Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46098.838ON52052024470.0
ABL128W8.838ON47436711791e-157
SAKL0D01518g8.838ON5743868241e-103
Kwal_27.102728.838ON5513687582e-93
KLLA0D01617g8.838ON5623847252e-88
KLTH0C03916g8.838ON5703677244e-88
TDEL0B005908.838ON5413645453e-62
ZYRO0G14146g8.838ON5073635144e-58
Kpol_1068.108.838ON6173764971e-54
TPHA0I002308.838ON6143724821e-52
NCAS0B003108.838ON5643344342e-46
YML114C (TAF8)8.838ON5103924085e-43
Smik_13.208.838ON5103684024e-42
NDAI0E003008.838ON6644394004e-41
Skud_13.278.838ON5143783936e-41
Suva_13.298.838ON5093703927e-41
TBLA0D032508.838ON6833473581e-35
KAFR0A028208.838ON4533363221e-31
CAGL0B02299g8.838ON6432142588e-23
KNAG0G034108.838ON5262682026e-16
NCAS0B054003.116ON10563711.1
SAKL0E14388g2.8ON93647751.6
SAKL0H02332g5.76ON81784705.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4609
         (520 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   947   0.0  
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   458   e-157
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   322   e-103
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   296   2e-93
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   283   2e-88
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   283   4e-88
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   214   3e-62
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   202   4e-58
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   196   1e-54
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   190   1e-52
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   171   2e-46
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   161   5e-43
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   159   4e-42
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   158   4e-41
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   155   6e-41
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   155   7e-41
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   142   1e-35
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   128   1e-31
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   103   8e-23
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    82   6e-16
NCAS0B05400 Chr2 complement(1008268..1008585) [318 bp, 105 aa] {...    32   1.1  
SAKL0E14388g Chr5 complement(1187853..1190663) [2811 bp, 936 aa]...    33   1.6  
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    32   5.7  

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/520 (89%), Positives = 467/520 (89%)

Query: 1   MTTDIKSSDGSTEGAKEFIQLKKLPGLQEVAKHNPMQILLSQSVALQLKTMKSDFSITEL 60
           MTTDIKSSDGSTEGAKEFIQLKKLPGLQEVAKHNPMQILLSQSVALQLKTMKSDFSITEL
Sbjct: 1   MTTDIKSSDGSTEGAKEFIQLKKLPGLQEVAKHNPMQILLSQSVALQLKTMKSDFSITEL 60

Query: 61  GFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRY 120
           GFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRY
Sbjct: 61  GFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRY 120

Query: 121 IKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSY 180
           IKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSY
Sbjct: 121 IKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSY 180

Query: 181 VPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVE 240
           VPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVE
Sbjct: 181 VPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVE 240

Query: 241 DEETIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYA 300
           DEETIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYA
Sbjct: 241 DEETIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYA 300

Query: 301 RSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYV 360
           RSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYV
Sbjct: 301 RSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYV 360

Query: 361 GVLKSIPKLRQLKANEMAAAXXXXXXXXXXXXXXLEKKHLQQGVVXXXXXXXXXXXXXXX 420
           GVLKSIPKLRQLKANEMAAA              LEKKHLQQGVV               
Sbjct: 361 GVLKSIPKLRQLKANEMAAAIERERIKQKEREMELEKKHLQQGVVDLNALHEDALLADLD 420

Query: 421 XXXXXXXXPMMGSKKQELGFSEIANPLQAKKILAQDSTLNVSSDIESTXXXXXXXXXXXX 480
                   PMMGSKKQELGFSEIANPLQAKKILAQDSTLNVSSDIEST            
Sbjct: 421 STDSEDDEPMMGSKKQELGFSEIANPLQAKKILAQDSTLNVSSDIESTSSARPSSKPPQQ 480

Query: 481 XXXXDVTTPPASENTTSPHHSAIHLTPTGPLIGSTPFVPH 520
               DVTTPPASENTTSPHHSAIHLTPTGPLIGSTPFVPH
Sbjct: 481 QPLQDVTTPPASENTTSPHHSAIHLTPTGPLIGSTPFVPH 520

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  458 bits (1179), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/367 (59%), Positives = 278/367 (75%), Gaps = 20/367 (5%)

Query: 14  GAKEFIQLKKLPGLQEVAKHNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQM 73
           GAKE IQLKKLP L EV K NPMQ LL+Q+V L LKTM+SD  IT+LGF N++QF+E+Q+
Sbjct: 14  GAKEGIQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQL 73

Query: 74  NDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIE 133
           +DM QILHRFAN+QRRNE+S+KD++LFL G G+E +SLY+E+ +S+Y+++ +    ++IE
Sbjct: 74  DDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIE 133

Query: 134 RQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHT 193
            QS  L+  W +P+ +EELLSS+HAEFFFKDVDILNLVPPTN NN YVP WLPEFPPDHT
Sbjct: 134 EQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHT 193

