Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_46088.837ON40640616530.0
TDEL0B006008.837ON3694089491e-126
KAFR0B039008.837ON3794219441e-125
ABL129W8.837ON3452458841e-116
TPHA0I002208.837ON3774148201e-106
SAKL0D01540g8.837ON3652557688e-99
CAGL0M02937g8.837ON3732587575e-97
KLLA0D01859g8.837ON3712467166e-91
Kwal_27.102758.837ON3792667142e-90
ZYRO0G14124g8.837ON3692577081e-89
Kpol_1068.118.837ON3812587063e-89
NCAS0C004308.837ON3692527045e-89
KLTH0C03938g8.837ON3762466891e-86
NDAI0K004408.837ON4042546892e-86
Suva_13.4648.837ON3662626662e-83
Smik_13.4898.837ON3722516602e-82
TBLA0D032308.837ON3752456567e-82
Skud_13.4488.837ON3642486531e-81
YMR276W (DSK2)8.837ON3732516375e-79
KNAG0J002908.837ON3672665652e-68
TBLA0B032408.837ON2842531672e-12
Kpol_1036.628.311ON77511121e-06
TDEL0F043808.311ON77561093e-06
KLTH0C03410g1.480ON391591185e-06
SAKL0H15818g8.311ON77561076e-06
KLTH0G12540g8.311ON77561076e-06
ZYRO0D05962g8.311ON77451051e-05
CAGL0B01589g8.311ON77451041e-05
TPHA0C008908.311ON77711042e-05
Kwal_27.101521.480ON381591142e-05
TDEL0B022005.701ON128561062e-05
TDEL0G017504.16ON77561032e-05
Skud_9.205.701ON125561062e-05
Smik_11.3575.701ON125561062e-05
NDAI0E050305.701ON128561062e-05
NCAS0A032105.701ON128561062e-05
NCAS0G002405.701ON128561062e-05
SAKL0E14894g5.701ON128561062e-05
Smik_9.215.701ON124561062e-05
KLLA0A00616g5.701ON128561062e-05
Kpol_1043.695.701ON128561062e-05
TPHA0E002405.701ON128561062e-05
TPHA0D046005.701ON128561062e-05
TBLA0E021105.701ON128561062e-05
CAGL0G02475g5.701ON128561062e-05
KLTH0E01078g5.701ON128561063e-05
Kwal_YGOB_Anc_5.7015.701ON128561063e-05
KAFR0D022305.701ON128561063e-05
KAFR0H002205.701ON128561063e-05
Suva_11.3305.701ON128561063e-05
Skud_11.3335.701ON128561063e-05
YIL148W (RPL40A)5.701ON128561063e-05
YKR094C (RPL40B)5.701ON128561063e-05
AFR285C5.701ON128561053e-05
ZYRO0G06622g5.701ON128561053e-05
KNAG0L021205.701ON128561053e-05
NDAI0H002704.16ON77561013e-05
Ecym_40195.701ON128561053e-05
Suva_10.32singletonON6251994e-05
NCAS0B035208.311ON77451005e-05
NDAI0J010708.311ON7745988e-05
SAKL0D11814g1.480ON400671071e-04
AFR358W1.480ON413691061e-04
KNAG0J028804.16ON153711002e-04
Suva_9.405.701ON14456993e-04
Ecym_84084.16ON15371993e-04
Suva_10.34singletonON15156993e-04
TPHA0K022504.16ON15371993e-04
TPHA0C023908.386ON15071993e-04
KAFR0E005301.480ON379611033e-04
Ecym_41818.386ON15271984e-04
AGL128W8.386ON15271984e-04
ZYRO0C04026g8.386ON15271984e-04
NCAS0C029408.386ON15271984e-04
KLTH0F08734g8.386ON15056974e-04
Kwal_23.33118.386ON15056975e-04
KAFR0H020008.386ON15271975e-04
SAKL0H13926g8.386ON15471975e-04
KLLA0F17974g8.311ON7771926e-04
Kwal_55.206074.16ON231711006e-04
KLLA0D18304g8.386ON15056976e-04
KNAG0C065805.701ON14956976e-04
TBLA0G006704.16ON22971996e-04
NDAI0D049304.16ON22971996e-04
KAFR0I014704.16ON22971996e-04
YLR167W (RPS31)8.386ON15256976e-04
Suva_10.33singletonON254711006e-04
NDAI0G022808.386ON15256966e-04
KNAG0A027308.386ON15071967e-04
CAGL0G08173g8.386ON15271967e-04
TDEL0F051008.386ON15056967e-04
KLTH0E05852g4.16ON409561008e-04
Kpol_1030.58.386ON15256968e-04
Kpol_1024.168.386ON15256968e-04
SAKL0H25784g4.16ON30571998e-04
TBLA0H031808.386ON15256950.001
Suva_10.304.16ON38171990.001
Skud_12.294.16ON38171990.001
YLL039C (UBI4)4.16ON38171990.001
ACL062C4.16ON38271990.001
NDAI0G003301.480ON42758990.001
KLLA0E00749g4.16ON38171990.001
Kpol_1070.64.16ON533711000.001
ZYRO0G07854g4.16ON46071990.001
Smik_12.184.16ON46071990.001
NCAS0C058504.16ON38871990.001
CAGL0D05082g4.16ON53371990.001
NDAI0F003005.701ON18756960.001
Suva_10.2668.386ON15256940.001
Skud_12.2348.386ON15256940.001
Smik_12.2298.386ON15256940.001
Suva_5.321.480ON40967970.002
Skud_5.531.480ON39767950.003
Ecym_35721.480ON44369950.003
CAGL0L01309g1.480ON39258940.005
Smik_5.561.480ON39767940.005
YDR139C (RUB1)8.311ON7745850.005
ZYRO0F05192g1.480ON38458930.006
YEL037C (RAD23)1.480ON39867910.009
NCAS0B045908.142ON44742860.044
TBLA0B021601.480ON40471850.053
TPHA0O004401.480ON36959850.061
TBLA0D022108.142ON56338850.068
CAGL0L06028g8.142ON50538840.080
KLLA0E22133g1.480ON38358830.10
TDEL0B046908.142ON44258810.19
SAKL0H24772g8.142ON41443800.26
TDEL0C025901.480ON36858790.29
Kpol_541.508.142ON51138790.35
YGL181W (GTS1)8.142ON39638780.38
NDAI0B01850singletonON40344780.39
KAFR0I027801.480ON21470760.42
Smik_7.918.142ON39938780.44
NCAS0G041201.480ON39258760.70
Suva_7.818.142ON40138750.86
Kpol_370.61.480ON40458722.0
TPHA0H004008.142ON46638704.1
TBLA0C012001.369ON50347704.6
NCAS0C040908.142ON39653686.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4608
         (406 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   641   0.0  
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   370   e-126
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   368   e-125
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   345   e-116
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   320   e-106
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   300   8e-99
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   296   5e-97
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   280   6e-91
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   279   2e-90
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   277   1e-89
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   276   3e-89
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   275   5e-89
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   270   1e-86
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   270   2e-86
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   261   2e-83
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   258   2e-82
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   257   7e-82
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   256   1e-81
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   249   5e-79
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   222   2e-68
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    69   2e-12
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    48   1e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    47   3e-06
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    50   5e-06
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    46   6e-06
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    46   6e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    45   1e-05
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    45   1e-05
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    45   2e-05
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    49   2e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    45   2e-05
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    44   2e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     45   2e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    45   2e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    45   2e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    45   2e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    45   2e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    45   2e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     45   2e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    45   2e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    45   2e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    45   2e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    45   2e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    45   2e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    45   2e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    45   3e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    45   3e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    45   3e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    45   3e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    45   3e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    45   3e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    45   3e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    45   3e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    45   3e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    45   3e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    45   3e-05
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    44   3e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    45   3e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    43   4e-05
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    43   5e-05
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    42   8e-05
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    46   1e-04
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    45   1e-04
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    43   2e-04
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     43   3e-04
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    43   3e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    43   3e-04
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    43   3e-04
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    43   3e-04
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    44   3e-04
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    42   4e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    42   4e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    42   4e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    42   4e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    42   4e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    42   5e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    42   5e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    42   5e-04
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    40   6e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    43   6e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    42   6e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    42   6e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    43   6e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              43   6e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    43   6e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    42   6e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    43   6e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    42   6e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    42   7e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    42   7e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    42   7e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    43   8e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    42   8e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    42   8e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    43   8e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    41   0.001
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    43   0.001
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    43   0.001
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    43   0.001
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    43   0.001
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    43   0.001
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    43   0.001
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    43   0.001
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    43   0.001
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    43   0.001
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             43   0.001
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    43   0.001
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        42   0.001
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    41   0.001
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    41   0.001
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    41   0.001
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    42   0.002
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    41   0.003
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    41   0.003
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    41   0.005
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    41   0.005
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    37   0.005
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    40   0.006
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    40   0.009
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    38   0.044
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    37   0.053
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    37   0.061
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    37   0.068
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    37   0.080
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    37   0.10 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.19 
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    35   0.26 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    35   0.29 
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    35   0.35 
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    35   0.38 
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    35   0.39 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    34   0.42 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    35   0.44 
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    34   0.70 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    33   0.86 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    32   2.0  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    32   4.1  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    32   4.6  
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     31   6.5  

