNFLPRQQ++ML LG R+ KK   +                      EELLTDI+DT
Sbjct: 352 DINSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDT 411

Query: 375 EKKLKVKISEEVKRQEEEMQK--LSEEKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAE 432
           EKKL+ KI EEV+RQE+++ K  + + K     +S  +++KK+E +ASLEVQQQNRPLA 
Sbjct: 412 EKKLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLAT 471

Query: 433 LQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEI 492
           LQ+H  N+RLLIDDDDEL +L DIL  VH  +Y+QL+++K+ +      I+ L+P LK  
Sbjct: 472 LQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVS----IQTLMPRLKFS 527

Query: 493 VFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLAS 552
           VF G NFVFSGLIPL T+I RADIVLWTN FGA +T +ID NTTH+ITKT GT KARLA 
Sbjct: 528 VFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAK 587

Query: 553 SFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVS 590
           +FN +IK+VHPDWIFEC+V+WKR+ EKPYELI+E+P S
Sbjct: 588 AFNPEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/654 (56%), Positives = 468/654 (71%), Gaps = 34/654 (5%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAG----- 55
           MSTP+  P  LPYPIT+++L  S G  VE+GQRLFAYK+W   +I  SP +   G     
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 56  -GKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114
             KS R+ I+    FDSP  G +VS N+ +GDE V    T+ EI +PC HD+ Y G+C  
Sbjct: 61  SKKSIRESIEF---FDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117

Query: 115 CGQTV-EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVD 173
           CG+ V E +Q S       A LT+SHT+ N+++S ++A  + +  +K+L   +KL+LVVD
Sbjct: 118 CGKEVDESDQVS-------ANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVD 170

Query: 174 LDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYY 233
           LDQTVIHCGVDPTI EW  DP NPN+E+L+DV+SF L EEP+LPP YMGPKPPT KCWYY
Sbjct: 171 LDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYY 230

Query: 234 VKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQ 293
           VK+RPGL++FF  ++  +E+HIYTMATR+YA EIAKIIDPDGTLF DRILSR+ENGSLT 
Sbjct: 231 VKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTH 290

Query: 294 KSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHL 353
           KSLERLFP DQSMVV+IDDRGDVWNWC NLIKV PY+FFVGIGDINSNFLPRQQ +ML L
Sbjct: 291 KSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQL 350

Query: 354 GRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSE---EKIPDHTTSKED 410
           GRRN KK +  +ELLTDI+DTEKKL+ KI EEVKRQEE +   S    E+I      KED
Sbjct: 351 GRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQ-VRKED 409

Query: 411 IAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEK 470
           I KK+E +ASLEVQQQNRPLAELQKH+HN++LL DDDDEL +L DIL  V   YY++L+ 
Sbjct: 410 ITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKT 469

Query: 471 NKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTIN 530
           +K         I+ L+P LK+ V +GCNFVFSGLIPL TNI +ADIVLWTN FGA+++ +
Sbjct: 470 DKEIQ------IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSAD 523

Query: 531 IDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVS 590
           I  +TTH+ITKTP T KA++A +F  DIK++HPDW+FEC++NWK + E PYE  +    +
Sbjct: 524 ITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTAT 583

Query: 591 KEYLENFKKELEETEKSKNSVDANISSQKYETFND-------AMILLGGSDSWL 637
            + L  FK+ LE  +K +      +S +  E  ++       ++ L     SWL
Sbjct: 584 DKELNEFKEALERRKKKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWL 637

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/666 (56%), Positives = 473/666 (71%), Gaps = 31/666 (4%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSP------GDESA 54
           M+TP++ PD +PYPIT+++L    G  + +G RLFAYK+W   +I  SP      G+   
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 55  GGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114
           G +SK+   + +  FD+P  G ++  N+ +GDE V     V E+K+PC HD+ Y G+C  
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 115 CGQTV-EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVD 173
           CG+ V E +Q S       A LT+SHT+ N+++S ++A  + ++ + +L  ++KL+LVVD
Sbjct: 121 CGKEVDERDQVS-------ANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVD 173

Query: 174 LDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYY 233
           LDQTVIHCGVDPTI EW  DP NPNYE+L++V+SF L EE +LPP YMGPKPP  KC YY
Sbjct: 174 LDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYY 233

Query: 234 VKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQ 293
           VK+RPGL++FF  +AP +E+HIYTMATR YA EIAKIIDPDG+LFG+RILSRDENGSLT 
Sbjct: 234 VKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTH 293

Query: 294 KSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHL 353
           KSLERLFP DQSMVVIIDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ +ML +
Sbjct: 294 KSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQM 353

Query: 354 GRRNRKK--LKQDEELLTDILDTEKKLKVKISEEVKRQEEEM----QKLSEEKIPDHTTS 407
           GRRN      K+ EELLTDI+DTEKKL+ KI +EVKRQE ++      L EE +      
Sbjct: 354 GRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQ--VR 411

Query: 408 KEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQ 467
             DI KK+E +ASLEVQQQNRPLAELQKH+HN++LL DDDDEL +L +IL  V S +Y  
Sbjct: 412 NGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKA 471