Query: 194 YKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETIAQTYKESQ 253
           YKFT+IYN+PI+DERQMKR LFEE KLSEKALL+MLG+A  K     D+  + Q   + Q
Sbjct: 194 YKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKK--PRADDAQLPQIISDGQ 251

Query: 254 EETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEE 313
           +E  LIYG E++R                 L    + ++GFNI++YAR R+ LARR+VEE
Sbjct: 252 QENLLIYGPERRR-----------------LAPEPAPTRGFNIEDYARCRVELARRRVEE 294

Query: 314 FENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQLK 373
           FE  KLQ QKNPFIRA++ CSPY    + +RKA EREF +LL RSY+GVL +IP+LR+ K
Sbjct: 295 FEQQKLQVQKNPFIRAAAACSPYATT-RLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353

Query: 374 ANEMAAA 380
           A E+AAA
Sbjct: 354 ARELAAA 360

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  322 bits (824), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 172/386 (44%), Positives = 256/386 (66%), Gaps = 17/386 (4%)

Query: 1   MTTDIKSSDGSTEGAKEFIQLKKLPGLQEVAKHN----PMQILLSQSVALQLKTMKSDFS 56
           MTT+  S   +   +++ I+LKKLP L   A H+    PM  +LSQ+VA++LK M  D +
Sbjct: 1   MTTEEASHKDAPAPSRKQIRLKKLPTLH-AAPHDSLEQPMHKILSQAVAIRLKPMNKDVA 59

Query: 57  ITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFE 116
           +++  F N++Q +   ++ M   LHRF +IQRR EIS KDL L LKG  +    L  E E
Sbjct: 60  MSQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELE 119

Query: 117 KSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNI 176
            S+YI   +  +   I ++S +L  K  KP+ ++ELL+S H+EFFFKD+DIL+LVPPTN 
Sbjct: 120 SSQYIVSNHPEKVNKIAQKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNK 179

Query: 177 NNSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKM 236
           NN Y+P WLPEFPPDHTY+FT+ YNKP+ DERQ++R L EEGK SE+AL+N+L    +  
Sbjct: 180 NNQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTN 239

Query: 237 LKVEDEETIAQT--YKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGF 294
             + + E + +   Y+E+QEET LI+G E+++          ++T N    L +   K F
Sbjct: 240 QDLGNNERVEKRSLYEETQEETFLIFGPERKK---------SHTTENSHELLRTLPLKNF 290

Query: 295 NIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNIL 354
           +++EYAR+R+ +ARRKV E+E ++L+ QKNPFI+A+++CSP   +   +RKA ++E   +
Sbjct: 291 SVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKS-TMSRKAIDKELKSM 349

Query: 355 LRRSYVGVLKSIPKLRQLKANEMAAA 380
           L+RSY+G+L+S+PKL ++KA E   A
Sbjct: 350 LQRSYIGLLRSVPKLNEVKARERELA 375

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  296 bits (758), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/368 (43%), Positives = 237/368 (64%), Gaps = 18/368 (4%)

Query: 18  FIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMN 74
            +QLK LP L E+ K    +P++ LL +++A+QLK++ +D SI++L F N++  +E  ++
Sbjct: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77

Query: 75  DMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIER 134
           +M   LH+ ANIQRR+ IS KDL L ++G  +    L  E E+SRY++  +  + K +E 
Sbjct: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137

Query: 135 QSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHTY 194
            S  + ++   PL   ELLSS H EFF  D D+L LVPP+  +  +VP WLP+FPPDHTY
Sbjct: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197

Query: 195 KFTAIYNKPISDERQMKRMLFEEGKLSEKAL--LNMLGSAQAKMLKVEDEETIAQTYKES 252
           +FTA YNKPI+DER MKR L EE  LSEKAL  L+ML   +A    + D +TI   Y+E+
Sbjct: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPI-DSDTI---YEEA 253

Query: 253 QEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVE 312
           Q+ETQL++G     P ++      N  N  DL L +   + F+++EYAR+R+ +ARR+V 
Sbjct: 254 QQETQLLFG-----PVKKKKTAAINEVN--DL-LRTLPQQNFSVEEYARNRVEIARRRVN 305

Query: 313 EFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQL 372
           E+E H+LQ QK  FI+A+ + SP+   ++T+ K  E+E   LL RS +G+LKS P L++ 
Sbjct: 306 EYERHQLQLQKGAFIKAAHLLSPFSK-KRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKER 364

Query: 373 KANEMAAA 380
           +  E+A A
Sbjct: 365 RKREIALA 372

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  283 bits (725), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 235/384 (61%), Gaps = 13/384 (3%)