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/406 (80%), Positives = 328/406 (80%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KIADGHSIHLVR                           RNSTAGSGSTVPNNITAGQMG
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQSTNDF 240
           QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQSTNDF
Sbjct: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQSTNDF 240

Query: 241 PAPGSANNSATTSGDXXXXXXXXXXXXXXXXXXXXXXXLFNAQSNXXXXXXXXXXNSGPX 300
           PAPGSANNSATTSGD                       LFNAQSN          NSGP 
Sbjct: 241 PAPGSANNSATTSGDNATLTSTGTGTNTNAAAANPLTSLFNAQSNPFAAMFAPPANSGPN 300

Query: 301 XXXXXXXXXXXXXXXXXFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRP 360
                            FGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRP
Sbjct: 301 PGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRP 360

Query: 361 PEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406
           PEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV
Sbjct: 361 PEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  370 bits (949), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 202/408 (49%), Positives = 255/408 (62%), Gaps = 41/408 (10%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSI++ VK GQ+KW+VS +P  ++   K  IA+VS IPA NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KI DGH+IHLV+                            N+ A   +TVP+NI +GQ G
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQES---------NTAAPGSATVPSNIASGQTG 111

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPL+DLT ARYAG+ NLPS DMFGPDGGL +   Q+++LGML+NPIFQSQ+NEML+NP
Sbjct: 112 GFNPLSDLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNP 171

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQ--MDMGAANGQSTN 238
           QM+DF+IQ +P LQAMGP AR++LQSPFFRQM+TNP ++RQ  +F   M+    N  +  
Sbjct: 172 QMVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAA 231

Query: 239 DFPAPGSANNSATTSGDXXXXXXXXXXXXXXXXXXXXXXXLFNAQSNXXXXXXXXXXNSG 298
            FPAPG +   A+++ +                       +FN  SN          N G
Sbjct: 232 SFPAPGDSTTEASST-EANTDANANTNANANTNAANPFAAMFNPGSN---PLASMFGNQG 287

Query: 299 PXXXXXXXXXXXXXXXXXXFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTEDN 358
                                AD+QQ        P DP+ML++LL GG  A  ++  +DN
Sbjct: 288 VG------------------AADNQQNQ------PFDPSMLASLLGGG--AAQQRAEQDN 321

Query: 359 RPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406
           RPPEERY+QQL QLN+MGF DF++NVAALRRSGGSVQGAL++LLNGDV
Sbjct: 322 RPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  368 bits (944), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/421 (50%), Positives = 252/421 (59%), Gaps = 57/421 (13%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSI++H+KSGQNKW V+ + S SI TLK+ I+++S IPA NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KI +GHSIHLV+                                 S  +VP+NI +GQ G
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSN--------ENTNSAPSVPSNIASGQTG 112

