Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_45197.340ON43243221470.0
ACL159W7.340ON41340515560.0
SAKL0F10978g7.340ON4053837252e-91
KLLA0C16687g7.340ON3983864491e-50
Kwal_56.246047.340ON3813794131e-45
KLTH0H01474g7.340ON3813644017e-44
TPHA0D045507.340ON4373612272e-19
NCAS0A140707.340ON1731931594e-12
ZYRO0F16258g1.100ON124499704.8
Kwal_26.8030na 1ON66094695.8
CAGL0L11330g4.332ON462102687.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4519
         (432 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar...   831   0.0  
ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No ...   603   0.0  
SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {...   283   2e-91
KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON} cons...   177   1e-50
Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [con...   163   1e-45
KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {...   159   7e-44
TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340     92   2e-19
NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7....    66   4e-12
ZYRO0F16258g Chr6 (1334261..1337995) [3735 bp, 1244 aa] {ON} sim...    32   4.8  
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    31   5.8  
CAGL0L11330g Chr12 complement(1206892..1208280) [1389 bp, 462 aa...    31   7.6  

>Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii ACL159W
          Length = 432

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/432 (95%), Positives = 414/432 (95%)

Query: 1   MKYSNKSRYFSLSIHNMDDPDMEVRYQCICKNLVKWSDLNICRECYSLSCFRCQGFEPVV 60
           MKYSNKSRYFSLSIHNMDDPDMEVRYQCICKNLVKWSDLNICRECYSLSCFRCQGFEPVV
Sbjct: 1   MKYSNKSRYFSLSIHNMDDPDMEVRYQCICKNLVKWSDLNICRECYSLSCFRCQGFEPVV 60

Query: 61  KYCPKCLEEPGKMDQIFCNRNCFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTP 120
           KYCPKCLEEPGKMDQIFCNRNCFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTP
Sbjct: 61  KYCPKCLEEPGKMDQIFCNRNCFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTP 120

Query: 121 PTGKIKSLTKYILELYSSKNARAYELITHLHNKKQLLQWEGKAFKFDEIVSALEGNAPRS 180
           PTGKIKSLTKYILELYSSKNARAYELITHLHNKKQLLQWEGKAFKFDEIVSALEGNAPRS
Sbjct: 121 PTGKIKSLTKYILELYSSKNARAYELITHLHNKKQLLQWEGKAFKFDEIVSALEGNAPRS 180

Query: 181 IVQRLAVGEKLHQLISEQIPLPLKDDSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSP 240
           IVQRLAVGEKLHQLISEQIPLPLKDDSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSP
Sbjct: 181 IVQRLAVGEKLHQLISEQIPLPLKDDSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSP 240

Query: 241 SSSRLHKESFAMNILPRIRIEKLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDTL 300
           SSSRLHKESFAMNILPRIRIEKLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDTL
Sbjct: 241 SSSRLHKESFAMNILPRIRIEKLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDTL 300

Query: 301 FMPIRKFNIPAVSVNDYKIIKNSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLG 360
           FMPIRKFNIPAVSVNDYKIIKNSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLG
Sbjct: 301 FMPIRKFNIPAVSVNDYKIIKNSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLG 360

Query: 361 SRFPFQNSTTNSINLLDYDIDEDAKAIDKGDGWCIXXXXXXXXXXXXXXXXXXIEGFEVR 420
           SRFPFQNSTTNSINLLDYDIDEDAKAIDKGDGWCI                  IEGFEVR
Sbjct: 361 SRFPFQNSTTNSINLLDYDIDEDAKAIDKGDGWCILPLKLLNKGNHLLNLLVNIEGFEVR 420

Query: 421 LNLHFIAKPSNS 432
           LNLHFIAKPSNS
Sbjct: 421 LNLHFIAKPSNS 432

>ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No
           homolog in Saccharomyces cerevisiae
          Length = 413

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/405 (68%), Positives = 336/405 (82%), Gaps = 1/405 (0%)

Query: 22  MEVRYQCICKNLVKWSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNRN 81
           MEVRYQC+C+ LVKWSDLN C+EC+S+SCFRCQ FEPV+KYCPKCLEEPGK+DQIFCNRN
Sbjct: 1   MEVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRN 60

Query: 82  CFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKNA 141
           CFQCPRC+ISLVISSEK+  D K Y+F CTGCKW+FTTPPTGKIKSLTKY+LELY+SKN+
Sbjct: 61  CFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKNS 120