Query: 1   MTT--DIKSSDGSTEGAKEFIQLKKLPGLQEVAKHNPMQILLSQSVALQLKTMKSDFSIT 58
           MTT  D   +D   E  +  ++L KLP L EV   NPM+ L +Q+V LQLKT+  +  I+
Sbjct: 1   MTTSEDKDKNDAKIETDQRRVRLDKLPNLNEVPHANPMERLFAQAVLLQLKTLNKNVVIS 60

Query: 59  ELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKS 118
           +L F+++     +Q++D+ Q L +   +QRR +IS  DL L+ KG G++++ L  + E S
Sbjct: 61  QLAFDDLCYVSLLQLDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEIS 120

Query: 119 RYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINN 178
            ++   ++ E   +    L + +++ K L ++ELLSS H+EFF +DVDILNL+P +N +N
Sbjct: 121 NFVHGKFKDEANALNETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSN 180

Query: 179 SYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSA--QAKM 236
            YVP+WLPE PPDHTYKFT++Y +PI+DER MK+ L EEG+LSEKALLNML     Q  +
Sbjct: 181 KYVPSWLPELPPDHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPL 240

Query: 237 LKVEDEE-------TIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSS 289
           + +  +         +++  KESQ ET LI+   K  P   +   G  +  +     N S
Sbjct: 241 VALNKDSDQSANNAALSEHIKESQLETDLIFDPHKTIPT--DKEWGTTTVLHGIESFNLS 298

Query: 290 HSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAER 349
             K FN+ EY + R  + +R+ E  EN     ++NPFIR + ICSPYG     +RK+ E 
Sbjct: 299 PVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVEN 358

Query: 350 EFNILLRRSYVGVLKSIPKLRQLK 373
           +   +LRRSY+G++ SIP++++++
Sbjct: 359 QLKTMLRRSYLGLIDSIPRVKEVR 382

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  283 bits (724), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 156/367 (42%), Positives = 233/367 (63%), Gaps = 19/367 (5%)

Query: 19  IQLKKLPGLQEV---AKHNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMND 75
           +QL+ LP L+E+   A  +P++ LL ++VA+QLK + S+ SI++  F N++  +E  +++
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 76  MFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQ 135
           M   LH+  NIQRR+ IS KDL L + G  +    L  E E+S+Y++       + +  +
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVREE 138

Query: 136 SLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHTYK 195
           S  +  K + PL ++ELL S H EFF +D +IL LVPPT  N  YVP WLPEFPPDHTY+
Sbjct: 139 SEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198

Query: 196 FTAIYNKPISDERQMKRMLFEEGKLSEKALLNM--LGSAQAKMLKVEDEETIAQTYKESQ 253
           FT+ +N+PI+DER MKR L EE  LSEKAL+++  L   ++     + +E     +KESQ
Sbjct: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDE----IFKESQ 254

Query: 254 EETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEE 313
           ++TQLI+G  K   + + A + G S    DL L +   + +N++EYAR+R+ +ARRKVEE
Sbjct: 255 QDTQLIFGPAK---KTKIAAINGAS----DL-LRTLPQQNYNVEEYARNRVEIARRKVEE 306

Query: 314 FENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQLK 373
           +E H+L  QK  FI+A+ + SP+  A+K   K  E+E   LL RSY+G+LKS P LR+ +
Sbjct: 307 YERHQLLLQKGAFIKAAHLLSPF--AKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQR 364

Query: 374 ANEMAAA 380
             E+  A
Sbjct: 365 KREVELA 371

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  214 bits (545), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 211/364 (57%), Gaps = 36/364 (9%)

Query: 19  IQLKKLPGLQEVAKHNPMQI----LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMN 74
           IQL  LP L E+  H   +     +LS++VALQLK MK+D  I++  F ++M  I+ Q+N
Sbjct: 10  IQLTHLPTLDEI-DHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQLN 66

Query: 75  DMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIER 134
           DM   LHRF+N+QRR  I+  D+ LFL+G  +    L  + + S+Y  KTY  EF ++  
Sbjct: 67  DMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHS 126

Query: 135 QSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILN-LVPPTNINNSYVPTWLPEFPPDHT 193
               L E +   + DE+    N +E      D++N LV P N    Y+P W+P FPPDHT
Sbjct: 127 ----LKETFTDAVVDED----NGSE------DVINELVRPNNPLIRYIPKWMPAFPPDHT 172

Query: 194 YKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETIAQTYKES- 252
           YKFT  YN+PI+DE  ++R + +EGK SE ALL++L +           +    +Y E+ 
Sbjct: 173 YKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNP---PTPSSDADGASYDEAL 229

Query: 253 -QEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKV 311
            +EET  IYG E Q+ R++NA    +         +      F+I+EYARSR+ +AR+KV
Sbjct: 230 VREETAAIYGNE-QKKRKKNASSSSDLL-------SKLPQTNFSIEEYARSRVEIARKKV 281