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPL DLT ARYAGY N+PS DMFGPDGGLNS   Q+++L MLDNP+FQSQ+NEML+NP
Sbjct: 113 GFNPLNDLTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNP 172

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMG-----AANGQ 235
           QMIDF+IQ +P LQAMGP AR+MLQSP FRQM+ NPD+IRQ  +F   M      AA G 
Sbjct: 173 QMIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGN 232

Query: 236 STNDFPAPGSA-------NNSATTSGDXXXXXXXXXXXXXXXXXXXXXXXLFNAQSNXXX 288
             + FPAPG A       N +A+                           LFN  +N   
Sbjct: 233 DPSAFPAPGEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFG 292

Query: 289 XXXXXXXNSGPXXXXXXXXXXXXXXXXXXFGADSQQPSRGFSLPPLDPAMLSALLSGGFT 348
                   S P                       QQP+        DPA+L+++L  G  
Sbjct: 293 AMSSNTNGSQP-----------------------QQPA-------FDPALLASML--GMP 320

Query: 349 ATGRQQT---EDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGD 405
            +  QQT   +DNRPPEERY+ QL QLN+MGF DFDRNVAALRRSGGSVQGAL+ALLNGD
Sbjct: 321 QS--QQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGD 378

Query: 406 V 406
           V
Sbjct: 379 V 379

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 190/245 (77%), Gaps = 11/245 (4%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M+I + VKSGQN+W+VS + S S+G LKQ IA+VS IPAENQRLIYSGKILKDDQTVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KIADGH+IHLV+                               A     VP++I+AGQ G
Sbjct: 61  KIADGHAIHLVK-----------SGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSG 109

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPLADLTGARYAGY NLPSTDMFGPDGGLNSA+GQEEI+GML+NPIFQSQ+NEML NP
Sbjct: 110 GFNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNP 169

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQSTNDF 240
           QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQM+TNPD+IRQ+SR QM MG A  +   DF
Sbjct: 170 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMGGAGAEQGTDF 229

Query: 241 PAPGS 245
           PAPGS
Sbjct: 230 PAPGS 234

 Score =  114 bits (286), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 63/80 (78%), Gaps = 3/80 (3%)

Query: 327 RGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAA 386
           RG ++PPLDPAMLS+L              DNRPPEERY+QQL QLN+MGF DFDRNVAA
Sbjct: 269 RGLAMPPLDPAMLSSLFG---AGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAA 325

Query: 387 LRRSGGSVQGALNALLNGDV 406
           LRR+GGSVQGAL+ALLNGDV
Sbjct: 326 LRRAGGSVQGALDALLNGDV 345

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/414 (45%), Positives = 235/414 (56%), Gaps = 45/414 (10%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSIS+ +KSGQNKW V+ +PS++I   K+ I++ S IPA NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KI DGHSIHLV+                             +   + S VP NIT+GQ  
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATA--------NAAAGSAESAVPTNITSGQTN 112

Query: 121 GFNPLADLTGARYAGY-ANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLAN 179
           GFNPLADLT ARYAGY   +PS DMFGPDGG+ +   Q+++L ML+NP+FQSQ+NEML+N
Sbjct: 113 GFNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSN 172

Query: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQST-- 237
           PQM++++I  +P LQA+GP AREM QSPFFRQM+TNPD+IRQ       MG         
Sbjct: 173 PQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGG 232

Query: 238 ----NDFPAPGSANNSATTSGDXXXXXXXXXXXXXXXXXXXXXXXLFNAQSNXXXXXXXX 293
               + FPAPG  +  + T+ D                       LFN   N        
Sbjct: 233 LNGDSSFPAPGETSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMN-------- 284

Query: 294 XXNSGPXXXXXXXXXXXXXXXXXXFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQ 353
                                    GA       GF     +P+ML+++L        RQ
Sbjct: 285 -----------PFAGLGNPAAAGSTGAPGTPQYPGF-----NPSMLASMLQ-----QPRQ 323

Query: 354 QT-EDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406
              ED RPPE RY+ QL QLN+MGF +FDRN+AALRRSGGSVQGAL+ALLN DV
Sbjct: 324 PAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  300 bits (768), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 186/255 (72%), Gaps = 12/255 (4%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSI+LH+KSGQNKW VS +P++++  LK+ I++VS IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KIAD H++HLVR                            ++ A + + VP+NI++GQ G
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSAT-----------DTGAAAAAAVPSNISSGQTG 109

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPLADLTGARYAGYANLPS DMFGPDGGL +A   +EIL MLDNPI QSQ+NEML+NP
Sbjct: 110 GFNPLADLTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNP 169

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF-QMDMGAANGQSTND 239
           QM+DF+IQQ+P LQAMGP ARE+LQS +FRQMMTNPD+IRQ  +F +M        +   
Sbjct: 170 QMVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAGGA 229

Query: 240 FPAPGSANNSATTSG 254
           FPAPG+A  +A+T G
Sbjct: 230 FPAPGTATQTASTEG 244

 Score =  109 bits (272), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/76 (73%), Positives = 63/76 (82%), Gaps = 1/76 (1%)

Query: 332 PPLDPAMLSALLSGGFTATGRQQTE-DNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRS 390
           P  DP++LS+ L G   A G+QQ   DNRPPEERY+QQL QLN+MGF DFDRNVAALRRS
Sbjct: 290 PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 349

Query: 391 GGSVQGALNALLNGDV 406
           GGSVQGAL+ALLNGDV
Sbjct: 350 GGSVQGALDALLNGDV 365

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  296 bits (757), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 149/258 (57%), Positives = 182/258 (70%), Gaps = 19/258 (7%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSI++H+KSGQNKW VS DPS +I  LK+ IA+VS IP+ NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
            I D H+IH+V+                             S+  S + VP+NI +GQ G
Sbjct: 61  NIKDDHAIHMVKSGGNASTSNAPTNA-------------NESSNSSTTAVPSNIASGQTG 107

