Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_45207.341ON91914692e-62
ACL158W7.341ON95883531e-44
SAKL0F10956g7.341ON86833026e-37
Kwal_YGOB_Anc_7.3417.341ON86852575e-30
KLTH0H01452g7.341ON86832498e-29
Kpol_530.377.341ON88842036e-22
TDEL0C020607.341ON88842002e-21
ZYRO0F11528g7.341ON121911972e-20
TPHA0F029107.341ON108991883e-19
TBLA0E004707.341ON1161041771e-17
NCAS0A140807.341ON78841691e-16
KLLA0C16709g7.341ON79811681e-16
CAGL0I03432g7.341ON149871695e-16
Suva_4.847.341ON81851212e-09
YDL160C-A (MHF2)7.341ON80661176e-09
Skud_4.957.341ON79851168e-09
NDAI0A019507.341ON122951172e-08
Smik_4.767.341ON80621142e-08
KNAG0C038107.341ON82841107e-08
KAFR0B009007.341ON78851045e-07
TBLA0A10760singletonON232947631.5
KLLA0D18194g8.381ON148054612.9
TDEL0G046406.7ON101745613.4
Ecym_24322.494ON46166595.8
KLTH0F03036gsingletonON46059596.0
Kpol_367.67.43ON103829596.3
KLLA0D09691g5.224ON51560587.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4520
         (91 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...   185   2e-62
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...   140   1e-44
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...   120   6e-37
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...   103   5e-30
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...   100   8e-29
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    83   6e-22
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    82   2e-21
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    80   2e-20
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    77   3e-19
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    73   1e-17
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               70   1e-16
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    69   1e-16
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    70   5e-16
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    51   2e-09
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    50   6e-09
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    49   8e-09
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    50   2e-08
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    49   2e-08
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    47   7e-08
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    45   5e-07
TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa]...    29   1.5  
KLLA0D18194g Chr4 (1533582..1538024) [4443 bp, 1480 aa] {ON} sim...    28   2.9  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...    28   3.4  
Ecym_2432 Chr2 (839673..841058) [1386 bp, 461 aa] {ON} similar t...    27   5.8  
KLTH0F03036g Chr6 (262704..262823,262877..264139) [1383 bp, 460 ...    27   6.0  
Kpol_367.6 s367 complement(18840..21956) [3117 bp, 1038 aa] {ON}...    27   6.3  
KLLA0D09691g Chr4 (817452..818999) [1548 bp, 515 aa] {ON} weakly...    27   7.6  

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score =  185 bits (469), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 91/91 (100%), Positives = 91/91 (100%)

Query: 1  MNHSQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKV 60
          MNHSQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKV
Sbjct: 1  MNHSQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKV 60

Query: 61 KKEDGKGSLIEGPVLHHTDLEEISGILLLDF 91
          KKEDGKGSLIEGPVLHHTDLEEISGILLLDF
Sbjct: 61 KKEDGKGSLIEGPVLHHTDLEEISGILLLDF 91

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score =  140 bits (353), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 64/88 (72%), Positives = 76/88 (86%)

Query: 4  SQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKE 63
          SQEP +P+DTIAR+F  CSFTQDST+ITED +TL E+Y+KLF+REAVLRSLENK+KVK+E
Sbjct: 8  SQEPAIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQE 67

Query: 64 DGKGSLIEGPVLHHTDLEEISGILLLDF 91
              S  EGPVL HTDLEEISG+L+LDF
Sbjct: 68 TRADSFAEGPVLQHTDLEEISGVLILDF 95

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score =  120 bits (302), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 63/83 (75%), Positives = 68/83 (81%), Gaps = 2/83 (2%)

Query: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGS 68
          +P DTIARIFQ CSFTQDSTRITEDT+ LT KYI+LFVREAVLRSLENK+KVK E    S
Sbjct: 6  LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPE--TES 63

Query: 69 LIEGPVLHHTDLEEISGILLLDF 91
          L  G VL H DLEEISG+LLLD 
Sbjct: 64 LDNGTVLSHEDLEEISGLLLLDM 86

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score =  103 bits (257), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 54/85 (63%), Positives = 66/85 (77%), Gaps = 5/85 (5%)

