Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_45145.443ON1246124663200.0
SAKL0G02728g5.443ON1237123635640.0
Kwal_55.213935.443ON1233122733020.0
TDEL0D025805.443ON1272123130570.0
Suva_8.1765.443ON1270124330230.0
YOR124C (UBP2)5.443ON1272125629860.0
Smik_15.3015.443ON1272124029700.0
Skud_15.2865.443ON1278125029580.0
NCAS0H021005.443ON1269124329530.0
TPHA0E017105.443ON1283125329290.0
ACL164C5.443ON138980728980.0
KNAG0B041905.443ON1262125128560.0
NDAI0C015505.443ON1295123728310.0
KAFR0D050705.443ON1227125328290.0
TBLA0A064705.443ON1320128127920.0
CAGL0K10252g5.443ON1267126825880.0
KLTH0F15862g5.443ON124183621720.0
ZYRO0G01606g5.443ON130579420440.0
Kpol_1062.235.443ON126680418860.0
KLLA0E02377g5.443ON122080517850.0
TPHA0J026205.443ON1225125214191e-174
Kpol_1016.15.443ON12517939441e-107
Kwal_34.162681.369ON449991352e-07
KLLA0A10791g1.369ON484921282e-06
TBLA0C012001.369ON503921282e-06
KLTH0H13354g1.369ON495991245e-06
NCAS0D006001.369ON493561246e-06
TDEL0D024001.369ON494571202e-05
ZYRO0G01188g1.369ON500521192e-05
KAFR0C045201.369ON4991111192e-05
KNAG0C019401.369ON499771165e-05
SAKL0D10120g1.369ON492401165e-05
NDAI0A016707.390ON846931141e-04
TPHA0A025101.369ON5051161131e-04
CAGL0L01639g1.137ON1147911094e-04
YFR010W (UBP6)1.369ON499521084e-04
Skud_6.941.369ON499521084e-04
AEL029W1.369ON446351067e-04
Ecym_27171.369ON483921069e-04
Kpol_534.231.369ON496381050.001
TPHA0A025401.137ON1286391060.001
NDAI0H035501.369ON5021951040.001
Suva_6.831.369ON500521040.001
Kpol_1003.532.307ON788481050.001
Smik_7.3141.369ON499521040.002
NCAS0A143707.390ON729901040.002
YJL197W (UBP12)1.137ON1254991050.002
NDAI0B034302.307ON856641040.002
KAFR0L017307.390ON701771030.002
TBLA0C070205.18ON1247991040.002
Kpol_2001.541.137ON1223661040.002
CAGL0H10582g2.307ON790481020.003
NCAS0G036802.307ON482481010.003
KLLA0C06974g8.742ON4461111010.003
Skud_10.221.137ON1255371020.003
CAGL0K10494g1.369ON495341000.004
Kwal_26.95985.18ON1191951010.004
ZYRO0C17908g1.137ON1204381000.005
KNAG0A054502.307ON76452990.006
SAKL0E07106g2.307ON79148990.007
NDAI0B004801.137ON125392980.009
KAFR0I026005.18ON121349970.010
Suva_5.2177.390ON75478970.011
NDAI0G007802.307ON48663960.011
Skud_4.1332.307ON78752970.011
Smik_4.1152.307ON79052970.011
TDEL0C056401.137ON117847970.011
Smik_10.371.137ON124791970.013
KLTH0G10934g2.307ON75869960.013
Suva_4.1252.307ON79352960.013
Kwal_27.114442.307ON75766960.014
KAFR0F015601.137ON117159960.014
TBLA0B060802.307ON82463960.014
YDL122W (UBP1)2.307ON80952960.014
NDAI0I025305.18ON1197100960.016
TPHA0L022905.18ON119395960.016
CAGL0M13783g5.18ON119675960.016
Suva_6.2761.137ON125648960.018
Ecym_81401.137ON126437960.018
Skud_5.2237.390ON74888950.018
TPHA0G008502.307ON78248950.018
AGL357W5.18ON116656950.019
NCAS0B061302.307ON77048950.021
KAFR0A075802.69ON80264950.021
KLLA0A00396g5.712ON101227950.022
KLTH0B09944g5.18ON118949950.022
Smik_5.2447.390ON74978940.022
TDEL0B020805.712ON102527940.024
Smik_13.4318.742ON47148930.025
TBLA0D010708.742ON48343930.025
AGR389C2.307ON77548940.027
KAFR0A069102.307ON67848930.027
NDAI0F034102.69ON87066940.028
Ecym_46857.390ON77846930.029
Suva_13.4955.18ON123051940.030
TDEL0G023702.307ON74763930.031
TDEL0A011002.69ON66177930.031
Kwal_55.196455.712ON97047930.032
Smik_13.5215.18ON123151930.032
YMR304W (UBP15)5.18ON123051930.033
Ecym_56715.18ON117649930.034
SAKL0C04246g1.137ON129788930.034
KLLA0D08459g2.69ON75066920.037
Kpol_513.255.18ON119050930.039
TPHA0D046605.712ON104527920.041
KNAG0F012202.69ON78466920.041
KNAG0C021801.137ON123194920.046
ZYRO0A02420g2.307ON74552920.047
NDAI0E008108.742ON49348910.048
AFR627C1.137ON128738920.049
Smik_2.497.390ON74528910.049
Kwal_33.136281.137ON116038910.055
KLTH0F03674g1.137ON119829910.058
Ecym_62488.742ON46651900.060
ABL145W2.69ON74986900.069
KNAG0C035807.390ON77687900.070
Skud_13.4785.18ON123198900.073
KNAG0E012905.18ON119649900.073
NCAS0G001705.712ON103078900.076
KNAG0J008003.270ON76598900.077
Smik_14.1442.69ON76366900.081
NCAS0D023905.18ON121150900.086
Suva_14.1562.69ON78866890.088
ZYRO0B16544g5.712ON104435890.091
NCAS0G018002.69ON87566890.091
Klac_YGOB_Anc_5.18b5.18ON116695890.094
Ecym_15348.8ON210166860.096
ZYRO0A05962g8.742ON465110880.096
ZYRO0C09812g2.69ON70266890.10
KLLA0E08801g2.307ON77148880.11
YBL067C (UBP13)7.390ON74766880.11
NDAI0F002005.712ON110527880.12
ZYRO0D07062g5.18ON119352880.12
AFR551W8.742ON469153880.12
Suva_2.507.390ON75066880.13
Skud_11.3385.712ON71259880.13
TBLA0E017605.712ON121227880.13
KLTH0E00814g5.712ON97447880.13
CAGL0J11352g2.69ON77166880.14
TBLA0B097602.69ON89866880.15
KNAG0B023707.390ON75339870.15
KLLA0E20351g7.390ON697154870.15
YMR223W (UBP8)8.742ON471101870.16
Ecym_40095.712ON151727870.16
KLLA0C03476g1.137ON1252145870.17
TPHA0E008707.390ON71537870.18
Kpol_1044.242.69ON72466860.19
Kwal_33.144302.69ON51166860.20
SAKL0H00418g5.18ON119049860.21
SAKL0E15136g5.712ON103727860.21
KAFR0C004103.270ON76926860.22
Skud_14.1482.69ON77666860.22
KNAG0L022005.712ON116127860.24
TPHA0P006807.390ON72779850.25
Skud_13.3928.742ON47348850.26
KAFR0D021605.712ON84627850.26
Suva_13.4078.742ON47167850.28
SAKL0E13002g2.69ON73966850.29
TPHA0D043508.202ON85483850.31
NCAS0A039108.188ON79554840.33
CAGL0G02563gsingletonON63126840.33
Kpol_1018.937.390ON75535840.37
YER098W (UBP9)7.390ON75478840.37
CAGL0H06721g5.712ON1081100840.37
KLTH0B07150g2.69ON75666840.40
CAGL0M11198g8.742ON46164830.43
YIL156W (UBP7)5.712ON107126830.45
ZYRO0B03300g7.390ON81366830.47
Smik_9.135.712ON106026830.49
ABR237C8.8ON209125800.51
SAKL0D03322g3.270ON76526830.52
AFR296C5.712ON116927830.56
Suva_9.305.712ON106226830.58
YNL186W (UBP10)2.69ON79266820.60
YKR098C (UBP11)5.712ON717108820.68
Skud_9.125.712ON106426820.71
NCAS0I031401.137ON120171820.73
CAGL0I05522g7.390ON72479810.79
KLTH0H07678g8.188ON86144810.86
KAFR0A042108.742ON44048800.92
TDEL0G004105.18ON118695810.94
Skud_2.387.390ON74869800.96
TDEL0D035503.270ON78099801.0
KAFR0H001505.712ON65627801.0
TBLA0J006001.137ON146237801.1
Kwal_56.230843.270ON76269801.1
Kpol_1045.417.390ON71228801.1
NCAS0B005808.742ON46648791.2
KAFR0B049202.357ON15578761.2
KNAG0G029308.742ON45952791.3
AGR370W7.390ON74035791.3
SAKL0H04994g8.742ON45448791.4
Suva_11.3355.712ON72427781.8
KAFR0C036508.8ON212134761.9
Kwal_27.108427.390ON71138772.2
NDAI0A036808.188ON111686782.2
Smik_11.3625.712ON72140772.5
Suva_6.78.8ON207156752.5
CAGL0H05335g8.540ON48334763.0
Kpol_1068.28.848ON49199763.2
Kwal_14.20088.188ON42451753.2
KLTH0C07326g3.270ON76239763.3
CAGL0I06765g8.188ON88749763.5
TBLA0I006102.521ON912124763.6
TBLA0C005308.97ON483125753.7
TDEL0A016208.202ON79567763.7
KNAG0D019308.188ON986110754.1
KLTH0C06732g7.390ON71447754.3
SAKL0B00638g8.8ON212183734.4
TBLA0D006207.390ON117128754.5
Suva_13.4438.811ON1418100754.9
Kwal_26.91518.742ON45448744.9
TBLA0E025703.270ON78519745.2
Kpol_1064.488.742ON46663735.8
TBLA0D015005.550ON46955736.1
YFL046W (FMP32)8.8ON207156726.1
TPHA0G005608.742ON46363736.6
SAKL0E13926g2.26ON55034737.2
YBR058C (UBP14)3.270ON78123737.3
NCAS0B042808.188ON92251737.8
ZYRO0G06798g8.188ON87742737.8
Kpol_1032.288.188ON88269738.3
Skud_2.1773.270ON782102728.9
Ecym_55448.202ON83465728.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4514