Query: 142 RAYELITHLHNKKQLLQWEGKAFKFDEIVSALEGNAPRSIVQRLAVGEKLHQLISEQIPL 201
           RAYEL+THLHNKKQLLQWEG+AFKFDEIV+ALEGNAPRS VQRLA GEKLH LI+E++  
Sbjct: 121 RAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQ 180

Query: 202 PLKDDSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNILPRIRIE 261
           PL+ D   VLYPKR HLKC+YRY CP+C+HTLS+PD +P+SS+LHKESFAMN+LP IRIE
Sbjct: 181 PLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIE 240

Query: 262 KLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDTLFMPIRKFNIPAVSVNDYKIIK 321
             A ALG+D QDP+A AI+V+NP P R+++  L+ASDTLF+P+RKF IP+V+ +D ++ +
Sbjct: 241 TEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDSQLDR 300

Query: 322 NSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLGSRFPFQNSTTNS-INLLDYDI 380
           + GKD+NLQILE Y KF PT MLGNDHK+NRAERTRRLG+RF FQ S + +  N +DYDI
Sbjct: 301 SQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPVDYDI 360

Query: 381 DEDAKAIDKGDGWCIXXXXXXXXXXXXXXXXXXIEGFEVRLNLHF 425
           +E+A+ +D+GD WCI                  I  ++V LNLHF
Sbjct: 361 EEEARPLDQGDAWCILPLKLLRDGLHLLNVLVTIGDWQVNLNLHF 405

>SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {ON}
           conserved hypothetical protein
          Length = 405

 Score =  283 bits (725), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 157/383 (40%), Positives = 229/383 (59%), Gaps = 20/383 (5%)

Query: 22  MEVRYQCICKNLVK-WSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNR 80
           M V   C C +  K  S LN+C+ CY +SC +CQ FEPV+KYCP C+E P + DQ  C +
Sbjct: 1   MRVLVLCDCSSKCKSLSQLNLCQACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTK 60

Query: 81  NCFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKN 140
           NCFQCPRC + LVISS   D   K Y+F C GC W + TP  GKI+SLTKYI  L +++ 
Sbjct: 61  NCFQCPRCKLGLVISSGSCDDGNKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANEC 120

Query: 141 --ARAYELIT-HLHNKKQLLQWEGKAFKFDEIVSALEGNAP---RSIVQRLAVGEKLHQL 194
             +R +E++  H H+K+QLL W         +   L+G+     R+++QRL+ G+KL +L
Sbjct: 121 LLSRRFEVLERHYHSKRQLLDW---GLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFEL 177

Query: 195 ISEQIPLPLKDDSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNI 254
           + E  P+PL D S+ +  P ++HL+CKY+Y+CP C +TL  P+  P S + +  SFA+  
Sbjct: 178 LDEPCPMPLNDTSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKY 237

Query: 255 LPRIRIEKLAVALGMDHQ--DPSAFAIVVINPNPSRSIECTLTASDTLFMPIRKFNIPAV 312
           LP +    LA    +D++  D + FA+V+ NP  S  +  T++ SD LF+PI +  I AV
Sbjct: 238 LPAL---SLAPRSQIDNKVYDDTRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAV 294

Query: 313 SVNDYKIIKNSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLGSRFPFQNSTTNS 372
           +      +  S +D  L+ +EQ+    PTY L  D K++R ERT+RLG +     ST N+
Sbjct: 295 TP-----VTPSHQDHGLKTIEQFILSVPTYKLTADTKLSRVERTKRLGKKNLNVYSTANN 349

Query: 373 INLLDYDIDEDAKAIDKGDGWCI 395
            +    +  ED K +D+G GWCI
Sbjct: 350 SSTSLLEDLEDYKLLDQGSGWCI 372

>KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON}
           conserved hypothetical protein
          Length = 398

 Score =  177 bits (449), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 193/386 (50%), Gaps = 36/386 (9%)

Query: 23  EVRYQCICKNLVKWSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNRNC 82
           + RY+  C     + DLN+C +C+ +SC +CQ FE V KYC +C ++  K D ++C++NC
Sbjct: 3   QFRYRSGCGLESNFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNC 62