Query: 312 EEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQ 371
            E+E  +++ Q+NPFI+ S I     ++ K+ R+ A RE + +L+RS   ++KSIP+L+ 
Sbjct: 282 VEYEERQMKLQRNPFIKYSKIAL-SNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQM 340

Query: 372 LKAN 375
            K +
Sbjct: 341 TKQD 344

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  202 bits (514), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 206/363 (56%), Gaps = 38/363 (10%)

Query: 18  FIQLKKLPGLQEVAKHN--PMQI-LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMN 74
           +IQ+ KLP LQE+   +  P  + +L++SVALQLK M +   IT+  F+ ++Q ++ Q+N
Sbjct: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNA--QITQFAFDRLLQLVDGQLN 61

Query: 75  DMFQILHRFANIQRRNEISIKDLKLFLKG-----TGIEVQSLYDEFEKSRYIKKTYEAEF 129
           DM   LHR +N+QRR  I+  D+ + ++G     + IE+QS   EF   +Y K     EF
Sbjct: 62  DMISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFK-----EF 116

Query: 130 KNIE--RQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPE 187
            ++   R     +     P  D+E +  N +           LVPPTN    ++P WLP+
Sbjct: 117 NHLHSLRDLQSSLAHEMVPFEDQEAVRQNVSTV---------LVPPTNPLQDFLPKWLPD 167

Query: 188 FPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETIAQ 247
           FPPDHTYKFT  Y+ PI+DE  ++R + EE K SE AL ++      K    +D    +Q
Sbjct: 168 FPPDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHL----SQKKNPTDDIVNRSQ 223

Query: 248 TYKE-SQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGL 306
              E +++ET  IYG   Q  +R+  +   NS    DL L+      F+++EYA +RI +
Sbjct: 224 YDSELAEQETLAIYG--SQLKKRKTQHPQANSA---DL-LSKLPQTNFSVEEYAHNRIEV 277

Query: 307 ARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSI 366
           AR+KV EFE  +LQ+Q++PF++ S I     N  K T+K   REF + L+RS++ ++KSI
Sbjct: 278 ARKKVLEFEERQLQSQQDPFLKLSRIAFTQCN-DKFTKKQVHREFQLALQRSFIHLVKSI 336

Query: 367 PKL 369
           P+L
Sbjct: 337 PEL 339

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  196 bits (497), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 199/376 (52%), Gaps = 54/376 (14%)

Query: 15  AKEFIQLKKLPGLQEVAKHN---PMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEM 71
           A ++IQL +LP L E         ++ +L+++VALQLK+M  D SIT+  F ++M  +  
Sbjct: 5   ATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVG 64

Query: 72  QMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKN 131
           Q++DM   LHR +++QRRN ++  D+ ++L+G  +  + L ++ +KS+Y+ K Y+ ++++
Sbjct: 65  QIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYES 124

Query: 132 IER------------QSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNS 179
           + +            Q LDL  K            ++ A+          LVP +N    
Sbjct: 125 LTKIATTTTRTLSTYQKLDLTHK-----------DTSTAQ-------TSKLVPISNPLQK 166

Query: 180 YVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQ----AK 235
            +P+WLP+FPPD+TYKFT  YN PI+DE  ++R + EEGK SEKALLN+L   Q    ++
Sbjct: 167 LIPSWLPDFPPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISR 226

Query: 236 MLKVEDEETIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFN 295
            LK    E    T     EET   Y     R +   ++       N             N
Sbjct: 227 DLKFSSSEMELAT-----EETLATYSAITLRNKHLTSFFEKEPIQN-----------SLN 270

Query: 296 IQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILL 355
           ++EYAR+R+ + R+KV  +E  +LQ Q+NPF++ S + S   N  K ++  A  E    L
Sbjct: 271 VEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLISA-NNDNKVSKSVANTEIRKYL 329

Query: 356 RRSYVGVLKSIPKLRQ 371
           +RS +  + SIPK +Q
Sbjct: 330 KRSLLNFIHSIPKTQQ 345

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  190 bits (482), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 208/372 (55%), Gaps = 28/372 (7%)

Query: 16  KEFIQLKKLPGLQEVAKHN---PMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQ 72
           K+++QL KLP L E    +   PM+++L++++ALQLK M  D +IT+  F ++   ++ Q
Sbjct: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQ 102

Query: 73  MNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNI 132
           ++DM   + + A +QRR E++ KD+ L+L+G  ++   L    ++S YIK+ Y  E   +
Sbjct: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLL 162

Query: 133 ERQSLD------LVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLP 186
            R + D      + +K  K L+D+  L +            L LVP TN   + +P WLP
Sbjct: 163 NRLATDTNEVLTVFKKTDKTLKDDSTLET------------LKLVPITNTLENIIPDWLP 210

Query: 187 EFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQ---AKMLKVEDEE 243
            FPPD+TYKFT  +NK I+D   +++ +  EGK SEKALL++L S +   +K+L ++  +
Sbjct: 211 SFPPDYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFD 270