         (1246 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  2439   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1377   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1276   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1182   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1169   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1154   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1148   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1144   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1142   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1132   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...  1120   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1104   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1095   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1094   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1080   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1001   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...   841   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...   791   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...   731   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...   692   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   551   e-174
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   368   e-107
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    57   2e-07
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    54   2e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    54   2e-06
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    52   5e-06
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    52   6e-06
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    51   2e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    50   2e-05
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    50   2e-05
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    49   5e-05
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    49   5e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    49   1e-04
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    48   1e-04
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    47   4e-04
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    46   4e-04
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    46   4e-04
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    45   7e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    45   9e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    45   0.001
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    45   0.001
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    45   0.001
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    45   0.001
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    45   0.001
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    45   0.002
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    45   0.002
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    45   0.002
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     45   0.002
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    44   0.002
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    45   0.002
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    45   0.002
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    44   0.003
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    44   0.003
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    44   0.003
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    44   0.003
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    43   0.004
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    44   0.004
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    43   0.005
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    43   0.006
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    43   0.007
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    42   0.009
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    42   0.010
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    42   0.011
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               42   0.011
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    42   0.011
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    42   0.011
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    42   0.011
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    42   0.013
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    42   0.013
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    42   0.013
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    42   0.014
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    42   0.014
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    42   0.014
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    42   0.014
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    42   0.016
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    42   0.016
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    42   0.016
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    42   0.018
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    42   0.018
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    41   0.018
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    41   0.018
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    41   0.019
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    41   0.021
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    41   0.021
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    41   0.022
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    41   0.022
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    41   0.022
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    41   0.024
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    40   0.025
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    40   0.025
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    41   0.027
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    40   0.027
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    41   0.028
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    40   0.029
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    41   0.030
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    40   0.031
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    40   0.031
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    40   0.032
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    40   0.032
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    40   0.033
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    40   0.034
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    40   0.034
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    40   0.037
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    40   0.039
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    40   0.041
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    40   0.041
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    40   0.046
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    40   0.047
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    40   0.048
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    40   0.049
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    40   0.049
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    40   0.055
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    40   0.058
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    39   0.060
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    39   0.069
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    39   0.070