Query: 83  FQCPRCDISLVISSEK--MDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILEL-YSSK 139
           FQCP C +SL I S K   ++D + Y F C GC W++ TP   KIKSLTKYI+EL YS+ 
Sbjct: 63  FQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTD 122

Query: 140 NARAYELIT---HLHNKKQLLQWEGKAFKFDEIVSALEGNAPRSIVQRLAVGEKLHQLIS 196
             R +E +    H  N    L  + ++ KFD    AL+ +   S  +RLA GE L +LI+
Sbjct: 123 THRRFESLRQFYHTRNTLNSLSLKPESLKFD----ALDPSNLNSWWKRLANGEPLWKLIN 178

Query: 197 EQIPLPLKD--DSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNI 254
           E+  +P  +    N+   P    L+ KY Y CP C   ++  D +P + +  K     + 
Sbjct: 179 EENAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSG 238

Query: 255 LPRIRI--EKLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDTLFMPIRKFNIPAV 312
           +PRI +        L  +    +   +++ N     +    + A ++L +P  + +I A 
Sbjct: 239 IPRISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFAA 298

Query: 313 SVNDYKIIKNSGKDINLQILEQYAKFTPTYMLG---NDHKINRAERTRRLGSRFPFQNST 369
                 I  N  +  NL+ L+      PT+ML    +  K+ R E TRRLG      N  
Sbjct: 299 ------IKTNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLG----LLNKR 348

Query: 370 TNSINLLDYDIDEDAKAIDKGDGWCI 395
            +S NL         + ID+G GW +
Sbjct: 349 LSSDNL---------RIIDEGTGWIV 365

>Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [contig
           161] FULL
          Length = 381

 Score =  163 bits (413), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/379 (27%), Positives = 190/379 (50%), Gaps = 36/379 (9%)

Query: 22  MEVRYQCICK-NLVKWSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNR 80
           M V++ C C  + +   DLN+CR+C+ +SC  CQ  E ++K+CP C +     +Q+ CN+
Sbjct: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60

Query: 81  NCFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKN 140
           NCF+CPRC +++ +S  K     +C+   C GC W +TTP   K + LT+++ EL   ++
Sbjct: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120

Query: 141 ARAYELITHLHNKKQLLQWEGKAFKFDEIVSALEGN-APRSIVQRLAVGEKLHQLISEQI 199
                 I+     +  +Q     F+  E    ++ + A + + +RL    KL +L++E+ 
Sbjct: 121 PHEQRFISLRKLYRDKIQ-----FQNLETTDVIDPSFATKEVAERLN-NMKLFELVNEEF 174

Query: 200 PLPLKDDSNEVL--YPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNILPR 257
           PLP+   +      +P+   L+ K+ Y CP C   L+     P SSR   ESFAM+ LP 
Sbjct: 175 PLPIHKGTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPD 234

Query: 258 IRIEKLAVALGMDHQDPSAFAIVVINPNPSR-SIECTLTASDTLFMPIRKFNIPAVSVND 316
           +++   ++ +     D ++ A+V    + +  + + T+ +  T  +P+R+F +      D
Sbjct: 235 LQVVSRSL-IDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIPVRQFTL----TRD 289

Query: 317 YKIIKNSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLGSRFPFQNSTTNSINLL 376
                 S  ++  + +++ A   PT+ L  + KI  AE++RR       + +  N I   
Sbjct: 290 IP----SRNELTQEAIKRLASEVPTFQLNTNTKILAAEKSRRNSK---VERTHKNEI--- 339

Query: 377 DYDIDEDAKAIDKGDGWCI 395
                     ID+G+GWCI
Sbjct: 340 ----------IDQGNGWCI 348

>KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {ON}
           conserved hypothetical protein
          Length = 381

 Score =  159 bits (401), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 177/364 (48%), Gaps = 40/364 (10%)

Query: 39  LNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNRNCFQCPRCDISLVISSEK 98
           LNIC +C+ +SC  CQ  E ++KYCP C        Q+ C  NC +CPRC++ L +S EK
Sbjct: 19  LNICAKCHRVSCNWCQKPELLIKYCPGCFRVAESEGQLRCVHNCLECPRCELILSVSMEK 78

Query: 99  MDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKN--ARAYELITHLHNKKQL 156
           + S  K +   C GC W + TP    +K+LT  + EL   ++   + +  +   +  K+ 
Sbjct: 79  LASGHKRFEMVCNGCSWRYKTPEVSTLKTLTGCVEELRKKEDPYTQRFNSLREFYGFKRE 138