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPLADLTGARYAGYANLPS DMFGPDGG+N+A  Q+E+L M++NPIFQSQ+NEML+NP
Sbjct: 108 GFNPLADLTGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNP 167

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF------QMDMGAANG 234
           +M+DF+IQ +P LQAMGP AR+MLQSPFFRQM+TNP +IRQ  +F      Q  M  A+ 
Sbjct: 168 EMLDFMIQSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADA 227

Query: 235 QSTNDFPAPGSANNSATT 252
              + FPAPG  +   TT
Sbjct: 228 TDASAFPAPGGDDTETTT 245

 Score =  113 bits (282), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 66/86 (76%), Gaps = 3/86 (3%)

Query: 321 DSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDF 380
           ++QQ   G   P  DP +L++LL G   A  +   EDNRPPEERY+QQL QLN+MGF DF
Sbjct: 291 NNQQGGAGVQQPAFDPTLLASLLGGQLPAPAQ---EDNRPPEERYEQQLRQLNDMGFFDF 347

Query: 381 DRNVAALRRSGGSVQGALNALLNGDV 406
           DRNVAALRRSGGSVQGAL+ALLNGDV
Sbjct: 348 DRNVAALRRSGGSVQGALDALLNGDV 373

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  280 bits (716), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 144/246 (58%), Positives = 175/246 (71%), Gaps = 13/246 (5%)

Query: 3   ISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKI 62
           IS+HVKSGQN W V  + +++I   K+ I+ VS +PA+NQRLIYSGKILKD +TVESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  ADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMGGF 122
            DGHS+H+V+                             S A + S  P+NI+AGQ GGF
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGS-----------AASPAATNSAAPSNISAGQTGGF 112

Query: 123 NPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQ--EEILGMLDNPIFQSQVNEMLANP 180
           NPLADLTGARYAG ANLPS DMFGPDGGLNS+ G   E +L ML+NPIFQSQ+NEML+NP
Sbjct: 113 NPLADLTGARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNP 172

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQSTNDF 240
           QM+DFLIQQ+P LQA+GP AR+MLQSPFFRQMMT+P +IRQ  +    MG +   + + F
Sbjct: 173 QMVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPDGAASAF 232

Query: 241 PAPGSA 246
           PAPGSA
Sbjct: 233 PAPGSA 238

 Score =  103 bits (256), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%)

Query: 332 PPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSG 391
           P  +  +L+++  G   ATG     DNRPPEERY+ QL QLN+MGF DFDRNVAALRR+G
Sbjct: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356

Query: 392 GSVQGALNALLNGDV 406
           GSVQGAL+ALLNGDV
Sbjct: 357 GSVQGALDALLNGDV 371

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  279 bits (714), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 146/266 (54%), Positives = 175/266 (65%), Gaps = 34/266 (12%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSI++HVKSGQ+KW VS D  S++   K  IAE S I  ENQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITA---- 116
           KI DGH++HLV+                                GSGST P N  +    
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAI-------------------GAPGSGSTAPTNTASSGAA 101

Query: 117 --------GQMGGFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPI 168
                   GQ GGFNPL+DLT ARYAGY NLPS D FGPDGG+ SA   +++L ML+NP+
Sbjct: 102 AAPASLSSGQAGGFNPLSDLTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPV 161

Query: 169 FQSQVNEMLANPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMD 228
            QSQ+NEML+NPQMIDFLIQQ P LQ+MGP AR+MLQSPFFRQMMTNP++IRQ  +F   
Sbjct: 162 MQSQMNEMLSNPQMIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGV 221

Query: 229 MGAANGQS---TNDFPAPGSANNSAT 251
           +G A   S    N FPAPG+A++ A+
Sbjct: 222 LGGAGDPSAAGANAFPAPGTADSDAS 247

 Score =  115 bits (289), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/84 (72%), Positives = 66/84 (78%), Gaps = 2/84 (2%)

Query: 323 QQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDR 382
           Q P  G  LP  DPAMLSALL GG      QQ +D RPPEERY+QQL QLN+MGF +FDR
Sbjct: 298 QAPGAG-GLPAFDPAMLSALL-GGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDR 355

Query: 383 NVAALRRSGGSVQGALNALLNGDV 406
           NVAALRRSGGSVQGAL+ALLNGDV
Sbjct: 356 NVAALRRSGGSVQGALDALLNGDV 379

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  277 bits (708), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 176/257 (68%), Gaps = 5/257 (1%)

Query: 2   SISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
           +I++ +KSGQNKW+V+ DP S++ T K+ I++VS IPA +QRLIYSGKILKDDQT++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IADGHSIHLVRXXXX---XXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQ 118
           + DGHS+HLV+                               N++    +  P+N++AGQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 119 MGGFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLA 178
            GGFNPLADLT ARYAG+ +LPS DMFGPDGG  +   QE++L MLDNPIFQSQ+NEML+
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANGQS 236
           NPQM+DF+IQ +P LQAMGP AR+M QSPFFRQM+TNP +IRQ  +F   M+ G     +
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242

Query: 237 TNDFPAPGSANNSATTS 253
            N FPAPG+ N    ++
Sbjct: 243 ANAFPAPGNENTEGESA 259

 Score =  103 bits (257), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 3/72 (4%)

Query: 335 DPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSV 394
           DP +L+++L      + +QQ +DNRPPEERY+ QL QLNEMGF DFDRNVAALRRSGGSV
Sbjct: 301 DPQLLASMLGA---PSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSV 357

Query: 395 QGALNALLNGDV 406
           QGAL++LLNGDV
Sbjct: 358 QGALDSLLNGDV 369

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  276 bits (706), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 178/258 (68%), Gaps = 15/258 (5%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +H+KSGQNKW+V+ D S+++  LK+ IA+VS IP ENQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KI D HSIHLV+                             + + S + +P+NI AGQ G
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTS--------TATNSDSNAPLPSNIAAGQSG 112