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    39   0.073
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    39   0.073
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      39   0.076
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    39   0.077
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    39   0.081
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    39   0.086
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    39   0.088
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    39   0.091
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      39   0.091
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    39   0.094
Ecym_1534 Chr1 complement(1097497..1098129) [633 bp, 210 aa] {ON...    38   0.096
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    39   0.096
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    39   0.10 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    39   0.11 
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    39   0.11 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      39   0.12 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    39   0.12 
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    39   0.12 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    39   0.13 
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    39   0.13 
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    39   0.13 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    39   0.13 
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    39   0.14 
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    39   0.15 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.15 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    38   0.15 
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    38   0.16 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    38   0.16 
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    38   0.17 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    38   0.18 
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    38   0.19 
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    38   0.20 
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    38   0.21 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    38   0.21 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    38   0.22 
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    38   0.22 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    38   0.24 
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    37   0.25 
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    37   0.26 
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    37   0.26 
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    37   0.28 
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    37   0.29 
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    37   0.31 
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     37   0.33 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    37   0.33 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    37   0.37 
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    37   0.37 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    37   0.37 
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    37   0.40 
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    37   0.43 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.45 
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    37   0.47 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    37   0.49 
ABR237C Chr2 complement(843933..844562) [630 bp, 209 aa] {ON} Sy...    35   0.51 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    37   0.52 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    37   0.56 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    37   0.58 
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    36   0.60 
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    36   0.68 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    36   0.71 
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    36   0.73 
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    36   0.79 
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    36   0.86 
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    35   0.92 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    36   0.94 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    35   0.96 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    35   1.0  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    35   1.0  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    35   1.1  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    35   1.1  
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    35   1.1  
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       35   1.2  
KAFR0B04920 Chr2 complement(1025332..1025799) [468 bp, 155 aa] {...    34   1.2  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    35   1.3  
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    35   1.3  
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    35   1.4  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    35   1.8  
KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON...    34   1.9  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    34   2.2  
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              35   2.2  
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...    34   2.5  
Suva_6.7 Chr6 (16281..16904) [624 bp, 207 aa] {ON} YFL046W (REAL)      33   2.5  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    34   3.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...    34   3.2  
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    33   3.2  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    34   3.3  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    34   3.5  
TBLA0I00610 Chr9 complement(106947..109685) [2739 bp, 912 aa] {O...    34   3.6  
TBLA0C00530 Chr3 (97938..99389) [1452 bp, 483 aa] {ON} Anc_8.97 ...    33   3.7  
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    34   3.7  
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    33   4.1  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    33   4.3  
SAKL0B00638g Chr2 (61811..62449) [639 bp, 212 aa] {ON} highly si...    33   4.4  
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    33   4.5  
Suva_13.443 Chr13 complement(763923..768179) [4257 bp, 1418 aa] ...    33   4.9  
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    33   4.9  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    33   5.2  
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    33   5.8  
TBLA0D01500 Chr4 (374387..375796) [1410 bp, 469 aa] {ON} Anc_5.5...    33   6.1  
YFL046W Chr6 (42815..43438) [624 bp, 207 aa] {ON}  FMP32Putative...    32   6.1  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    33   6.6  
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    33   7.2  
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    33   7.3  
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     33   7.8  
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    33   7.8  
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    33   8.3  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    32   8.9  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    32   8.9  