Query: 244 TIAQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSR 303
             +     ++ E   +Y       ++  A+         D   NS+ +K F+I++Y   R
Sbjct: 271 --SDDMDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNK-FDIEKYVHKR 327

Query: 304 IGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVL 363
           I + R KV+++E+ +L+ Q +PF++ +++ S   + +K +R+        +L+RS++ ++
Sbjct: 328 INIVRNKVKQYEDKQLRLQNDPFLKMTALLSEQTD-KKVSREVINTNIENVLKRSFLQLI 386

Query: 364 KSIPKLRQLKAN 375
            SIP L Q K +
Sbjct: 387 NSIPTLNQNKKD 398

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/334 (32%), Positives = 183/334 (54%), Gaps = 16/334 (4%)

Query: 39  LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLK 98
           LL++S+ALQLK +  +  +++L FN +   +  Q++ +   LHR + IQRRN  +  D++
Sbjct: 51  LLNKSIALQLKPL--NLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKTDIE 108

Query: 99  LFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHA 158
           L L+G  + +  L+ + + S ++K     ++  + + S  + +        + + +  H 
Sbjct: 109 LLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDS------SDTMANPGHD 162

Query: 159 EFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEG 218
                  +IL  + P N     +P WLP FPPDHTYKFT  +NKPI+D+  +K+ L EEG
Sbjct: 163 SMVNNPSNIL--IKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEG 220

Query: 219 KLSEKALLNMLGSAQAKMLKVEDEETIAQTYKESQEETQLIYGVEK-QRPRRENAYVGGN 277
           K SEK+LLN+L     +   +E+EET     + ++EE   IYG +   R +R+  ++   
Sbjct: 221 KKSEKSLLNLLNDI-TEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLISI 279

Query: 278 STNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYG 337
                +   +   SK FN+  YA  R+ L R++VEEFE  +L+ +KNPF+R S +     
Sbjct: 280 HDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMI---- 335

Query: 338 NAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQ 371
           N +K +R   + E    L+RSY  + ++ PKL+Q
Sbjct: 336 NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQ 369

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  161 bits (408), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 204/392 (52%), Gaps = 54/392 (13%)

Query: 6   KSSDGSTEGAKEFIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGF 62
           K+S+  T      +QL+ LP L E++      P+  +L ++V  QL ++  +  I+    
Sbjct: 4   KTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFAL 61

Query: 63  NNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIK 122
           + ++  + +QM+ MF+ LH    +QRR++ S  DLKL L+   ++  SLY +F+ S +IK
Sbjct: 62  DELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIK 121

Query: 123 KTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVP 182
             +  E++ +   S        +   ++EL   N+ E    ++++L  +PP+N     +P
Sbjct: 122 SKHSTEYEKLMSWSSLAALPHNEEDEEDEL---NNIEEQQNEINVL--LPPSNPLEKQIP 176

Query: 183 TWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNM--------LGSAQA 234
           +WLP FPPDHTYKFT  +N PI+D + +K+ + +E + SEKALLN+          S   
Sbjct: 177 SWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTP 236

Query: 235 KMLKVEDEETIAQTYKESQEETQLIYG--VEKQRPRRENAYVGGNSTNNDDLPLNSSHSK 292
           +   ++DE+ I Q  +        I+G  +E+++P         N               
Sbjct: 237 QPPGLDDEDAIEQQLE--------IWGNALEERKPTITEKSFNEN--------------- 273

Query: 293 GFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSIC----SPYGNAQKTTRKAAE 348
             NI++YA+ R+ LAR +V +FE ++L+  KNPF++ S       SP+  + KT +K  E
Sbjct: 274 --NIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPHQ-SHKTIQKTIE 330

Query: 349 REFNILLRRSYVGVLKSIPKLRQLKANEMAAA 380
            +F    R+S    + ++PK+++LK  ++  A
Sbjct: 331 LQF----RKSMTLFMHNLPKVQKLKKEKIRMA 358

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  159 bits (402), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/368 (29%), Positives = 188/368 (51%), Gaps = 27/368 (7%)

Query: 10  GSTEGAKE-FIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGFNNM 65
           GS  G +   +QL++LP L E++      P+  +L ++V  QL ++  +  I+    + +
Sbjct: 7   GSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFALDEL 64

Query: 66  MQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTY 125
           +  + +QM+ MF+ LH    +QRR+E S  DLKL  +   ++  SLY +F+ S +IK  +
Sbjct: 65  VNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNH 124

Query: 126 EAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWL 185
             E+  + R  L           DEE   SN  E   +  +I  L+PP+N     +P+WL
Sbjct: 125 AVEYGKLVR--LSSFPALAHNEEDEEDELSNIEE---QQSEINVLLPPSNPLEKLIPSWL 179