Query: 121 GFNPLADLTGARYAGYA-NLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLAN 179
           GFNPL+DLT ARYAGY  NLPS DMFGPDGG+NS   Q+++L ML+NP+FQSQ+NEML+N
Sbjct: 113 GFNPLSDLTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSN 172

Query: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQ---- 235
           PQMIDF+IQ +P LQAMGP AR+M QSPFFRQM+TNP++IRQ  +    MG  NGQ    
Sbjct: 173 PQMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMG-GNGQFGAN 231

Query: 236 -STNDFPAPGSANNSATT 252
            + + FPAPG  + +A  
Sbjct: 232 AAASSFPAPGETDTTAAA 249

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/75 (62%), Positives = 58/75 (77%), Gaps = 3/75 (4%)

Query: 332 PPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSG 391
           P  DP++ +++         +QQ +DNRPPEERY+ QL QLN+MGF DFDRNVAALRRSG
Sbjct: 310 PAFDPSLFASMFQ---PPQQQQQEQDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSG 366

Query: 392 GSVQGALNALLNGDV 406
           GSVQGAL+ALL+ DV
Sbjct: 367 GSVQGALDALLSNDV 381

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  275 bits (704), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 146/252 (57%), Positives = 177/252 (70%), Gaps = 23/252 (9%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSIS+HVKSGQN WQVS DP+S+I  LK+ IA+VS +PA NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KI DG SIH+V+                            N+TA   + V  N+ AG+ G
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQA------------NTTA---TPVAPNMAAGETG 105

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLN-SAIGQEEILGMLDNPIFQSQVNEMLAN 179
           GFNPL+DLT ARYAGY NLPS D FGPDGGLN S   Q+E+L MLDNP+FQSQ+NEML+N
Sbjct: 106 GFNPLSDLTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSN 165

Query: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGA-----ANG 234
           PQM+DF+IQ +P LQAMGP AR++LQ+P FRQM+TNPD+IRQ  +    M        NG
Sbjct: 166 PQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNG 225

Query: 235 Q--STNDFPAPG 244
           Q  +++DFPAPG
Sbjct: 226 QANTSSDFPAPG 237

 Score = 95.1 bits (235), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 47/75 (62%), Positives = 56/75 (74%), Gaps = 3/75 (4%)

Query: 332 PPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSG 391
           P  DP+  +++         +QQ ED RPPEERY+ QL QLN+MGF DFDRNVAALRRSG
Sbjct: 298 PAFDPSFFASMFQ---PPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSG 354

Query: 392 GSVQGALNALLNGDV 406
           G+V+ ALNALLNGDV
Sbjct: 355 GNVESALNALLNGDV 369

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  270 bits (689), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 165/246 (67%), Gaps = 2/246 (0%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MSI++H+KSGQNKW V+ DPSS+I   K  IA  S I  ENQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KI D HS+HLV+                               A    + P N++ GQ  
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATS-TPAAQPQQSAPANLSTGQGN 119

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPL+DLT ARYAG+ NLPS D FGPDGG+ SA   +++L ML+NP+ QSQ+NEML+NP
Sbjct: 120 GFNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNP 179

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF-QMDMGAANGQSTND 239
           QMIDFLIQQ P LQ+MGP AR +LQSPFFRQMMTNPD+IRQ  +F  M  G +     + 
Sbjct: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLGGDSAAGGGSS 239

Query: 240 FPAPGS 245
           FPAPG+
Sbjct: 240 FPAPGT 245

 Score =  107 bits (268), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/75 (70%), Positives = 61/75 (81%), Gaps = 2/75 (2%)

Query: 332 PPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSG 391
           P LDP +LS++L G   A   QQ +D RPPEERY+ QL QLN+MGF +FDRNVAALRRSG
Sbjct: 304 PALDPMVLSSILGGAGAA--NQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSG 361

Query: 392 GSVQGALNALLNGDV 406
           GSVQGAL+ALLNGDV
Sbjct: 362 GSVQGALDALLNGDV 376

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  270 bits (689), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 149/254 (58%), Positives = 171/254 (67%), Gaps = 26/254 (10%)

Query: 2   SISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
           +IS+H+KSGQN WQVS D ++SI TLK  IA+VS IPA NQRLIYSGKILKDDQ V+ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMGG 121
           I DGHS+HLVR                             +T  S +TVP+NI+AGQ GG
Sbjct: 63  IQDGHSVHLVRSGKKSTPTPATT---------------NTTTNASNNTVPSNISAGQTGG 107

Query: 122 FNPLADLTGARYAGY-ANLPSTDMFGPDGGLN-SAIGQEEILGMLDNPIFQSQVNEMLAN 179
           FNPLADLT ARYAGY  NLPS D FGPDGG+N S    +E L MLDNPI QSQ+NEML+N
Sbjct: 108 FNPLADLTSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSN 167

Query: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANGQST 237
           PQMIDF+IQ +P LQAMGP AR+M QSP FRQM+TNPD+IRQ  +    M MG     ST
Sbjct: 168 PQMIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGST 227

Query: 238 N-------DFPAPG 244
           N        FPAPG
Sbjct: 228 NATDNAASSFPAPG 241

 Score =  108 bits (269), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (77%)

Query: 330 SLPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRR 389
           +LPP DP+M ++L  G    +   Q +D RPPEERY+ QL QLN+MGF DFDRN+AALRR
Sbjct: 328 TLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRR 387

Query: 390 SGGSVQGALNALLNGDV 406
           +GGSV+ A+NALLNGDV
Sbjct: 388 TGGSVEAAVNALLNGDV 404

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  261 bits (666), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 175/262 (66%), Gaps = 17/262 (6%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MS++++VKSGQ+KW+VS  P S++   K+ I+E + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
            I DGHS+HLV+                            ++T  S S  P N+++GQ  
Sbjct: 61  HIQDGHSVHLVK---------SQPRPQAGAATGAGGDAGASATNASVSATP-NMSSGQSA 110