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 2439 bits (6320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1187/1246 (95%), Positives = 1187/1246 (95%)

Query: 1    MYQEQADDGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF 60
            MYQEQADDGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF
Sbjct: 1    MYQEQADDGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF 60

Query: 61   VLEGVRGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHS 120
            VLEGVRGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASL        DKHS
Sbjct: 61   VLEGVRGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHS 120

Query: 121  KINVFMGLLCDPMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHP 180
            KINVFMGLLCDPMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHP
Sbjct: 121  KINVFMGLLCDPMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHP 180

Query: 181  ADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSI 240
            ADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSI
Sbjct: 181  ADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSI 240

Query: 241  CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD 300
            CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD
Sbjct: 241  CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD 300

Query: 301  KFGFELCEVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLP 360
            KFGFELCEVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLP
Sbjct: 301  KFGFELCEVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLP 360

Query: 361  KEVVAASSKLRSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYY 420
            KEVVAASSKLRSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYY
Sbjct: 361  KEVVAASSKLRSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYY 420

Query: 421  GDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRL 480
            GDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRL
Sbjct: 421  GDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRL 480

Query: 481  FHIDPSETDPKQIPDEMLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELE 540
            FHIDPSETDPKQIPDEMLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELE
Sbjct: 481  FHIDPSETDPKQIPDEMLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELE 540

Query: 541  PFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNY 600
            PFQQESQAYS              TAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNY
Sbjct: 541  PFQQESQAYSILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNY 600

Query: 601  LLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLK 660
            LLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLK
Sbjct: 601  LLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLK 660

Query: 661  VALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPL 720
            VALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPL
Sbjct: 661  VALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPL 720

Query: 721  RDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSK 780
            RDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSK
Sbjct: 721  RDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSK 780

Query: 781  ERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISIEGSNV 840
            ERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISIEGSNV
Sbjct: 781  ERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISIEGSNV 840

Query: 841  XXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITSTCVAKISPD 900
                             KDE                    NIVEENEPITSTCVAKISPD
Sbjct: 841  ETEAAAEDIIADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPITSTCVAKISPD 900

Query: 901  QLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIE 960
            QLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIE
Sbjct: 901  QLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIE 960

Query: 961  NPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTI 1020
            NPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTI
Sbjct: 961  NPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTI 1020

Query: 1021 LQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAI 1080
            LQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAI
Sbjct: 1021 LQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAI 1080

Query: 1081 KQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDK 1140
            KQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDK
Sbjct: 1081 KQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDK 1140

Query: 1141 ELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRK 1200
            ELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRK
Sbjct: 1141 ELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRK 1200

Query: 1201 YNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLKVYQ 1246
            YNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLKVYQ
Sbjct: 1201 YNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLKVYQ 1246

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1377 bits (3564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/1236 (56%), Positives = 896/1236 (72%), Gaps = 45/1236 (3%)

Query: 22   ESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF-------VLEGVRGNGVLKSP 74
            E   V + GKT+LYP V  N+PFKTSDRLLDDIRS + F       +L     NGVL+ P
Sbjct: 28   EVPPVIDDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRLP 87

Query: 75   MLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMV 134
            ML+YS+++   +  S+GYLLDQV L+T YEY S          + +KINVFMG+L D  +
Sbjct: 88   MLEYSRKKTT-QPCSVGYLLDQVTLKTKYEYES------KTCPELNKINVFMGVLVDQHI 140