Query: 186 PEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETI 245
           P FPPDHTYKFT  +N PI+D + +K+ + +E + SEKALLN+      K L        
Sbjct: 180 PNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNL-----NKRL-------- 226

Query: 246 AQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIG 305
             ++  S   T     ++      +   + GN+       + ++     NI++YA+ R+ 
Sbjct: 227 --SHLSSASHTSPPPVLDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVE 284

Query: 306 LARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKS 365
           LAR +V +FE ++L+  KNPF++ S     +      + K  +   ++  R+S    + +
Sbjct: 285 LARERVAKFELNQLKRTKNPFLKLSETLY-FSEGPHQSHKTIQSAIDLQFRKSMTLFMHN 343

Query: 366 IPKLRQLK 373
           +PK+++LK
Sbjct: 344 LPKVQKLK 351

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  158 bits (400), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 136/439 (30%), Positives = 211/439 (48%), Gaps = 91/439 (20%)

Query: 28  QEVA-KHNPMQI--LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFA 84
           +E+A  H  MQI  LL +S+A+QLK  K DFS  +L FN +   ++ Q+N +   LHR +
Sbjct: 19  REIAHNHMDMQIEKLLQKSIAIQLKAFKVDFS--KLAFNQLTLLVDDQLNSLITELHRLS 76

Query: 85  NIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQ 144
            +QRRN ++  DL+L+++G  I    L  ++E S+YI++    +   I R   + V K +
Sbjct: 77  LLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQR 136

Query: 145 KPLRDEELLSSNH--AEFFFKDVDILN----LVPPTN----INNSYVPTWLPEFPPDHTY 194
             + +      N+   + F    D  +    L+ PTN    IN   + +WLP FPPDHTY
Sbjct: 137 THIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGIN---ISSWLPSFPPDHTY 193

Query: 195 KFTAIYNKPISDERQMKRMLFEEGKLSEKALLNML--------GSAQAKM---------- 236
           KFT  +N PI+DE+ +K+ L EEG  SEKALLN L        G++ A M          
Sbjct: 194 KFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSN 253

Query: 237 ----LKVEDEETIAQTYKESQ-----------------EETQLIYGVEKQ--RPRRENAY 273
                  ++EE  A+  KE +                 EET  IYG + Q     R+++ 
Sbjct: 254 EGPITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSS 313

Query: 274 VGGNSTNNDDLPLN----SSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRA 329
                + +D+  +N    SS  K F++ +Y+  R+ L R+KVE FEN KL+ +KNPF++ 
Sbjct: 314 KPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKL 373

Query: 330 SS-ICSPYGNAQKTT-------------------------RKAAEREFNIL--LRRSYVG 361
           S  +C    +                              RK A+    I+  L+RS+  
Sbjct: 374 SKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYS 433

Query: 362 VLKSIPKLRQLKANEMAAA 380
           +L + PKL++ K   +  A
Sbjct: 434 ILNNYPKLKKAKKQRVKLA 452

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  155 bits (393), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 111/378 (29%), Positives = 196/378 (51%), Gaps = 46/378 (12%)

Query: 16  KEFIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQ 72
           +  +QLK LP L E++      P+  +L ++V  QL ++  D  I+    + ++  + +Q
Sbjct: 14  RTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAVQ 71

Query: 73  MNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNI 132
           M+ MF+ LH  A +QRR+  +  DLKL  K   ++  SLY + + S +IK  +  E++ +
Sbjct: 72  MDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKL 131

Query: 133 ERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDH 192
              S        +   ++EL   N+ E    ++ +L  +PP+N     +P+WLP FPPDH
Sbjct: 132 VSSSSFSASSHNEEDEEDEL---NNIEEQQNEISVL--LPPSNPLEKLMPSWLPNFPPDH 186

Query: 193 TYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLG-------SAQAKMLKVEDEETI 245
           TY+FT  +N PI+D + +KR + +E K SEKALLN+         ++ A   ++ D+   
Sbjct: 187 TYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDD--- 243

Query: 246 AQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGF---NIQEYARS 302
                ++ E+   I+G   Q  +R                  ++ SK F   NI++YA+ 
Sbjct: 244 ----ADAGEQQLEIWGNALQEEKR------------------TAISKSFNENNIEQYAKY 281

Query: 303 RIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGV 362
           R+ LAR +V +FE ++L+  KNPF+R S       +  +  R A +R  ++  R+S +  
Sbjct: 282 RVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHR-AIQRAIDLQFRKSMMLF 340

Query: 363 LKSIPKLRQLKANEMAAA 380
             ++PK+++LK  ++  A
Sbjct: 341 AHNLPKVQKLKKEKIRMA 358

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  155 bits (392), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 104/370 (28%), Positives = 188/370 (50%), Gaps = 27/370 (7%)

Query: 14  GAKEFIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIE 70
            ++  +QL  LP L EV+      P+  +L +SV  QL ++  +  I+    + M+  + 
Sbjct: 12  ASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSL--NICISNFALDEMVNLVA 69