Query: 468 LEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKT 527
           LE     + + S  I+ L+P LK  VFK CNFVFSGLIPL T+I +ADIVLWT  FGA +
Sbjct: 472 LELKNGNSDDTS--IQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASS 529

Query: 528 TINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEE 587
           T NI  NTTH+ITKTPGT+KAR+A SFN  IK+VHPDW+FEC+  WK VDEK +EL V++
Sbjct: 530 TSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQ 589

Query: 588 PVSKEYLENFKKELEETEKSK------NSVDANISSQKYETFNDAMILLGGSDSWLDNDD 641
             S+  LE FKK LE+  K+K       S D N  +    + ++ + L  G  SWL  DD
Sbjct: 590 VASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL-VDD 648

Query: 642 EMDEFL 647
           E+++ L
Sbjct: 649 ELEDVL 654

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/665 (54%), Positives = 468/665 (70%), Gaps = 35/665 (5%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDE------SA 54
           M+T IR P  LPYPI + +L  S G  +  G RL  YK+W   +  +  GD+      S 
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 55  GGKS--------KRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDV 106
           GG +         +Q  + +  F+SP  G ++S N+ +GDE   +   + EIK+PC HD+
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 107 TYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREAR 166
            YGGLC QCG+ V  +   G  LD          +++++ISE +A    K+ ++ LR  +
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVG-------DVDLQISETEAIRTGKALKEHLRRDK 173

Query: 167 KLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPK-- 224
           KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM     
Sbjct: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGS 233

Query: 225 ----PPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGD 280
               PP RKCWYYVK+RPGL++FF+ +AP FE+HIYTMATR YAL+IAKI+DP G LFGD
Sbjct: 234 MLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 293

Query: 281 RILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 340
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINS
Sbjct: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353

Query: 341 NFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLSEE 399
           NFLP+Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+ KI +EVKRQEE++  +L+  
Sbjct: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413

Query: 400 KIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLR 459
           + P    SKE++ KKLE++ASLEVQQQNRPLA+LQKHLH+++LL+DDDDEL +L   L  
Sbjct: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 473

Query: 460 VHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLW 519
           +H  YYD L +      E  P++  +IPSLK+ VF+ C FVFSGLIPL T+I R+DIV+W
Sbjct: 474 IHKTYYDMLSQQ----NEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIW 529

Query: 520 TNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEK 579
           T+TFGA +T +IDY TTHLITK P T KARLA  FN  IKIVHPDWIFEC+VNWK+VDEK
Sbjct: 530 TSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEK 589

Query: 580 PYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLDN 639
           PY LIV+ P+S E L+NF+ +L   +K +  ++     Q   T  + + L     SWL+N
Sbjct: 590 PYTLIVDSPISDEELQNFQTQL---QKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNN 646

Query: 640 DDEMD 644
           DD+ D
Sbjct: 647 DDDED 651

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/669 (54%), Positives = 472/669 (70%), Gaps = 42/669 (6%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDF-EQIVTSPGDE------- 52
           M+T IR P+ LPYPI + +L  S G  +  G RL  YK+W   E+   + GD+       
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 53  ----------SAGGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPC 102
                     S   K  R+ I+    F+SP  G ++S N+ +GDE   +   + EIK+PC
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEF---FESPYEGDLISWNVDVGDEIATANQVICEIKRPC 117

Query: 103 THDVTYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQL 162
            HD+ YGGLC QCG+ V  +   G  LD          +M+++ISE +A    ++ ++ L
Sbjct: 118 NHDIVYGGLCTQCGKEVSADAFDGVPLDVVG-------DMDLQISETEAIRSGEALKEHL 170

Query: 163 REARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMG 222
           R  +KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM 
Sbjct: 171 RRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMN 230

Query: 223 ------PKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGT 276
                   PP RKCWYYVK+RPGL++FF  +AP FE+HIYTMATR YA++IAKI+DP G 
Sbjct: 231 EDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGE 290

Query: 277 LFGDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIG 336
           LFGDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+G
Sbjct: 291 LFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVG 350

Query: 337 DINSNFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QK 395
           DINSNFLP+Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+ KI +EVKRQEE++  +
Sbjct: 351 DINSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQ 410

Query: 396 LSEEKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTD 455
           L+  + P    SKE++ KKLE++ASLEVQQQNRPLA+LQKHLH+++LL+DDDDEL +L  
Sbjct: 411 LATAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMG 470

Query: 456 ILLRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRAD 515
            L  +H+ YY  + +    + E  P++  +IPSLK+ VF+ C+FVFSGLIPL T+I R+D
Sbjct: 471 TLSNIHNTYYQMISQ----SNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSD 526

Query: 516 IVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKR 575
           IV+WT+TFGA +T +IDY TTHLITK P T KARLA  FN +IKI+HPDWIFEC+VNWK+
Sbjct: 527 IVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKK 586

Query: 576 VDEKPYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDS 635
           VDEKPY LIV+ P+S E L+NF+K+L   +K +  ++ N   Q   T  + + L     S
Sbjct: 587 VDEKPYTLIVDSPISDEELQNFQKQL---QKRQEYLEENQQQQHMLTPQENLNLFAAGTS 643