Query: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKE--DGK 66
          VP DTIARIFQ CSF  DSTRITE T+TL ++Y+++FVREA+LRS+ENKD+VK E  D  
Sbjct: 5  VPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQL 64

Query: 67 GSLIEGPVLHHTDLEEISGILLLDF 91
          GS +   VL H DLE +SG+LLLD 
Sbjct: 65 GSQV---VLTHKDLERVSGLLLLDM 86

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score =  100 bits (249), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)

Query: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGS 68
          +PSDTIARIFQ CSF  DSTRITE T++L + Y+++FVREA+LRS+ENK++VK E  +  
Sbjct: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSE-HQDQ 63

Query: 69 LIEGPVLHHTDLEEISGILLLDF 91
          L +  VL H DLE +SG+LLLD 
Sbjct: 64 LGDQVVLTHKDLERVSGLLLLDM 86

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 82.8 bits (203), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (72%), Gaps = 4/84 (4%)

Query: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDG-KG 67
          +P +TIAR+ +  SF   STRITED +   +KY++LFVREA++RS+E K K+++E+   G
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFTG 66

Query: 68 SLIEGPVLHHTDLEEISGILLLDF 91
            +E   L HTDLEEI+G+LLLD 
Sbjct: 67 VRVE---LTHTDLEEIAGLLLLDM 87

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score = 81.6 bits (200), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)

Query: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKE-DGKG 67
          +P +TIAR FQ+ +F  +ST IT++T+ + +KY+++FVREAVLRS  NK+++K E  G  
Sbjct: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64

Query: 68 SLIEGPVLHHTDLEEISGILLLDF 91
                VL H DLE I+G+LLLD 
Sbjct: 65 RNSNEIVLTHEDLENITGLLLLDM 88

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 5/91 (5%)

Query: 1   MNHSQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKD-K 59
           + H    +VP +TI RI +L +F  +ST ITE+T+T+ +KY+++FVREAV RS+ NKD +
Sbjct: 34  IGHVDMSMVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQ 93

Query: 60  VKKEDGKGSLIEGPVLHHTDLEEISGILLLD 90
               DG G +     L+H DLE+I+G+LLLD
Sbjct: 94  GSHGDGDGEI----QLNHEDLEKITGMLLLD 120

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 77.0 bits (188), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (63%), Gaps = 17/99 (17%)

Query: 9   VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDK-------VK 61
           +P DTIARI QL SF ++ TRI+ +++ + +KY++LFVREAVLRS+EN+++       +K
Sbjct: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68

Query: 62  KEDGKGS---------LIEGPVLHHTDLEEISGILLLDF 91
           K   K +            G  L H DLEEISG+LLLD 
Sbjct: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 72.8 bits (177), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (58%), Gaps = 24/104 (23%)

Query: 9   VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDK--------V 60
           +P +TIARI Q  SF  ++TRIT++T+T  +KY++LF+REA LRSLENK++        V
Sbjct: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75

Query: 61  KKEDG-------------KGSLIEGPVLHHTDLEEISGILLLDF 91
           K E G               + IE   L H  LE I+G+LLLD 
Sbjct: 76  KNEPGLEDTKIFNDNNKLNDNDIE---LSHEALEAITGLLLLDM 116

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 69.7 bits (169), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 58/84 (69%), Gaps = 7/84 (8%)

Query: 8  VVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKG 67
           +P +TIA+I QL +F    T++TE+T+++ ++Y++LF+REA+ RSL+NK+   KE G+ 
Sbjct: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKE---KELGQT 58

Query: 68 SLIEGPVLHHTDLEEISGILLLDF 91
           +    V+   DLE + G+LLLD 
Sbjct: 59 DI----VIDEKDLERVVGLLLLDM 78

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 69.3 bits (168), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 49/81 (60%), Gaps = 9/81 (11%)