Query: 135  KLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDE 194
            +  S DD++N   YHL++TVKTRLHLER K+  G+  YHL++ LH  DKQD+ F   + E
Sbjct: 141  RPESLDDVINVPIYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDI-FMTTESE 199

Query: 195  CVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPN 254
             ++DSATYVSS TNRL+RIEI KPEFT E+ + F+ + +++RY S CEK+ DL+  +VP 
Sbjct: 200  QLVDSATYVSSDTNRLLRIEIFKPEFTKEDLAIFSQEKVKERYASACEKFQDLDPTSVPT 259

Query: 255  QAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEV-QEED 313
            Q ECLNTLFK+FK PL+R+ S+D LKTISA+NK LNSQ+DP+WL +K+ F+L E   EE 
Sbjct: 260  QVECLNTLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEET 319

Query: 314  GRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKLRSF 373
            G    E++PPD T+YV DW+VR  RE Y RK LEL+F+GK S +LLPK++++  SK RSF
Sbjct: 320  GELIREFEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKSRSF 379

Query: 374  QLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQI 433
             LYQT+FS +FWF LLG+  RN  +   Q P+D + HFINLS + YY D+DII+NYE+QI
Sbjct: 380  NLYQTNFSTSFWFHLLGD-GRNFQDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQI 438

Query: 434  LLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQI 493
             LDP+N GIY+D L +IAN KG +QL+ +  KQNIVG+EAL+ AL +F ID  +TD K I
Sbjct: 439  SLDPENVGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKSI 498

Query: 494  PDEMLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXX 553
             DE+LLS YK E K  + ++  DL+NALRLLAK+K+S+KLKF+V+ EP+   S+AY    
Sbjct: 499  TDELLLSIYKNELKAASVQKRTDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAYQLLE 558

Query: 554  XXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYH 613
                       TAYTI+V+DAPGLK+DCDRALYTLA+AKRS+ LFN+L Q CP FQ+FY+
Sbjct: 559  IGESVDLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQEFYN 618

Query: 614  ISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSK 673
            I  WSY  AL  LQVN NATDD+ILEIF+RKW++EP+ SPDQFL LK AL K+  ERNSK
Sbjct: 619  IDNWSYKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIERNSK 678

Query: 674  LINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASD 733
            LIN+F++TGI+D + L +GNWPTGLNNIGNTCYLNSLLQYYF+ISPLRDY+ NY+   + 
Sbjct: 679  LINNFIDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQKMLNC 738

Query: 734  LL-LNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAY 792
               +     G ++KRRIG R V+KPEVERSVQFVYQLRDLF DM H+KER VTP++ELAY
Sbjct: 739  FRDIEDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTKELAY 798

Query: 793  LSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDT---EVFDISIEGSNVXXXXXXXXX 849
            L+F+PS   VEFE+        T   +  E  +E T   ++ D++ +G +          
Sbjct: 799  LAFAPSNIEVEFEAP-------TITTVAPEDLDERTNKLDIIDLAADGIDNETEKGSKSS 851

Query: 850  XXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITSTC-VAKISPDQLENTLEI 908
                    K E                       +E E + ++  VAKIS DQLENTLE+
Sbjct: 852  LLDVHNQQKPEEQTEDIIMGG------------TQEEEAVNASMRVAKISSDQLENTLEL 899

Query: 909  GRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIENPEKRRTK 968
            GRQQDVTECIGNVL+Q+ESAS P + +E +EQ+DL+K+LFYGK+KQ LIP++NP K RTK
Sbjct: 900  GRQQDVTECIGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTK 959

Query: 969  FERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQRV 1028
             ERF+SLLVN+GDHPKDIYDALDLYF+DDLL L D++  V+R+VAV  LP ILQIQIQRV
Sbjct: 960  IERFVSLLVNIGDHPKDIYDALDLYFKDDLLQL-DEDGEVKRTVAVTNLPKILQIQIQRV 1018

Query: 1029 YYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKIL 1088
            YYDRE+ MPFKS EPLPF E +YMDRYM + +  +LAK+ ++ +L E L A+K R+ ++L
Sbjct: 1019 YYDRERFMPFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLL 1078

Query: 1089 SKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRN-LIKQLDSFSLEIDKELSNLDD 1147
            SKND GL+ K SL +TK FL+S VL + E  I +E +  L+  +DS   +ID ELS+L  
Sbjct: 1079 SKNDTGLSFKGSLLQTKKFLQSEVLDKHE--IAVENKGALVCHIDSMITKIDGELSSLYQ 1136

Query: 1148 KIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVT 1207
            KI  +E  I+++F++FT  GY+LFA FIHRGEASYGHYW+YIKDRK +GIWRKYNDESVT
Sbjct: 1137 KITALEVQIANQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVT 1196

Query: 1208 EVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            EVP+SEVF+FTE NTATPYFLVYIK+GHE EIEPLK
Sbjct: 1197 EVPQSEVFNFTEGNTATPYFLVYIKEGHEDEIEPLK 1232