Query: 71  MQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFK 130
           +QM+ MF+ LH  A +QRR+++S  DLKL  +   +   SL+ + + S +IK  +  E++
Sbjct: 70  VQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYE 129

Query: 131 NIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPP 190
            + + S      +      E+           +  +I  L+PP+N     +P+WLP FPP
Sbjct: 130 KLVKSS-----SFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLPNFPP 184

Query: 191 DHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETIAQTYK 250
           DHTYKFT  +N PI+D + +KR + +E   SE+ALLN+      ++ ++           
Sbjct: 185 DHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNL----NKRLFRISSA-------- 232

Query: 251 ESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRK 310
            S   +  +        R E   + GN+ +     + +      NI++YA+ RI LAR +
Sbjct: 233 -SHTPSPRLPDASDASERLE---IWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARER 288

Query: 311 VEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLR 370
           V +FE ++L+  KNPF++ S     + N  + + K  +R  ++ LR+S    + ++PK++
Sbjct: 289 VSKFEVNQLKRTKNPFLKISESLYSFKNPHQ-SHKVIQRSIDLQLRKSVTLFMHNLPKVQ 347

Query: 371 QLKANEMAAA 380
           +LK  ++  A
Sbjct: 348 KLKKEKIQLA 357

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 166/347 (47%), Gaps = 66/347 (19%)

Query: 39  LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLK 98
           LL++S+ALQLK M  + SI+ + FN ++  +++Q+NDM   L R +  QRR  I+  DL 
Sbjct: 63  LLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASNDLS 122

Query: 99  LFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSS-NH 157
           L+L+   +    L    E+S +IK  +  ++        +L+ +    LRD    ++ N 
Sbjct: 123 LWLRSFNLNPSDLTLYLEESNFIKSKFNKDY--------NLLYEL---LRDYNTETNHNF 171

Query: 158 AEFFFKDVDILN----------LVPPTNINNSYVPTWLPEFPPDHTYKFTAIYNKPISDE 207
               +   D+LN          +VPP+N     +P WLP  PPDHTYKFT +YN+PI+DE
Sbjct: 172 KNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDE 231

Query: 208 RQMKRMLFEEGKLSEKALLNMLGSA-------------------------------QAKM 236
             MK++L  EGKL+E AL+ +L ++                                +  
Sbjct: 232 TVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMT 291

Query: 237 LKVEDEETIAQTYKE------SQEETQLIYG----VEKQRPRRENAYVGGNSTNNDDLPL 286
           LK   E     T +       +Q+ET+ IYG    V K + R E        T    L  
Sbjct: 292 LKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAET---QLSE 348

Query: 287 NSSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSIC 333
              +   FN++EYAR ++   R +V  +E  +LQAQKNPF + S + 
Sbjct: 349 EFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMI 395

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  128 bits (322), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 99/336 (29%), Positives = 166/336 (49%), Gaps = 49/336 (14%)

Query: 39  LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIK-DL 97
           LL +SVA++LK +     +    F+ ++  +++Q+ND+ + L R + +QRRN  + K D+
Sbjct: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88

Query: 98  KLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNH 157
            L LKG  +    L  E E S +IK+ Y  +               +K L ++ +  + H
Sbjct: 89  LLLLKGFNLSESELNTELEISNHIKRLYSED---------------EKKLSEDSIHYNQH 133

Query: 158 AEFFFK-DVDILNLVPPTNINNSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFE 216
            +F    +     L+ PTN     +P+W P  PPDHTYKFT  YN  I+D + +K+  F+
Sbjct: 134 TDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFD 193

Query: 217 EGKLSEKALLNMLGSAQAKMLK--VEDEETIAQTYKESQEETQLIYG-VEKQRPRRENAY 273
           E K  + AL N++   ++   +  +  +ET+A+       E+Q ++G VE++    +  Y
Sbjct: 194 ESKTVKTALFNLINKIESNEERNDLHYDETLAKL------ESQALFGTVEEKMNTNKKVY 247

Query: 274 VGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSIC 333
              NS     +P+       F+I+EY+  R+ +AR KV +FEN  L  + NPFI      
Sbjct: 248 KSLNSII---VPITK-----FDIEEYSHKRVNIARNKVSKFENKMLALKYNPFIN----- 294

Query: 334 SPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKL 369
               N Q   +          L RS+  ++ SIP+L
Sbjct: 295 --LINDQTDVKS--------YLNRSFQLMINSIPEL 320

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  103 bits (258), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 115/214 (53%), Gaps = 18/214 (8%)

Query: 36  MQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIK 95
           M  LL ++V +QL+T+  D ++T +  + ++ F E Q+N +   LHR + +QRR  I++ 
Sbjct: 34  MGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVS 93