Query: 636 WLDNDDEMD 644
           WL+NDD+ D
Sbjct: 644 WLNNDDDED 652

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/658 (54%), Positives = 463/658 (70%), Gaps = 35/658 (5%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPG------DESA 54
           M+T IR P+ LPYPI + +L  S G  +  G RL  YK+W   +  +  G      D S 
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 55  GGKS--------KRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDV 106
           GG +         +Q  + +  F+SP  G ++S N+ +GDE   +   + EIK+PC HD+
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 107 TYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREAR 166
            YGGLC QCG+ V  +   G  LD          +M+++ISE +A    K+ ++ LR  +
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVVG-------DMDLQISETEAIRTGKALKEHLRRDK 173

Query: 167 KLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGP--- 223
           KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM     
Sbjct: 174 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 233

Query: 224 ---KPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGD 280
               PP RKCWYYVK+RPGL++FF+ +AP FE+HIYTMATR YAL+IAKI+DP G LFGD
Sbjct: 234 VLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGD 293

Query: 281 RILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 340
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINS
Sbjct: 294 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 353

Query: 341 NFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLSEE 399
           NFLP+Q   ML LGR+ R+K ++ +ELLTDI+D EKKL+ KI +EVKRQEE++  +L+  
Sbjct: 354 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 413

Query: 400 KIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLR 459
           + P    SKE++ KKLE++ASLEVQQQNRPLA+LQKHLH+++LL+DDDDEL +L   L  
Sbjct: 414 EEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 473

Query: 460 VHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLW 519
           +H  YY  L +      E  P++  +IPSLK+ VF+ C FVFSGLIPL T+I R+DIV+W
Sbjct: 474 IHMTYYQMLSQE----NEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIW 529

Query: 520 TNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEK 579
           T+TFGA +T +ID+ TTHLITK P T KARLA  FN +IKIVHPDWIFEC+VNWK+VDEK
Sbjct: 530 TSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEK 589

Query: 580 PYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWL 637
           PY LIV+ P+S E L+NF+ +L   +K +  ++ N   Q   T  + + L     SWL
Sbjct: 590 PYTLIVDSPISDEELQNFQSQL---QKRQEYLEENQEQQHMLTSQENLNLFATGTSWL 644

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/698 (53%), Positives = 477/698 (68%), Gaps = 68/698 (9%)

Query: 1   MSTP--IRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGD------- 51
           M+TP  IR P  LPYPIT+ +L    G  + +  RL AYK+W   +I TSP +       
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 52  -----------------ESAGGKSKRQRIDLVGT---------------------FDSPV 73
                             +    + R  I+ +                       FD P 
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 74  SGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVEDEQTSGSLLDNQA 133
            G + S  +  GD+ V     + EI++PC HDV YGGLC  CG+ V DE     L  +  
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEV-DENDIDDL--SGP 177

Query: 134 KLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIHCGVDPTIGEWSKD 193
            LT+SHT+ N++IS ++A  + +S +K+LR+ +KL+LVVDLDQTVIHCGVDPTIGEW +D
Sbjct: 178 NLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRD 237

Query: 194 PDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFEL 253
           P NPN+E+LKDV+ F+L EEP+LP  YMGPKPP RKCWYYVK+RPGL+DFF  +AP FE+
Sbjct: 238 PTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEM 297

Query: 254 HIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDR 313
           HIYTMATR YA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFP DQSMV+IIDDR
Sbjct: 298 HIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDR 357

Query: 314 GDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRK-----KLKQDEELL 368
           GDVWNW  NLIKV+PY+FFVG+GDINSNFLP+QQ +ML LGRR+ +       K++++LL
Sbjct: 358 GDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLL 417

Query: 369 TDILDTEKKLKVKISEEVKRQEEEM-QKLSEEKIPDHTT--SKEDIAKKLEHNASLEVQQ 425
           TDI+DTEK L+ KI+EEVKRQEE++  +L+  + P  T   +KE+I+KK+E++ASLEVQQ
Sbjct: 418 TDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQ 477

Query: 426 QNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSPDIKHL 485
           +NRPLA LQKH H++RLLIDDD+EL HL D L ++HS YY+ L+K       + PDIK++
Sbjct: 478 KNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYI 537

Query: 486 IPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLITKTPGT 545
           +P +K+ V + C+FVFSGLIPL TNI ++DIV+WTN FGA++T +ID NTTH+ITKTPGT
Sbjct: 538 MPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGT 597

Query: 546 MKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKELEETE 605
            KARLA S++ DIKIVHPDW+FEC++ WK V+EKPYEL+VE+ VS + L +F ++LE   
Sbjct: 598 YKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRI 657

Query: 606 KSKNSVDANISSQKYETFNDAMI------LLGGSDSWL 637
           +     D  +    Y    D  I      L  G  SWL
Sbjct: 658 QLSELKDEGL----YNKLPDGNIDINEVNLFAGGTSWL 691

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/661 (53%), Positives = 465/661 (70%), Gaps = 40/661 (6%)

Query: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSK- 59
           M+T IR P+ LPYPI + +L  S G  ++ G RL  YK+W    +V  P D         
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFW---YLVERPSDAGDDDNDHD 57

Query: 60  ---------------RQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTH 104
                          +Q  + +  F+SP  G ++S N+ +GDE   +   + EIK+PC H
Sbjct: 58  SSPGGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNH 117