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL--NSAIGQEEILGMLDNPIFQSQVNEMLA 178
           GFNPLADLT ARYAGY N+PS DMFGPDGG   N +  Q+E+L M+DNPIFQSQ+NEML+
Sbjct: 111 GFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLS 170

Query: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMG-----AAN 233
           NPQM+DF+IQ +P LQAMGP AR+MLQSP FRQM+TNPD+IRQ  +F   M       + 
Sbjct: 171 NPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSA 230

Query: 234 GQSTNDFPAPGSANNSATTSGD 255
           G + + FPAPG      TT  D
Sbjct: 231 GGAASAFPAPGGDAPEETTDTD 252

 Score =  106 bits (264), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (78%)

Query: 331 LPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRS 390
           +P  DPA+L+++      A    Q ED RPPEERY+QQL QLN+MGF DFDRNVAALRRS
Sbjct: 291 MPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 350

Query: 391 GGSVQGALNALLNGDV 406
           GGSVQGAL++LLNGDV
Sbjct: 351 GGSVQGALDSLLNGDV 366

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  258 bits (660), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 172/251 (68%), Gaps = 18/251 (7%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MS+++H+KSGQ+KW+VS  P S++   K+ I++ + +P  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
            I DGHS+HLV+                             + A +G+    N+++GQ  
Sbjct: 61  HIQDGHSVHLVK-----------SQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSA 109

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL--NSAIGQEEILGMLDNPIFQSQVNEMLA 178
           GFNPLADLT ARYAGY N+PS DMFGPDGG   N +  Q+E+L M++NPIFQSQ+NEML+
Sbjct: 110 GFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLS 169

Query: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANGQS 236
           NPQM+DF+IQ +P LQAMGP AR+MLQSP FRQM+TNPD+IRQ  +F   MD  A  G +
Sbjct: 170 NPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGST 229

Query: 237 ---TNDFPAPG 244
               + FPAPG
Sbjct: 230 GGAASAFPAPG 240

 Score =  106 bits (264), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 60/79 (75%)

Query: 328 GFSLPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAAL 387
           G  +P  DPA+L+++      +    Q ED RPPEERY+ QL QLN+MGF DFDRNVAAL
Sbjct: 294 GTGMPAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAAL 353

Query: 388 RRSGGSVQGALNALLNGDV 406
           RRSGGSVQGAL++LLNGDV
Sbjct: 354 RRSGGSVQGALDSLLNGDV 372

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  257 bits (656), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 165/245 (67%), Gaps = 12/245 (4%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M+IS+H+KSGQN W V  + SS+I   K +IA VS IPA NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
           KI DGHSIH+V+                           +N+   SG      ++ G+  
Sbjct: 61  KIQDGHSIHMVK-----SGAHATASSTTNSMTTTNTTAPQNNNGSSG------MSTGRGS 109

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180
           GFNPL+DLT ARYAGY NLPS DMFGPDGG  ++  Q+++L ML+NP+FQSQ+NEML+NP
Sbjct: 110 GFNPLSDLTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNP 169

Query: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF-QMDMGAANGQSTND 239
           +++DFLI  +P LQ++GP AR M QSP FRQM+TNPD+IRQ  R  QM  G     S + 
Sbjct: 170 EIVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASS 229

Query: 240 FPAPG 244
           FPAPG
Sbjct: 230 FPAPG 234

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%)

Query: 353 QQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALL 402
           Q+ EDNRPPEERY+ QL QLN+MGF DFD+NVAALRRSGGSVQGA+NALL
Sbjct: 323 QEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  256 bits (653), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 172/248 (69%), Gaps = 16/248 (6%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MS+++H+KSGQ+KW+V+  P  ++   K+ I++ + IP  NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
            I DGHS+HLV+                             ++A  G++   N+++GQ  
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNA-----------TATSAAVGTSATPNMSSGQSA 109

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL--NSAIGQEEILGMLDNPIFQSQVNEMLA 178
           GFNPLADLT ARYAGY N+PS DMFGPDGG   N +  Q+E+L M++NPIFQSQ+NEML+
Sbjct: 110 GFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLS 169

Query: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANGQS 236
           NPQM+DF+IQ +P LQAMGP AR+MLQSP FRQM+TNP+++RQ  +F   MD  A N  +
Sbjct: 170 NPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAA 229

Query: 237 TNDFPAPG 244
           +  FPAPG
Sbjct: 230 S-AFPAPG 236

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (78%)

Query: 331 LPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRS 390
           +P  DPA+L+++      +    Q ED+RPPEERY+ QL QLN+MGF DFDRNVAALRRS
Sbjct: 289 MPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 348

Query: 391 GGSVQGALNALLNGDV 406
           GGSVQGAL++LLNGDV
Sbjct: 349 GGSVQGALDSLLNGDV 364

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  249 bits (637), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 170/251 (67%), Gaps = 18/251 (7%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           MS+++H+KSGQ+KW+V+  P S++   K+ I + + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMG 120
            I DGHS+HLV+                             + A +G+    N+++GQ  
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATA-----------TGAAAGTGATPNMSSGQSA 109

Query: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL--NSAIGQEEILGMLDNPIFQSQVNEMLA 178
           GFNPLADLT ARYAGY N+PS DMFGPDGG   N +  Q+E+L M++NPIFQSQ+NEML+
Sbjct: 110 GFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLS 169

Query: 179 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDM-----GAAN 233
           NPQM+DF+IQ +P LQAMGP AR+MLQSP FRQM+TNPD+IRQ  +F   M       + 
Sbjct: 170 NPQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSA 229

Query: 234 GQSTNDFPAPG 244
           G + + FPAPG
Sbjct: 230 GGAASAFPAPG 240

 Score =  104 bits (259), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/76 (65%), Positives = 60/76 (78%), Gaps = 3/76 (3%)