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1276 bits (3302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1227 (53%), Positives = 854/1227 (69%), Gaps = 46/1227 (3%)

Query: 26   VREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF-------VLEGVRGNGVLKSPMLDY 78
            +++ GKT+LY      +PFKTS+RLLDDI+  L++       +L      GVL+ P+L+Y
Sbjct: 34   IKDTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELHKGVLRLPILEY 93

Query: 79   SKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMVKLCS 138
            S++  +   ++IG+L+DQV+L+T YEY S            +KI VFMG+L +       
Sbjct: 94   SRKPTD-DVYNIGHLVDQVVLKTRYEYDS------KTCPGLNKITVFMGVLLNSSQMPKI 146

Query: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVID 198
             DD+   S YHL+VTVKTRLHLER ++Q G+ QYHL+ +LHP DK+DL   + +D  +ID
Sbjct: 147  YDDVTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLLLTDAEDPHLID 206

Query: 199  SATYVSSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAEC 258
            S  YVSS TN+L+ IEI KPEF+  + +EF PD+I+KRY S C+KYPDL+ + +P+QAEC
Sbjct: 207  SVMYVSSDTNKLICIEIFKPEFSQADLTEFCPDAIKKRYSSACDKYPDLDPDMIPSQAEC 266

Query: 259  LNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQEED-GRKE 317
             +TL K+FK PL+R+  +D LKTISA+NK LNSQLDP WL +KF F+LC+  + D     
Sbjct: 267  FSTLLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLCQANDTDEAGSA 326

Query: 318  YEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKLRSFQLYQ 377
             E++PPD TNYV+D +VR LRE Y RK LEL+F+GK S  L+ KE +A  S+ RSFQLYQ
Sbjct: 327  MEFQPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKDSRARSFQLYQ 386

Query: 378  THFSHTFWFQLLGEF-DRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQILLD 436
            T  S +F+F LL E     D+  Q+    D N +F+NLS  YYY D+DII+NYE+Q LLD
Sbjct: 387  TSNSLSFFFHLLNETRGVMDYGSQE---IDRNYNFMNLSSCYYYTDKDIIKNYETQALLD 443

Query: 437  PKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIPDE 496
             +N GIY+D LT+IAN+KGS+ L+ +  KQ++VG+EAL+SAL LF IDPS+T    IPDE
Sbjct: 444  RENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDPSDTSLMTIPDE 503

Query: 497  MLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXXXXX 556
            +LL  Y++EC  G+T++HA L+NALRLLAK K S  L+FY   EP+    QAYS      
Sbjct: 504  LLLGVYRKECSQGSTQKHATLKNALRLLAKAKNSSTLQFYAAYEPYDNVHQAYSLLEVDE 563

Query: 557  XXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHISY 616
                    TAYTIKV+D+PGLK+DCDRA+YTLA+ KRSM LFN+L+++CP F++FY    
Sbjct: 564  SVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQCPVFEEFYSADK 623

Query: 617  WSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLIN 676
             +Y  AL  LQVN NA+DD+ILE+F+RKW  E V+SPDQFL    AL KI   RNS LIN
Sbjct: 624  LTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTKIGQVRNSLLIN 683

Query: 677  HFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLL 736
             +LETG ID   L + NWPTGLNNIGNTCYLNSLLQYYF ISPLR +I +Y+ T ++   
Sbjct: 684  RYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQKTLAEFHD 743

Query: 737  NMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFS 796
            ++   G  +KRRIGGR V++ EVERSVQFVYQLRDLF DM H++ R VTP +ELAYL+F+
Sbjct: 744  SIGNLG--SKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFVTPRKELAYLAFA 801

Query: 797  PSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISIEGSNVXXXXXXXXXXXXXXXX 856
            PS   VEFE          T+   +E    D EV D++ EG                   
Sbjct: 802  PSNIEVEFEGTP-------TVEPAKENSENDVEVIDLTAEGEASEDVDML---------- 844

Query: 857  XKDEXXXXXXXXXXXXXXXXXXXXNIVEENEP-ITSTCVAKISPDQLENTLEIGRQQDVT 915
                                    N V   EP ++ST VAKIS DQLEN LE+GRQQDVT
Sbjct: 845  ----KPAESETQVVTTQLNEDTVMNDVIATEPMVSSTRVAKISTDQLENALEMGRQQDVT 900

Query: 916  ECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIENPEKRRTKFERFMSL 975
            ECIGNVL+Q+ESAS P+N D   EQ DL+K+LF+GKLKQDL P+++P K RTK ERF+SL
Sbjct: 901  ECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSKIRTKIERFVSL 960

Query: 976  LVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVYYDREKL 1035
            LVNVGDHPK++YDALD YF+DD+L L D +  V+R++A++ELP +LQIQIQRVYYDREK 
Sbjct: 961  LVNVGDHPKNVYDALDQYFKDDVLQLEDGD--VKRTLAIKELPVVLQIQIQRVYYDREKF 1018