Query: 157 LQWEGKAFKFDEIVSALEGNAPRSIVQRLAVGEKLHQLISEQIPLPLKD--DSNEVLYPK 214
           LQ+  +  +  E +      A + +  RL    KL+++I+E+ P+  KD  DS ++  P 
Sbjct: 139 LQYMEEGGEVSESI------ASKELFDRLN-ETKLYKMINEECPIEFKDTKDSGDIALPL 191

Query: 215 RLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNILPRIRIEKLAVALGMDHQDP 274
            L L+ K+ Y CP C   L+     P SSR   ESFA ++LP + I   +  +     D 
Sbjct: 192 PLRLRAKFDYRCPSCGEWLTKSHPDPRSSRFLLESFAAHMLPSLEIVHRS-KVEPSVSDE 250

Query: 275 SAFAIVVINPNPSRS-IECTLTASDTLFMPIRKFNIPAVSVNDYKIIKNSGKDINLQILE 333
           +A A+V    + S + +E T+  S T+ +P+R+F +      D  +   S     ++ ++
Sbjct: 251 NAMALVFTASDQSDTPVEITILGSATIHIPVRQFTL----AYDGPVKCES----TMETIK 302

Query: 334 QYAKFTPTYMLGNDHKINRAERTRRLG--SRFPFQNSTTNSINLLDYDIDEDAKAIDKGD 391
           +     PTY L ++  I   E++RRL      P +N+                  ID+G 
Sbjct: 303 RLVTRVPTYQLNSNTNILATEKSRRLTRPETAPHKNN-----------------MIDQGS 345

Query: 392 GWCI 395
           GWCI
Sbjct: 346 GWCI 349

>TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340
          Length = 437

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 148/361 (40%), Gaps = 41/361 (11%)

Query: 34  VKWSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMD------------------- 74
           + +S LN+CR+C+ +SC  CQ F+   K+CP C       D                   
Sbjct: 26  IDFSRLNLCRKCHKISCDSCQLFQDYEKFCPYCCRNNKVPDCADGSRLSFEERYCQEICY 85

Query: 75  QIFCNRNCFQCPRCDISLVIS---SEKM-DSDKKCYLFNCTGCKWTFTTPPTGKIKSLTK 130
             +C   CFQCP+C+ SL +S   +E++ D + K   F C  C W+++T   G +K L+K
Sbjct: 86  DEYCTNGCFQCPKCNNSLALSLCKNERLKDPNGKTISFQCYCCSWSWSTELPGNVKLLSK 145

Query: 131 YILELY---SSKNARAYELITHLHNKKQLLQWEGKAFKFDEI-VSALEGNAPRSIV---- 182
           +I  L+     K  R  +L     N          ++   +I +   +  + R ++    
Sbjct: 146 HIFSLHLNLDPKFQRFKQLSNIYLNDSSDCSNNDPSYSVKDIYLKQGDLQSARGLLDIIN 205

Query: 183 --QRLAVGEKLHQLISEQIPLP-LKDDSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDS 239
             +  +       L+++Q P   L DD+N  L P+   L  K+ Y CP C  T+  P   
Sbjct: 206 NKKETSFNTSSTVLLNDQFPHQNLYDDTNTSL-PELSKLVMKFEYKCPHCEETILKPSSE 264

Query: 240 PSSSRLHKESFAMNILPRIRIEKLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDT 299
             SS    ESFA   LP I +  +      D +      +  I  N +  ++  +  SD 
Sbjct: 265 LYSSDNTYESFAFTQLPTIEVSAIK-----DLKQDLVLIMKNIEDNLNDFVQAEIITSDN 319

Query: 300 LFMPIRKFNIPAVSVNDYKIIKNSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRL 359
           + +   KF I   S  D    K+      +  LE    F        ++K  R E+ RRL
Sbjct: 320 IQLSQNKF-IFMKSTGDKLQDKSKYYAELMSYLEGLPSFDLNLCDNVNNKFVRIEKQRRL 378

Query: 360 G 360
            
Sbjct: 379 A 379

>NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7.340
          Length = 173

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 85/193 (44%), Gaps = 38/193 (19%)