Query: 105 DVTYGGLCVQCGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLRE 164
           D+ YGGLC QCG+ V  +   G  LD          +M+++ISE +A    ++ ++ LR 
Sbjct: 118 DIVYGGLCTQCGKEVSADAFDGVPLDVVG-------DMDLQISETEAIRTGRALKEHLRR 170

Query: 165 ARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMG-- 222
            +KL+LVVDLDQT+IHCGVDPTI EW  DP+NPN+E+L+DV+SF+L EE VLP  YM   
Sbjct: 171 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAED 230

Query: 223 ---PKPP-TRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLF 278
              PKPP  RKCWYYVK+RPGL++FF+ +AP FE+HIYTMATR YAL+IAKI+DP G LF
Sbjct: 231 GSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELF 290

Query: 279 GDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDI 338
           GDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDI
Sbjct: 291 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 350

Query: 339 NSNFLPRQQNSMLHLGRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM-QKLS 397
           NSNFLP+Q   ML LGR+ R+K ++ +EL+TDI+D EKKL+ KI  EVKRQEE++  +L+
Sbjct: 351 NSNFLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLA 410

Query: 398 EEKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDIL 457
             + P    SKE++ KKLE++ASLEVQQQNRPLA+LQKHLH+++LL+DDDDEL +L   L
Sbjct: 411 TAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTL 470

Query: 458 LRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIV 517
           L +H  YY  L +      E+ P++  +IPSLK+ VF+ C FVFSGLIPL T+I R+DIV
Sbjct: 471 LNIHKTYYQMLSQ----PGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIV 526

Query: 518 LWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVD 577
           +WT+TFGA +T +I+Y TTHLITK PGT KARLA  FN +IK+VHPDWIFEC+VNWK+VD
Sbjct: 527 IWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVD 586

Query: 578 EKPYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWL 637
           EKPY LIV+ P+S + L++F+K+L   +K +  +D +   Q      + + L     SWL
Sbjct: 587 EKPYTLIVDSPISDDELQSFQKQL---QKKQEYLDEHHEQQHMLMPQENINLFAAGTSWL 643

Query: 638 D 638
           +
Sbjct: 644 N 644

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/670 (54%), Positives = 474/670 (70%), Gaps = 42/670 (6%)

Query: 3   TPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIV----TSPGDESAGGKS 58
           TP+     LPYP+TV +L    GD V RG RLFAYK+W   ++      + GD    G +
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 59  KRQRI-DLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQ 117
            ++ + + V  F+SP  G VVS ++  GDE       +  +++PC HDV Y GLC  CG+
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 118 TVEDEQ------TSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLV 171
            V++ +       SG +  N   LT+SH + N++IS  +A  L+   Q++LR A+KLVLV
Sbjct: 127 EVDEYEIQAAAAASGGVGPN---LTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLV 183

Query: 172 VDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPK-PPTRKC 230
           VDLDQTV+HCGVDPTIGEW +DP NPNYE+L+DV+SF+L EEP+LP  Y+G K P  RKC
Sbjct: 184 VDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKC 243

Query: 231 WYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGS 290
           WYYVK+RPGL+ FF  +AP FE+HIYTMATR YALEIAKIIDPD +LFGDRILSRDENGS
Sbjct: 244 WYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGS 303

Query: 291 LTQKSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSM 350
           LT KSLERLFP DQSMV +IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP+QQ +M
Sbjct: 304 LTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTM 363

Query: 351 LHLGRRNR-------KKLKQDEE----LLTDILDTEKKLKVKISEEVKRQEEEMQKLS-- 397
           L +GRR++        K +QD+     LLTDI++TEK+L+ KI +EVKRQE ++ K +  
Sbjct: 364 LQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAA 423

Query: 398 --EEKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTD 455
             E++ P    SKE+  KKLE +AS+EVQQ+NRPLA LQKHLHN++LL+D+DDEL +L D
Sbjct: 424 GDEQQTPGQ--SKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKD 481

Query: 456 ILLRVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRAD 515
            L  +H  YY  L++N         +I+ ++  LK  VF+ C+FVFSGLIPL+TN+  AD
Sbjct: 482 RLADLHKRYYSTLKENPQDT-----NIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAAD 536

Query: 516 IVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKR 575
           IV+WTN FGA TT ++D  TTHLITKTPGT KARLA +FN DIKIVHPDWIFEC++ W+R
Sbjct: 537 IVIWTNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWER 596

Query: 576 VDEKPYELIVEEPVSKEYLENFKKEL---EETEKSKNSVDANISSQKYETFNDAMILLGG 632
           VD KPY LIVE+PVS+  +  FK++L   +E  + + S  A + + K    +  + L  G
Sbjct: 597 VDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPD--IDLFAG 654

Query: 633 SDSWLDNDDE 642
             SWL+++D+
Sbjct: 655 GISWLNDEDD 664

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 69/153 (45%), Gaps = 27/153 (17%)

Query: 475 ATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWT---NTFGAKTTINI 531
            T  SPD +H++        K C    S      T  +R + +L++   N  G   +  I
Sbjct: 112 TTNYSPDPRHIL--------KDCTIYVS-----RTVFNRTENILYSELINALGGSVSDMI 158