Query: 331 LPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRS 390
           +P  DPA+L+++      A+   Q ED RPPEERY+ QL QLN+MGF DFDRNVAALRRS
Sbjct: 301 MPAFDPALLASMFQPPVQAS---QAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 357

Query: 391 GGSVQGALNALLNGDV 406
           GGSVQGAL++LLNGDV
Sbjct: 358 GGSVQGALDSLLNGDV 373

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  222 bits (565), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 167/266 (62%), Gaps = 23/266 (8%)

Query: 1   MSISLHVKSGQNKWQVS--ADP-SSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTV 57
           M I++ VK GQN+W V+  ++P  +++   K+ +A V+ +P ENQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKIADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAG 117
           E YKI DGH++HLV+                              TAG+      ++ AG
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATT---------AAGTAGTAPAAGASMAAG 111

Query: 118 QMGGFNPLADLTGARYAGY-ANLPSTDMFGPDGGLNSAIGQ------EEILGMLDNPIFQ 170
           Q  GFNPLADLT ARYAGY   +PS DMFGPDGGL S  G       EEIL ML+NPIFQ
Sbjct: 112 QQPGFNPLADLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQ 171

Query: 171 SQVNEMLANPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF----Q 226
           SQ+NEM +NPQM+DFLIQ +P LQAMGP AREMLQSP FRQM+TNPD++RQ  +F    Q
Sbjct: 172 SQMNEMFSNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQ 231

Query: 227 MDMGAANGQSTNDFPAPGSANNSATT 252
                A G   N FPAPG  +  A T
Sbjct: 232 GSGAGAGGADPNAFPAPGGDDTGAPT 257

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (78%), Gaps = 1/70 (1%)

Query: 337 AMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQG 396
           A + A+   G TA      +D RPPEERY+QQL QLN+MGF DFDRNVAALRR+GGS+QG
Sbjct: 299 AFMQAMSRNGATAPAAA-PQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQG 357

Query: 397 ALNALLNGDV 406
           AL+ALLNGDV
Sbjct: 358 ALDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 116/253 (45%), Gaps = 26/253 (10%)

Query: 3   ISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKI 62
           IS+++K  + K+ + ++    I  +  +I +   IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  ADGHSIHLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXRNSTAGSGSTVPNNITAGQMGGF 122
            DGH I ++                             NS   + +T  N+ T    G  
Sbjct: 62  KDGHCIIVI-------IHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNI 114

Query: 123 NPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANPQ- 181
             +   +   Y   +N    ++  P+        + E+L +LD+P    Q NEML N Q 
Sbjct: 115 ITITTTSPDPYGVRSN----EVHDPE-------VERELLQVLDHP-RSFQENEMLLNNQN 162

Query: 182 MIDFLIQQHPHLQAMGP-AAREMLQSPFFRQMMTNPDVI-RQVSRFQMDMGAANGQSTND 239
           ++ FLIQ +PHL+ M    AR++L+ P  ++   + + + +Q+S  +  +  AN    N 
Sbjct: 163 LLRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHAN----NG 218

Query: 240 FPAPGSANNSATT 252
              PGS+N + T 
Sbjct: 219 ITHPGSSNETITV 231

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 32/51 (62%)

Query: 21 SSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          S  +  +K+ + E   IP   QRLI+ GK + D+QTV+S K+ DG  +HLV
Sbjct: 20 SDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          V     + I  +KQ + E   IP   QRLI+ GK + D QT+E+ K+ DG  +HLV
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 13 KWQVSA---DPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          K QV A   D  S+I   KQR+AE         +LIYSGKIL+DD+T+  YK+ DG  +
Sbjct: 10 KKQVLALELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +S +    +  +K+ + E   IP   QRLI+ GK ++DDQTV+S  ++ G  +HLV
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          V  DP   +  +K+ + E   IP   QRLI+ GK + DD++V S  ++ G  +HLV
Sbjct: 15 VVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSANLSSGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 28/45 (62%)

Query: 27 LKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +K+ + E   IP   QRLI+ GK + D QTV S K+ DG  +HLV
Sbjct: 26 IKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 30/45 (66%)

Query: 27 LKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +K+ + E   IPA  QRLI+ GK + +D T+ + K++DG  +HLV
Sbjct: 26 IKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+ +  +    S  +  +K  + E   IP   QRLI+ GK + D+QTVES 
Sbjct: 1  MQIKVKTLTGK-EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 KIADGHSIHLV 71
           + DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 13 KWQVSA---DPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          K QV A   + SS++   KQ++AE         +LIYSGKIL+DD+T+  YK+ DG  +
Sbjct: 10 KKQVLALELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 11 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 32/51 (62%)

Query: 21 SSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 6  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 27 LKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +K+ + E   IP   QRLI+ GK + D+QTV S  + DG  +HLV
Sbjct: 26 IKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 27 LKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +K+ + E   IP   QRLI+ GK + D+Q+V S  + DG  +HLV
Sbjct: 26 IKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 3  ISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
          I+++ K   + K  +  DP+S++   KQ++A       +  +LI+SGK+L+D +T+E  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 IADGHSI 68
          + DG  +
Sbjct: 62 LKDGDQV 68

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 1  MSISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVES 59
          M+I++H K   + +  +   PS++I   KQ +A          ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIADGHSI 68
           K+ DG  +
Sbjct: 61 CKLKDGDQV 69

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16  VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
           +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%)

Query: 11 QNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHL 70
          + K  V  + SS+I   K ++A +     +  +LI+SGK+LKDDQTV S  + D   + +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 71 V 71
          +
Sbjct: 70 M 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 3  ISLHVKSGQNKWQVSADPSSS--IGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          + L VK+   K ++S D  SS  +  +K+ + E   IP   Q+LI+ GK + D+ T+ S 
Sbjct: 1  MQLKVKTLTGK-EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 KIADGHSIHLV 71
           + DG  +HLV
Sbjct: 60 DLQDGSLLHLV 70

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16  VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
           +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 119 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16  VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
           +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 195 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16  VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
           +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 271 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16  VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
           +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 347 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++ K L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%)