Query: 96  DLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAE----FKNIE----------RQSLDLVE 141
           DL+++++G  +    LY   E+S++I++ Y  +    FK+I           R ++   E
Sbjct: 94  DLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVFKDINIDNPMESALGRINIQNKE 153

Query: 142 KWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNI----NNSYVPTWLPEFPPDHTYKFT 197
             +    D ++   +  E        +  +  T+     N  Y P WLP+FPPDHTYK+T
Sbjct: 154 NIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRNLRYKPGWLPDFPPDHTYKYT 213

Query: 198 AIYNKPISDERQMKRMLFEEGKLSEKALLNMLGS 231
             Y   +  E ++++ L EEG+LSEKAL+ ++ +
Sbjct: 214 PSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSN 247

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 53/90 (58%), Gaps = 6/90 (6%)

Query: 283 DLPLN-SSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQK 341
           DL  N +S  K F+++ YAR RI +ARRKV +FE  +L  + NP +R + +   Y +A++
Sbjct: 386 DLDSNPTSKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKM--KYYDAEE 443

Query: 342 TTRKAAEREFNILLRRSYVGVLKSIPKLRQ 371
           +     E E+   ++R+     ++IP +++
Sbjct: 444 SD---FETEYQKCIKRTMDRFKRNIPIIKE 470

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 82.4 bits (202), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 121/268 (45%), Gaps = 34/268 (12%)

Query: 76  MFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIER- 134
           M   LHR A +QRR   +  D+ L L+G     Q   ++ E+  Y+ K        + R 
Sbjct: 81  MVTELHRIATVQRRQHATHDDVALLLQG----FQLTPEDIEEQMYLSKKIGYNRMQVPRE 136

Query: 135 QSLDLVEKWQ-----KPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFP 189
           Q++ L +        K + +++L++S          D+   +P        +P WLP+ P
Sbjct: 137 QTVQLQDATGSYDRFKLVENQQLIASG-----LSGSDMSQELPIAE----KIPAWLPKLP 187

Query: 190 PDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDE---ETIA 246
           P+HTYKFT  YNK ++DE+ +K  + +E    E +L N++ +         DE   ET  
Sbjct: 188 PNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVDERARETPP 247

Query: 247 QTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGL 306
           +  K   +E   +YG  ++   R   + G  +     L L     K F++Q Y+  R+ L
Sbjct: 248 EELKRIDDEIVALYGPLEEIAER---HEGPRTKRRTPLYLK----KSFDVQAYSLGRVKL 300

Query: 307 ARRKVEEFENHKLQAQKNPFIRASSICS 334
           AR  V+ FE       +NPF     +CS
Sbjct: 301 ARNAVQRFEWETKYRPRNPF-----LCS 323

>NCAS0B05400 Chr2 complement(1008268..1008585) [318 bp, 105 aa] {ON}
           Anc_3.116 YOL086W-A
          Length = 105

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 47  QLKTMKSD---FSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKG 103
           +L+TM S     +++    N++M+   +Q++++   L RFA+   R  I+ +D+ LFL+ 
Sbjct: 31  ELQTMNSGSTRITVSNKFINSLMELCYLQLDNLGSDLERFAHHAGRETITQEDMMLFLRK 90

Query: 104 TGI 106
           T I
Sbjct: 91  TPI 93

>SAKL0E14388g Chr5 complement(1187853..1190663) [2811 bp, 936 aa]
           {ON} similar to uniprot|P32259 YNL236W Saccharomyces
           cerevisiae SIN4 involved in positive and negative
           regulation of transcription
          Length = 936

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 4/47 (8%)

Query: 220 LSEKALLNM---LGSAQAKMLKVEDEETIAQTY-KESQEETQLIYGV 262
           L+ + LLN    L S+Q ++L++ED + I++TY  +SQ E  +IYG+
Sbjct: 300 LNLQFLLNFSPDLISSQGEILELEDYQVISRTYDNDSQPEVLMIYGI 346

>SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 817

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 276 GNSTNNDDLPLNSSHSKGF----NIQEYARSRIGLARRKVEEFENHKLQ---AQKNPFIR 328
           G S   D+LPL +S   GF    N  + +R+ +   R +++  ENH L    AQK    R
Sbjct: 623 GKSKKQDELPLGTSKGYGFVCFKNPLDASRAMMATDRFQID--ENHTLYVSFAQK----R 676

Query: 329 ASSICSPYGNAQKTTRKAAEREFN 352
           A S+ +P  +AQ + + + +  F+
Sbjct: 677 AKSVSNPGSSAQYSKQHSRKGSFH 700

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,719,472
Number of extensions: 2109072
Number of successful extensions: 6313
Number of sequences better than 10.0: 76
Number of HSP's gapped: 6566
Number of HSP's successfully gapped: 78
Length of query: 520
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 406
Effective length of database: 40,409,475
Effective search space: 16406246850
Effective search space used: 16406246850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)