Query: 532 DYNTTHLITKTPG--TMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPV 589
              TTHLI+  P    + A +AS  +  IK V+P W+ +C +  K VDEK +  I++  +
Sbjct: 159 SNKTTHLISSDPTDPALIAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNF--ILDSSL 216

Query: 590 SKEYLE-------NFKKELEETEKSKNSVDANI 615
           S E  E       N    ++ T K+K  +D N 
Sbjct: 217 SPEDAEETLNDSWNLLGSIQPTTKNKYLIDHNF 249

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 93/218 (42%), Gaps = 36/218 (16%)

Query: 455 DILLRVHSAYY--DQLEKNKHGATEL-SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNI 511
           D+L+ V ++ +    +E  +H  T L SPD  H +  L+  V K              + 
Sbjct: 91  DLLIPVVTSNWITKAIETKRHPKTSLFSPDPNHFLKDLQICVLK-------------PSF 137

Query: 512 DRADIVLWT---NTFGAKTTINIDYNTTHLITKTPG-TMKARLASSFNRDIKIVHPDWIF 567
           + ++ +L+T   ++ G     NI+  TTH+IT  P  +    L  +    IK ++P W+ 
Sbjct: 138 EASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIYPTWLI 197

Query: 568 ECIVNWKRVDEKPYELIVEEPVS--KEYLENFKKELEET--EKSKN---------SVDAN 614
            C+   + +DE  +E++   P +   E L +   ++ +   EK+ N         S+D  
Sbjct: 198 HCVKESQLIDESEHEIV---PFTDDTEKLNDLWNQVNDIKFEKASNFLSGHTFIVSIDLL 254

Query: 615 ISSQKYETFNDAMILLGGSDSWLDNDDEMDEFLNDSDS 652
            S   Y  F D +   GG         E+ + +ND  S
Sbjct: 255 FSKDSYIFFIDFIKNCGGEIHNYFETKELSKIINDGSS 292

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 521 NTFGAKTTINIDYNTTHLITKT---PGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVD 577
           N+ G   T  I+  TTHLI      P  +  +     N  IK V+P W+ +C    K +D
Sbjct: 158 NSLGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYID 217

Query: 578 EKPYELIVEEPVSKEYLEN 596
           E P+ LI E+  + E+L++
Sbjct: 218 ESPH-LITEDQNNSEHLDD 235

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 71/149 (47%), Gaps = 21/149 (14%)

Query: 465 YDQLEKNKHGAT-ELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWT--- 520
           Y  +E NK   T   SPD        ++++FK    +F  L     + ++ +++ ++   
Sbjct: 98  YKCIEVNKLVKTNSFSPD--------EKLIFKNYQ-IFLSL----NSFNKTEVLFYSELI 144

Query: 521 NTFGAKTTINIDYNTTHLITKTPG--TMKARLASSFNRDIKIVHPDWIFECIVNWKRVDE 578
           N  G  T  +I   TTHLIT  P    + A +AS   ++I  V+P W+ +C  +   V+E
Sbjct: 145 NALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNE 204

Query: 579 KPYELIVEEPV--SKEYLENFKKELEETE 605
             + + ++     SK  L++    +EE++
Sbjct: 205 SDHLINIQSSAEDSKNRLQDLWNMVEESQ 233

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 45/110 (40%), Gaps = 4/110 (3%)

Query: 494 FKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAK-TTINIDYNTTHLITKTPGTMKARLAS 552
             G       L P+  NI    I       GAK    ++  +TTH I        A L  
Sbjct: 171 MSGITVCLGSLDPM-LNISEEQIEKCLQVIGAKPLQKHVSIDTTHFICNDEEEEDAELIR 229

Query: 553 SFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKELE 602
           + N +I IV P+WI  C V  + V  + + L  ++ + K Y   F KE E
Sbjct: 230 AKNSNIPIVRPEWIRACAVEKRIVGVRGFYLDADKSILKSY--TFPKEQE 277

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 504 LIPLHTNI---DRADIVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKI 560
           LI  +TN+    R  I   TN  G  TT  + +    L+   P  MK + A  +   + I
Sbjct: 349 LILTYTNLFGPQRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLII 408

Query: 561 VHPDWIFECIVNWKRVDEKPY 581
           V P+W+ EC    K++D K +
Sbjct: 409 VGPNWLEECYKANKKLDPKLF 429

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 58/147 (39%), Gaps = 35/147 (23%)

Query: 144 IRISEKQAYTLEKSAQKQL-------REARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDN 196
           I +S+ QA  +  +  + L       R  RK  L++DLD+T++H                
Sbjct: 293 IDLSKLQANQVSATGYETLLAPKEIKRFGRKKCLILDLDETLVHS--------------- 337

Query: 197 PNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIY 256
               S K V S           F +      +    YV  RPG+ +F   ++  +E+ ++
Sbjct: 338 ----SFKYVDS---------ADFVIPVTIDNQTHHVYVIKRPGVDEFLKRVSELYEVVVF 384

Query: 257 TMATRTYALEIAKIIDPDGTLFGDRIL 283
           T +   Y   +  I+DP  T+   R+ 
Sbjct: 385 TASVSRYGDPLLNILDPANTIIHHRLF 411