Query: 11 QNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          + K  +  +PS++I  +K ++A+         ++IYSGK+L+D QTVE  ++ +G  I
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 516 NIQKESTLHLV 526

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 440 NIQKESTLHLV 450

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 155 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 214 NIQKESTLHLV 224

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 231 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 290 NIQKESTLHLV 300

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 309 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 368 NIQKESTLHLV 378

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 385 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 444 NIQKESTLHLV 454

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
          M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHSIHLV 71
           I    ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60
           M I +   +G+    +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIADGHSIHLV 71
            I    ++HLV
Sbjct: 516 NIQKESTLHLV 526

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16  VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
           +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 74  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 129

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +  + S +I  +K +I +   IP + QRLI++GK L+D +T+  Y I    ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 3  ISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
          +SL  K+  + K  +  +PS++I   K ++A+ S       +LIYSGK+L+D +TV    
Sbjct: 2  VSLTFKNFKKEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECG 61

Query: 62 IADGHSI 68
          + DG  +
Sbjct: 62 LKDGDQV 68

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 3  ISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
          +SL  K+  + K  +  +PS++I   K ++A+ +       +LIYSGK+L+D +TV    
Sbjct: 2  VSLTFKNFKKEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECG 61

Query: 62 IADGHSI 68
          + DG  +
Sbjct: 62 LKDGDQV 68

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 1  MSISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVES 59
          M I+++ K   + K  +   P+++I   KQ +A+         ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKIADGHSI 68
           K+ DG  +
Sbjct: 61 CKLKDGDQV 69

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%)

Query: 11 QNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          + K+ +  + S SI  +K+ ++E         +LI+SGK+LKD  +VES    DG+ +
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEV 68

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 3  ISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
          +SL  K+  + K  +  +PS++I  +K ++A+         +LIYSGK+L+D +TV    
Sbjct: 2  VSLTFKNFKKEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECG 61

Query: 62 IADGHSI 68
          + DG  +
Sbjct: 62 LKDGDQV 68

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 37.4 bits (85), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 27 LKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSIHLV 71
          +K+ + E   IP   QRLI+ GK + D  TV    + +G  +HLV
Sbjct: 26 IKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 11 QNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          + K  +  DPSSS+   K R+A          +LIYSGK+L+D + ++   + DG  +
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQV 68

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 3  ISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
          +SL  K+  + K  +  +PS++I   K ++A+         +LIYSGK+L+D +TV    
Sbjct: 2  VSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECG 61

Query: 62 IADGHSI 68
          + DG  +
Sbjct: 62 LKDGDQV 68

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGD 405
           +Y +QL  L +MGF D D NV AL    G++   +N L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 3  ISLHVKS-GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61
          +SL  K   + K  +  D  S+I + K +IA   +   +  +LIYSGKILK+D T+ +  
Sbjct: 2  VSLIFKDFKKEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSG 61

Query: 62 IADG-HSIHLV 71
          + D  H I ++
Sbjct: 62 LKDNDHIIFMI 72

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 12 NKWQVSAD--PSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
           K ++S D   SS++   K+++AE         +LIYSGK+L+D  ++E   + DG  +
Sbjct: 10 KKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           +Y +QL++LN+MGF + D N  AL  S G +  AL+ L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           +Y ++L QL E+GF +  +N+ A+  S G V GAL+ L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%)

Query: 11 QNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          + K  +     ++I   K+ IAE     A   +LIY+GKIL+D +TV    + +G  +
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 344 SGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           SG   + G +Q  D      RY ++L  L EMG+ D D N  AL  + G +  A++ L
Sbjct: 175 SGDVPSLGNRQARDYE--LSRYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406
           R+  QL  L E+G++D D NV AL  + G +  AL+ +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%)

Query: 11 QNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          + K  +  D SSS+   K ++A+         +LIYSGK+L+D ++++   + DG  +
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           RY ++L +L EMGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           RY +QL +L +MGF D ++N+ AL  + G++  A++ L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALL--NGD 405
           +Y ++L +L  MGF D D N  AL  + G + GA++ L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 3  ISLHVKS--GQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQR--LIYSGKILKDDQTVE 58
          + L++K    ++K+Q++   + ++  LK  I +   +        LIYSGK+L+DD T+ 
Sbjct: 1  MKLYIKDPRTRSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLN 60

Query: 59 SYKIADGHSI 68
          S  + D   I
Sbjct: 61 SLHLKDNAQI 70

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           RY +QL +L +MGF D ++N+ AL  + G++  A++ L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 33/58 (56%)

Query: 11 QNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          + K  ++ + ++++   K ++A+         +LIYSGK+L+D +T+E   + DG  +
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           RY +QL +L +MGF D ++N+ AL  + G++  A++ L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 13 KWQVSADPSSSIGTL--KQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKIADGHSI 68
          K ++  D   S+  L  K++IA          +LIYSGK+L++D T+    + DG  +
Sbjct: 11 KEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQV 68

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 364 RYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401
           +Y + ++ L +MG+ D D N  AL  + G +  A++ L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
          bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/47 (23%), Positives = 28/47 (59%)

Query: 2  SISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSG 48
          ++  +VK   N + +S   S+++  LK+++ E++++P   Q+ +  G
Sbjct: 5  TLEFNVKHSGNVYPISITSSTTVQELKEQVQELTNVPVSRQKFMVKG 51

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 350 TGRQQTEDNRPPEERYQQQLEQLNEMGF-VDFDRNVAALRRSGGSVQGALNAL 401
           + R    D+R    +Y +QL +L +MG+  D  R   AL R+ G +  +L+ +
Sbjct: 184 SNRHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,571,417
Number of extensions: 1233118
Number of successful extensions: 3083
Number of sequences better than 10.0: 145
Number of HSP's gapped: 3118
Number of HSP's successfully gapped: 238
Length of query: 406
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 294
Effective length of database: 40,638,807
Effective search space: 11947809258
Effective search space used: 11947809258
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)