Query: 11 SDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGSLI 70
          S TIARI Q   F   +TRITE+ + L E YI+LFVRE VLRSLEN         K  ++
Sbjct: 7  STTIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLEN---------KADML 57

Query: 71 EGPVLHHTDLEEISGILLLDF 91
              +   DLE ++G+LL+DF
Sbjct: 58 ADKTVDFVDLEAVAGLLLMDF 78

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 69.7 bits (169), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 11/87 (12%)

Query: 9   VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDK----VKKED 64
           VP DTIAR+ Q+ +F    TRI  D +   ++YI +F REAVLRS+E+ D     +++E 
Sbjct: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQ 129

Query: 65  GKGSLIEGPVLHHTDLEEISGILLLDF 91
            K        + HTDLE I+G+LLLD 
Sbjct: 130 DKE-------ITHTDLENIAGLLLLDM 149

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score = 51.2 bits (121), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 6/85 (7%)

Query: 8  VVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLE-NKDKVKKEDGK 66
          ++P + I +I    + +  + +I +  I + +KY+++F+ EA LRSL+ +KD     DG 
Sbjct: 2  ILPKEAIIKILSQNN-SDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGD 60

Query: 67 GSLIEGPVLHHTDLEEISGILLLDF 91
          G L     L H DLE I G+LL+D 
Sbjct: 61 GPL----ELSHLDLERIVGLLLMDM 81

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score = 49.7 bits (117), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 26 DSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGSLIEGPVLHHTDLEEISG 85
          +  +I ++ + + +KY+ +F+ EAVLRSL++   +  E G  S +E   L H DLE I G
Sbjct: 18 NDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLE---LSHQDLERIVG 74

Query: 86 ILLLDF 91
          +LL+D 
Sbjct: 75 LLLMDM 80

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score = 49.3 bits (116), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 7/85 (8%)

Query: 8  VVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKG 67
          ++  D + +I    +F +D  +I +  + + + Y+ +F+ EA LRSL++     ++D  G
Sbjct: 1  MLSKDALIKILSQNNFRKD-IKIDDKVLPMIQNYLDIFIEEAALRSLQS-----QKDASG 54

Query: 68 SLIEGPV-LHHTDLEEISGILLLDF 91
             +GP+ L H DLE I G+LL+D 
Sbjct: 55 GHRDGPLELSHLDLERIVGLLLMDM 79

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 49.7 bits (117), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 5/95 (5%)

Query: 2   NHSQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVK 61
           N   +  +  +TI +I +  SF    T IT++TI + ++Y+ LF++EAV+RS ENK   +
Sbjct: 28  NIQADMTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQ 87

Query: 62  KEDGKGSLIEGPV-----LHHTDLEEISGILLLDF 91
            ED               L H DLE I G+LL++ 
Sbjct: 88  VEDFDDEEDADEEDKTIELTHLDLERIVGLLLMEL 122

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score = 48.5 bits (114), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 30 ITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGSLIEGPVLHHTDLEEISGILLL 89
          I+++ I + +KY+ +F+ EA LRSL++   + KE  K   +E   L H DLE + G+LL+
Sbjct: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDPLE---LSHQDLERVVGVLLM 78

Query: 90 DF 91
          D 
Sbjct: 79 DM 80

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 47.0 bits (110), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGS 68
          +  +T++RI    SF   ST I +  +T  +KY++ +V+E +LRSLENKD          
Sbjct: 9  ISRETLSRILT-QSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD---------- 57

Query: 69 LIEGPV-LHHTDLEEISGILLLDF 91
          L   P  L   D+E I G+LLLD 
Sbjct: 58 LGVNPAELTERDIERILGLLLLDM 81

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 44.7 bits (104), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (51%), Gaps = 11/85 (12%)

Query: 9  VPSDTIARIFQLCSFTQDSTR--ITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGK 66
          +P +TI+RI  L    ++     I  +T+    KY  + + E VLRSLENK+ + +    
Sbjct: 3  IPKETISRIL-LNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKENIAE---- 57