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+ +F S +   +E+ ++T +   YA  +   +DP+GT+
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {ON}
           Anc_4.156 YLR330W
          Length = 566

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 55/134 (41%), Gaps = 9/134 (6%)

Query: 526 KTTINIDYNTTHLITKT---PGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYE 582
           +T + ID  TTH +       G     L  + N +I IV P+WI  C V  + V  + + 
Sbjct: 205 QTKVGID--TTHFVCNELDDNGEEDEELQKAKNNNIPIVKPEWIRACCVEKRIVGVRAFY 262

Query: 583 LIVEEPVSKEY----LENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD 638
           +  E  VS +Y    L+N     +E E     V   + S   ET  +    +   +    
Sbjct: 263 VGAESTVSDDYKFPPLKNLPHPTQEQESPVEPVHEEVGSVPQETGTNEYESVPADNEDTP 322

Query: 639 NDDEMDEFLNDSDS 652
               M+E  NDS+S
Sbjct: 323 QPSAMNELNNDSES 336

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+ +F + ++  +E+ ++T +   YA  +   +DP+GT+
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 42/106 (39%), Gaps = 22/106 (20%)

Query: 159 QKQLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPP 218
           Q  L   RK  LVVDLD+T+IH                    S+    S   H   V  P
Sbjct: 145 QSILFAERKKRLVVDLDETLIHSAT----------------RSVSHSNSAQGHMVEVRFP 188

Query: 219 FYMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYA 264
                 P +    YYV  RP    F S ++  ++L I+T + + YA
Sbjct: 189 ------PSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYA 228

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+ +F   ++  +E+ ++T +   YA  +   +DP+GT+
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRIL 283
           YV  RPG+++F   +   FE+ ++T +   Y   +  I+DP   L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 27/124 (21%)

Query: 160 KQLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPF 219
           K  ++  K  L++DLD+T++H           K  +NP++    ++    +H        
Sbjct: 305 KDSKDKHKKCLILDLDETLVHSSF--------KFINNPDFILPIEIEDGQIHN------- 349

Query: 220 YMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFG 279
                        YV  RPG+  F   +   +E+ I+T +   YA  +  ++D D  L  
Sbjct: 350 ------------VYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLIN 397

Query: 280 DRIL 283
            R+ 
Sbjct: 398 HRLF 401

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 14/93 (15%)

Query: 493 VFKGCNFVFSGLIPLHTNIDR----ADIVLWTNTFGAKTTINIDYNTTHLITKTPGTMKA 548
           +F+GC    +G    HT+ DR     +IV+   TF        D   TH++ +     K 
Sbjct: 43  IFRGCRVHVNG----HTDPDREELRREIVMHGGTFVHYLARPSD--VTHIVAEHVPVAKR 96

Query: 549 RLASSFNRDIKIVHPDWIFECIVNWKRVDEKPY 581
           RL  +     K+V P W+  C+ + + V  KPY
Sbjct: 97  RLWHA----CKVVRPAWVSACLCSGELVPWKPY 125

>NDAI0J01640 Chr10 (403145..405241) [2097 bp, 698 aa] {ON} Anc_4.156
           YLR330W
          Length = 698

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 11/109 (10%)

Query: 494 FKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAK---TTINIDYNTTHLITK-----TPGT 545
             G       L PL  +I +A +       GAK   T + ID  TTH +T        G 
Sbjct: 192 MSGITVCLGPLDPL-LHITKAQVSQCLKNLGAKPLQTKVGID--TTHFVTNETDTGADGE 248

Query: 546 MKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYL 594
             A L  + + +I +V P+W+  C  + + V  + + L  +  ++K Y+
Sbjct: 249 ENAELKKAKDNNIPVVKPEWVRACEQDERIVGVRGFYLDADPALAKNYV 297

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGT----LFGDRILSRDEN 288
           YV  RPG+ +F   +   +E+ ++T +   Y   +  I+DP G     LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 6/93 (6%)

Query: 493 VFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLITKTPGTMKARLAS 552
           VF+GC    +G         R +IVL    F    T   D   TH++ +    + A    
Sbjct: 90  VFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKKSD--VTHIVAQN---LSAAKCI 144

Query: 553 SFNRDIKIVHPDWIFECIVNWKRVDEKPYELIV 585
            F R+ K+V P WI  C+   K +  + Y +IV
Sbjct: 145 EF-RNFKVVQPGWIGACVRIGKMLSWREYSVIV 176

>TDEL0G01170 Chr7 complement(238219..241326) [3108 bp, 1035 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1035

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 42/107 (39%), Gaps = 19/107 (17%)

Query: 468 LEKNKHGATEL-SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAK 526
           L  N+H  T + SPD +H+    +  V + C                ++ + +T    A 
Sbjct: 106 LSTNRHHRTAVFSPDRRHIFKDYQIYVSRHC-------------FKHSEYLFYTEIVNAM 152

Query: 527 TTINIDY---NTTHLITKTPGTMKARLASSFNR--DIKIVHPDWIFE 568
               ID+    TTHLITK  G         F +   IK V P W+ +
Sbjct: 153 GGTCIDFLSNRTTHLITKDSGDPAVAAVVGFGKVDSIKFVFPTWLVQ 199