Query: 1036 MPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGL 1095
            MPFKS EPLPF + +YMDRYM + ++E+  K+QE+ +    LE++K R+K +L KN  G+
Sbjct: 1019 MPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQKALLEKNGNGM 1078

Query: 1096 TLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENS 1155
            + K SL ET+ FLES VL ++  +I+ +K + +K ++S  L+ID ELS +  +I  ++  
Sbjct: 1079 SFKTSLLETERFLESGVLEQNAIEIQ-KKDSALKAIESMLLKIDNELSEIYSRITALDQK 1137

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            +S  FD F   GY+LFAVFIHRGEASYGHYW+YIKD   +GIWRKYNDE+VTE PE+EVF
Sbjct: 1138 LSSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVF 1197

Query: 1216 DFTEDNTATPYFLVYIKDGHEHEIEPL 1242
            +FTE NTATPYFLVY+K+GHE EI+PL
Sbjct: 1198 NFTEGNTATPYFLVYVKNGHESEIQPL 1224

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1182 bits (3057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/1231 (50%), Positives = 825/1231 (67%), Gaps = 36/1231 (2%)

Query: 27   REGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV-------LEGVRGNGVLKSPMLDYS 79
            R+ GK VLY  VS  +PFKTSDRLLDD+   L+F+       L     NG+LK+P+L YS
Sbjct: 58   RDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYS 117

Query: 80   KERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCD-PMVKLCS 138
            +   +L  +S G L+DQ+ LQTS+EY S+          H+K+NV+MG+L D P     +
Sbjct: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCP------GHNKLNVYMGVLIDVPHDYKIT 171

Query: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVN--DLHPADKQDLCFFEDDDECV 196
               +   + YHL+VTVKTR  LE  K++ G+  YH ++  DLH  D+QDL F +  D  +
Sbjct: 172  SSTLSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEF-DPTDPRL 230

Query: 197  IDSATYVSSGTNRLVRIEILKPEFTAEEWSE-FTPDSIRKRYLSICEKYPDLNRENVPNQ 255
            +D A YVSS TN+LV IE+  PEF  EE +E ++  +I+ RY   C+++  L+   +P Q
Sbjct: 231  VDHAIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQ 290

Query: 256  AECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFEL-CEVQEEDG 314
            A+C+NTL K+F+ PL+RQ+S++ LKTI+++N VLNS+++PNWL  K+GFEL  E  E  G
Sbjct: 291  ADCINTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTG 350

Query: 315  RKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKLRSFQ 374
               +E++PP+ TNY+ D  VR LRE +IRK +EL+F+GK +I LL K+    S   R+F 
Sbjct: 351  ESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFN 410

Query: 375  LYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQIL 434
              Q  FS T WF++LGE  R+ F+ +   P D N +FINLS  +YY DRDII+NYE+Q  
Sbjct: 411  AIQIAFSKTTWFKMLGEH-RSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCA 469

Query: 435  LDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIP 494
            LDP+N GIY+D LT+IAN KG++QL+ +  KQ++VGQEAL+ AL+LF ID  + D   I 
Sbjct: 470  LDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATID 529

Query: 495  DEMLLSCYKEECKYG-NTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXX 553
            D +L+S YK E     N  +H DL+NALRLLAKYK+S+KLKF+ + EP++  S+AY    
Sbjct: 530  DSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILE 589

Query: 554  XXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYH 613
                       TAY+I ++D+PGLK+DCDRALYT+ + KRS+ L NYLLQ+CP FQ +Y 
Sbjct: 590  VDESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYG 649

Query: 614  ISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSK 673
                 Y+ AL  LQ+N NA D+ +LE+F+RKW +E     D  L LK AL KI  ERNSK
Sbjct: 650  PGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSK 709

Query: 674  LINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASD 733
            LI HF++TG ID + L + NWPTGLNNIGNTCYLNSLLQYYF+++PLR Y+  Y++T   
Sbjct: 710  LILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQET--- 766

Query: 734  LLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYL 793
             + +         RRIGGR V++ EVERSVQFVYQLRDLF  M +SKERCVTP +ELAYL
Sbjct: 767  -MEHFRHHTGNELRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYL 825

Query: 794  SFSPSTTNVEFESAAQVPFRDTTILLEQEPPN-EDTEVFDISIEGSNVXXXXXXXXXXXX 852
            +F+PS   VEFE         TT+  + E     ++   DI + G               
Sbjct: 826  AFAPSNFEVEFEP--------TTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIEL 877

Query: 853  XXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITSTCVAKISPDQLENTLEIGRQQ 912
                  ++                    +  ++N   TST VAKIS DQLEN LE+GRQQ
Sbjct: 878  DSDSGNEDIDVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQ 937