Query: 42  CRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQ-IFCNRNCFQCPRCDISLVISSEKMD 100
           C+ C++ +C  C+ F+P+ + CP+C      MD+   C  +CFQCP C+ +L +   K  
Sbjct: 17  CKVCHNTTCPDCELFQPLQRECPQCQTITMHMDEDTRCKNDCFQCPNCETALTVLLAK-S 75

Query: 101 SDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKNARAYELITHLHNKKQLLQWE 160
           S KK Y F C  C + + TP              +  +      +++ HL+    +    
Sbjct: 76  SRKKRYKFTCKHCDYDYVTP-------------SMSVTDERSISQIVDHLNETLNV---- 118

Query: 161 GKAFKFDEIVSALEGNAPRSIVQRLAVGEKLHQLISEQIPLPLKDDSNEVLYPKRLHLKC 220
            +  +F E+   +E          L  G      I   + LPL  D  +V+ P+R  L C
Sbjct: 119 -EYLRFQELKKNIE----------LGGG------IDNVVVLPLCGD--DVILPRRTKLVC 159

Query: 221 KYRYTCPQCNHTL 233
           +++  CP C H +
Sbjct: 160 QFQSICPHCYHVV 172

>ZYRO0F16258g Chr6 (1334261..1337995) [3735 bp, 1244 aa] {ON}
           similar to uniprot|P38717 Saccharomyces cerevisiae
           YNL257C SIP3 Protein that activates transcription
           through interaction with DNA-bound Snf1p C-terminal
           region has a putative leucine zipper motif potential
           Cdc28p substrate and to uniprot|P38851 Saccharomyces
           cerevisiae YHR155W YSP1 Hypothetical ORF
          Length = 1244

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 9/99 (9%)

Query: 75  QIFCNRNCFQCPRCDISLVISSEKMDSDK-KCYLFNCTGCKWTFTTPPTGKIKSLTKYIL 133
           Q++  R  +     ++ + ISS K+  DK    +   T  K TFT   TGK   LT  + 
Sbjct: 183 QLYEVRQSYLDASLELVVAISSMKLGVDKCVMEIIGLTQLKNTFTFQHTGKKVDLTPLLN 242

Query: 134 ELYSSKN-------ARAYELITHLHN-KKQLLQWEGKAF 164
           E +SS +         A+ L   + N K+Q+LQ+  + F
Sbjct: 243 EKFSSYSEWVENSIEAAHSLQNEIENAKRQVLQFAAQKF 281

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 19/94 (20%)

Query: 50  CFRCQGFEPVVKYCPKCLEEPGKMDQIFCN----------RNCFQCPRCDISLVISSEKM 99
           C RCQ  +   KYC  C EE   M   +CN          ++ + C +C I  +     +
Sbjct: 299 CMRCQHVQDPQKYCENCDEE---MALYYCNECKLFDNDETKDIYHCDKCGICRLGLGLGV 355

Query: 100 DSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYIL 133
           D       F+C GC+   +    G  + + +  +
Sbjct: 356 D------FFHCDGCQACLSIELQGNHRCIERATM 383

>CAGL0L11330g Chr12 complement(1206892..1208280) [1389 bp, 462 aa]
           {ON} similar to uniprot|Q04638 Saccharomyces cerevisiae
           YML068w
          Length = 462

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 43/102 (42%), Gaps = 13/102 (12%)

Query: 78  CNRNCFQCPRCDISLVISSEKMDSD----KKCYLFNCTGC--KWTFTTPPTGKIKSLTKY 131
           C   C  CPRCD   +   E +D       KC    C  C   W   T P GK + +   
Sbjct: 291 CPFACKICPRCDYWCI--KEDLDDSLIQCSKCSFAFCFICSHSWHGYTNPCGKAEKIANE 348

Query: 132 ILELY---SSKNARAYELITHLHNKKQLLQWEGKAFKFDEIV 170
           I+E Y   S+   R  EL T    K+  LQ E + +  D+++
Sbjct: 349 IIEEYMEDSTTRTRKKELETKYGKKR--LQSECEEYLADKML 388

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,581,576
Number of extensions: 2109635
Number of successful extensions: 5390
Number of sequences better than 10.0: 24
Number of HSP's gapped: 5536
Number of HSP's successfully gapped: 26
Length of query: 432
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 320
Effective length of database: 40,638,807
Effective search space: 13004418240
Effective search space used: 13004418240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)