>TPHA0C01240 Chr3 complement(282061..283950) [1890 bp, 629 aa] {ON}
           Anc_7.220 YER049W
          Length = 629

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 6/84 (7%)

Query: 362 KQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSK--EDIAKKLEHNA 419
           K  E LLT   D  K  K  +SE +K  E E+Q LS+   P+H T++    + K  E N+
Sbjct: 296 KHYERLLTGEEDNNKDCKF-LSEALKLTEREIQYLSQYISPEHLTAEGITKLQKSFEDNS 354

Query: 420 SLEVQQ-QNRPLAELQKHL--HNE 440
           SL+++   N P ++L K L  H+E
Sbjct: 355 SLQIESFLNDPKSDLLKKLIKHDE 378

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRIL 283
           YV  RPG+ +F   +   FE+ I+T +   Y   +   +DP G     R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>Kwal_47.17438 s47 complement(402545..402973) [429 bp, 142 aa] {OFF}
           [contig 207] FULL
          Length = 142

 Score = 32.3 bits (72), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 602 EETEKSKNSVDANISSQKYETFNDAM--ILLGG-SDSWLDNDDEMDEFLNDSDSEDHR 656
           EET ++++ V A +SS   +T +  +  ++LG    S L ND E   FL+  DS+DHR
Sbjct: 46  EETRRARSGVPARLSSLVVDTTDRRLSELVLGLLRRSSLANDSEDHRFLDPLDSKDHR 103

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 523 FGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYE 582
            G K+T  +    THLI   P   K   A S    I +V+  W+ +C++   RV E  +E
Sbjct: 374 LGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFE 433

>TDEL0D02950 Chr4 complement(556701..558692) [1992 bp, 663 aa] {ON}
           Anc_4.156 YLR330W
          Length = 663

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 13/80 (16%)

Query: 494 FKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKT-TINIDYNTTHLITKT------PGTM 546
             G       L PL  NI  A I    +  GA+     +  +TTH +T        P  M
Sbjct: 171 MSGITVCLGPLDPL-LNISGAQIAQSLSQMGARPLQRRVAIDTTHFVTNDAENDDDPELM 229

Query: 547 KARLASSFNRDIKIVHPDWI 566
           KA+     N +I IV P+W+
Sbjct: 230 KAK-----NSNIPIVRPEWV 244

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+++F   +   FE+ ++T +   Y   +  I+D D  +
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKVI 326

>Kwal_14.1042 s14 complement(168504..171242) [2739 bp, 912 aa] {ON}
           YHR154W (RTT107) - involved in silencing [contig 244]
           FULL
          Length = 912

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 483 KHLIPSLKEIV--FKGCNFVFSGLIPLHTNI---DRADIVLWTNTFGAKTTINIDYNTTH 537
           + ++PS K ++   + C F  S L+  +TN     R  I       G K+T  +    TH
Sbjct: 324 RFILPSEKLLLSPLRPCIFQKSELVLSYTNYMGQQRHYIQRLVEALGGKSTTELTKKNTH 383

Query: 538 LITKTPGTMKARLASSFNRDIKIVHPDWIFEC 569
           L++  P   K   AS +  +  IV+  W+ +C
Sbjct: 384 LLSCLPHGQKYEAASRWGNNCIIVNHLWLEDC 415

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+ +F   ++  +E+ ++T +   YA  +   +DP+ T+
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+++F   +   FE+ ++T +   Y   +  I+D D  +
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVI 339

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+++F   +   FE+ ++T +   Y   +  I+D D  +
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVI 327

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 227 TRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDP-----DGTLFGDR 281
           T++  +    RPG+  F   ++ ++E+ +++     YA +IA+ +DP        LF + 
Sbjct: 211 TQQSGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEH 270

Query: 282 ILSRDENGSLTQKSLERLFPMDQSMVVIID-DRGDVWNWCENLIKVVPYD 330
            L +D    +  K L +L   D   V+IID D        EN I + P+D
Sbjct: 271 CLYKD---GVHIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 162 LREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYM 221
           L   +K  LV+DLD+T+IH     T         N +   L +V+ F +   P L     
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK-FGISGIPTL----- 293

Query: 222 GPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYA 264
                     Y++  RP    F + ++  ++L I+T + + YA
Sbjct: 294 ----------YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYA 326

>TBLA0F02100 Chr6 complement(516681..517040,517329..517331) [363 bp,
           120 aa] {ON} Anc_7.306 YDL136W
          Length = 120

 Score = 30.8 bits (68), Expect = 4.7,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 14/76 (18%)

Query: 360 KLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNA 419
           + K  E+L T ++D +K+L           E ++QKLS   +P   T ++DIA+ L    
Sbjct: 10  RTKSKEQLATQLVDLKKELA----------ELKVQKLSRPSLPKIKTVRKDIARVL---- 55

Query: 420 SLEVQQQNRPLAELQK 435
           ++  QQQ + + +L K
Sbjct: 56  TVITQQQRQAVRDLYK 71

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 233 YVKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTL 277
           YV  RPG+ +F   I   +E+ ++T +   Y   +  I+D D T+
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 41/113 (36%), Gaps = 17/113 (15%)