Query: 67 GSLIEGPVLHHTDLEEISGILLLDF 91
                P L   DLE+I G+LLLD 
Sbjct: 58 ----ATPTLDVDDLEKIIGLLLLDM 78

>TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa] {ON}
            
          Length = 2329

 Score = 28.9 bits (63), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 4    SQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAV 50
            + E  +P++TI   + + S TQ+S      T+T TE Y  +  +E V
Sbjct: 2165 TTEEQLPTETILDSYSISSTTQNSIFFPNKTVTHTEPYNTILPKETV 2211

>KLLA0D18194g Chr4 (1533582..1538024) [4443 bp, 1480 aa] {ON}
           similar to uniprot|Q04002 Saccharomyces cerevisiae
           YDR180W SCC2 Sister chromatid cohesion protein
          Length = 1480

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 21  CSFTQDSTRITEDTITLTEKY--------IKLFVREAVLRSLENKDKVKKEDGK 66
           C+F  DS  + +  + + EK         IK FV E VLR +E+++ V  E+ +
Sbjct: 772 CNFDDDSIAVRKHVMRMNEKILDTSSDLKIKTFVLEKVLRRIEDEEDVIVENAR 825

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score = 28.1 bits (61), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 11  SDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFV-REAVLRSL 54
           S+ ++ I +LC+F QD+   +   + +TE  + L   ++AVLR L
Sbjct: 609 SEAVSVIEELCAFYQDTDENSTSLVGITEILLSLLAQKKAVLRKL 653

>Ecym_2432 Chr2 (839673..841058) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ABR016C
          Length = 461

 Score = 27.3 bits (59), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 7   PVVPSDTIARIFQLCSFTQDSTRITEDTIT---LTEKYIKLFVREAVLRSLENKDKVKKE 63
           P + +D + RI++   +  D  +     +T   LT + I+       +RSL++ DKV K+
Sbjct: 72  PSLSADDVERIYE--EYGNDVDKCINTLLTFEGLTNEDIEAQKEYEKVRSLKDTDKVNKK 129

Query: 64  DGKGSL 69
           D  GSL
Sbjct: 130 DAWGSL 135

>KLTH0F03036g Chr6 (262704..262823,262877..264139) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53748 Saccharomyces cerevisiae
           YNR062C Hypothetical ORF
          Length = 460

 Score = 27.3 bits (59), Expect = 6.0,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 14  IARIFQLCSFTQDSTRITE-DTITLTEKYIKLFVREAVLRSLENKDKVKKEDG-KGSLI 70
           +A +F LC F   + RIT  +  T    ++ L V   +   LE+  K+ K DG KGSL+
Sbjct: 159 VAILFALCDFKVGNYRITSYNAPTFASSFMILIVGVFLAVLLEDP-KIAKSDGKKGSLL 216

>Kpol_367.6 s367 complement(18840..21956) [3117 bp, 1038 aa] {ON}
           complement(18840..21956) [3117 nt, 1039 aa]
          Length = 1038

 Score = 27.3 bits (59), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 58  DKVKKEDGKGSLIEGPVLHHTDLEEISGI 86
           DK  KE  KG L+ G  +H TD +  S I
Sbjct: 816 DKTNKEFWKGYLMSGGAIHSTDTQIKSAI 844

>KLLA0D09691g Chr4 (817452..818999) [1548 bp, 515 aa] {ON} weakly
           similar to uniprot|P47084 Saccharomyces cerevisiae
           YJR003C Hypothetical ORF
          Length = 515

 Score = 26.9 bits (58), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 12  DTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGSLIE 71
           +T  R+F L   T D+  ITE      E ++K F        LE+ D V  + G GS  E
Sbjct: 250 NTFIRLFSLVG-THDTVPITEKEAQAYESFVKDFNAIGENLGLESSDLVASKIGTGSTFE 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,498,134
Number of extensions: 346805
Number of successful extensions: 1245
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1226
Number of HSP's successfully gapped: 32
Length of query: 91
Length of database: 53,481,399
Length adjustment: 62
Effective length of query: 29
Effective length of database: 46,372,107
Effective search space: 1344791103
Effective search space used: 1344791103
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)