Query: 475 ATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWT---NTFGAKTTINI 531
           A+  SPD  H        V K C    S       +I   +   +    NT G      +
Sbjct: 108 ASNFSPDQAH--------VLKNCQIYIS-----KQSISATECSFYISLINTLGGFCIDFL 154

Query: 532 DYNTTHLITKTP-GTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYEL 583
               TH+IT  P     A +     +DIK V P W+       + VDE P+ L
Sbjct: 155 SSRATHIITLDPQDPAIAAVTHIGKKDIKFVLPTWLVSVFKKGQHVDETPHLL 207

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 162 LREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYM 221
           L+  ++  L++DLD+T+IH     ++          NY  L +V+  +    P   P   
Sbjct: 187 LKTNKRKKLILDLDETLIH-----SMSRNISSSTISNYH-LIEVKFPTPTSAPTSAP--- 237

Query: 222 GPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYA 264
           GP  P     YYV  RP    F + ++  ++L I+T + + YA
Sbjct: 238 GPSLPLSSL-YYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYA 279

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 30/63 (47%)

Query: 531 IDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVS 590
           +  +TTH +     +    LA + N +I +V P+WI  C +  + V  + + L V+    
Sbjct: 207 VSLDTTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVDSSTL 266

Query: 591 KEY 593
           + Y
Sbjct: 267 ESY 269

>KLTH0D17512g Chr4 (1457372..1461661) [4290 bp, 1429 aa] {ON} highly
           similar to uniprot|P47169 Saccharomyces cerevisiae
           YJR137C ECM17 Sulfite reductase beta subunit involved in
           amino acid biosynthesis transcription repressed by
           methionine
          Length = 1429

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 77/178 (43%), Gaps = 13/178 (7%)

Query: 461 HSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWT 520
           H+ +  Q   N      L   I+ +  SL++   K    +FS  + +  N   + I   +
Sbjct: 307 HALFIGQSASNTAEVEHLQSSIQKVF-SLEDAYLKVLKQLFSDNLQILNNYSDSSINASS 365

Query: 521 NTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRD--IKIVHPDWIFECIVNWKRVDE 578
             +G    ++ +     L++    ++     +SFN    +KIV      E +  W R +E
Sbjct: 366 PEYGYGLFVSQEKKRQELVSIVRKSLDT---ASFNSSEGVKIV------ELLSKWLRFNE 416

Query: 579 KPYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSW 636
           +P +    E  +K  +E +   LE  + S+N+++   +++  E+F      L GSD+W
Sbjct: 417 QPLKEASLEEANKVAVELYDL-LERNQDSRNALNILENAKSVESFKFTSSWLIGSDAW 473

>KNAG0D05050 Chr4 (923903..924409) [507 bp, 168 aa] {ON} Anc_7.25
           YAL044C
          Length = 168

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 31/48 (64%), Gaps = 4/48 (8%)

Query: 576 VDEKPYELIVEEPVSKEYLENFKKELEETEKSKNSVDANISSQKYETF 623
           ++E P +LI E+P+ K ++  F+ EL   EKSK ++D   + ++YE F
Sbjct: 122 LEESP-QLINEDPLGKGWMVQFEYEL---EKSKAAIDGLYTLEQYEKF 165

>TBLA0B07390 Chr2 complement(1758977..1762072) [3096 bp, 1031 aa]
           {ON} Anc_5.94 YHR154W
          Length = 1031

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 524 GAKTTINIDYN-TTHLITKTPGTMK---ARLASSFNRDIKIVHPDWIFECIVNWKRVDEK 579
           GA +++N+    T  LI K P   K   A+L +S  +DIKI++  W+ +C +  K +   
Sbjct: 399 GANSSVNLTKKFTNFLIVKKPIGKKFESAKLWNSKGQDIKILNHRWLHDCYIQNKNLKLI 458

Query: 580 PYELIVEEPVSKEYLENF 597
           P  LI  +   +   ++F
Sbjct: 459 PKYLIFPKDNEESIFDSF 476

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score = 32.0 bits (71), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 556 RDIKIVHPDWIFECIVNWKRVDEKP 580
           R   I+HP WI +CI N K +D +P
Sbjct: 773 RGYDIIHPKWILDCIANDKLLDFEP 797

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 237 RPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDP-----DGTLFGDRILSRDENGSL 291
           RPG+  F   ++ ++E+ +++     Y+  IA+ +DP        LF +  L +D    +
Sbjct: 222 RPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAFVSYNLFKEHCLYKD---GV 278

Query: 292 TQKSLERLFPMDQSMVVIID-DRGDVWNWCENLIKVVPYD 330
             K L +L   D+  V+IID D        EN I + P+D
Sbjct: 279 HIKDLSKL-NRDEKKVLIIDVDPNSYKLQPENAIPMKPWD 317

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,993,781
Number of extensions: 4268261
Number of successful extensions: 29782
Number of sequences better than 10.0: 950
Number of HSP's gapped: 30124
Number of HSP's successfully gapped: 1078
Length of query: 751
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 634
Effective length of database: 40,065,477
Effective search space: 25401512418
Effective search space used: 25401512418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)