Query: 913  DVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIENPEKRRTKFERF 972
            DVTECIGNVL+Q+ESAS P+N DE +EQ DLVKQLFYGK+KQ +IP+    + +TK ER+
Sbjct: 938  DVTECIGNVLFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERY 997

Query: 973  MSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVYYDR 1032
            +SLLVN+GDHPKDIYDALD YF D+ L +  +   V+R+VAV E PTILQIQIQRVYYDR
Sbjct: 998  LSLLVNIGDHPKDIYDALDSYFSDERLTMA-EYGDVKRTVAVTEFPTILQIQIQRVYYDR 1056

Query: 1033 EKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKND 1092
            E+ MPFKS EPLPF E LYMDRY  S + +++ KK+ES QL   L  +K R+K++LS N+
Sbjct: 1057 ERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNE 1116

Query: 1093 AGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDM 1152
             GL+ K +  ET  +L+S ++   E K  +    LI+QL     +ID+EL++L   I  +
Sbjct: 1117 LGLSRKAAYMETINYLKSDLIKSQELK-GLNNDFLIEQLKQSIADIDQELTSLYHDIAKL 1175

Query: 1153 ENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPES 1212
            EN+I  +F++F   GY+LFAVFIHRGEASYGHYWVYIKDR  +G WRKYNDE++TEVPE+
Sbjct: 1176 ENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPET 1235

Query: 1213 EVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            EVF+FTE NTATPYFLVY++ GHEH+IEPLK
Sbjct: 1236 EVFNFTEGNTATPYFLVYVRQGHEHDIEPLK 1266

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1243 (49%), Positives = 816/1243 (65%), Gaps = 57/1243 (4%)

Query: 28   EGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF-------VLE-GVRGNGVLKSPMLDYS 79
            + GK +LYP ++   P KTSDRLLDDI    +F       V+E G++ +G+LK  ML YS
Sbjct: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113

Query: 80   KERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMV---KL 136
              R  +R  ++G L DQV+LQT  EY S+         +++KI V   ++ +P +   ++
Sbjct: 114  NFRSRIRPDALGSLTDQVVLQTKTEYDSISCP------QYNKIQVLQAVIFNPSLPEQQI 167

Query: 137  CSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECV 196
             + DDIV    YHL+VTVK R  LER K+  G+ Q+H ++ LH  D  DL  F+  D  +
Sbjct: 168  AAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNL 227

Query: 197  IDSATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQ 255
             D   YVS  TN+L+ IEI  PEF + EE   FT  +I+KRY  +C K   LN    P+Q
Sbjct: 228  KDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQ 287

Query: 256  AECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELC-EVQEEDG 314
             +C  TLFK+FK PL+R+ + D +KTI + N VLN+ L+P WL  K+GF+   E+ EE  
Sbjct: 288  PDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETN 347

Query: 315  RKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL-PKEVVAASSKLRSF 373
                EY PPD  +YV DW +R +RE Y+RK L+L+F G+ S  LL P  ++  +  ++  
Sbjct: 348  ESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGL 407

Query: 374  QLYQTHFSHTFWFQLLGEFDRN---DFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYE 430
               QT FS   WFQLLGE       +FN+Q   P D  PHFINLSV++YY DRDIIRNYE
Sbjct: 408  SSIQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYE 467

Query: 431  SQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDP 490
            +   LDP+N G+Y+D LT+IAN KG++Q++ +  KQ+I+GQEAL +AL +F IDP + D 
Sbjct: 468  ALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDI 527

Query: 491  KQIPDEMLLSCYKEECKYGN---TRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQ 547
             ++ +  LLS YK E    N   +    +L+NALRLLAKY +S+KLKFYV+ EP++  SQ
Sbjct: 528  AELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQ 587

Query: 548  AYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPR 607
            AY               TAY+IK++D+PGLK+DCDRALYT+AI+KRS+DLFN+L   CP+
Sbjct: 588  AYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQ 647

Query: 608  FQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIA 667
            FQ +Y      Y  AL+ LQVN NA+D+ IL+IF+ KW +E V  PDQFL LK AL KI+
Sbjct: 648  FQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKIS 707

Query: 668  HERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
             ERNS LI +FL TG ID N L   NWPTG+NNIGNTCYLNSLLQYYF+I+PLR YI NY
Sbjct: 708  IERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767

Query: 728  EDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPS 787
            + T ++   N + S +   RR+GGR +++ EVERS+QF++QLR+LF  M HS+ERCVTPS
Sbjct: 768  QKTLNN--FNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPS 825

Query: 788  RELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPN------EDTEVFDISI-EGSNV 840
            +ELAYL+F+PS   VEFE        D TIL E+E         +D  + D  + E +N 
Sbjct: 826  KELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTN- 884

Query: 841  XXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITSTCVAKISPD 900
                             KDE                    ++       + T VAKIS D
Sbjct: 885  -------------GDVEKDENNHEKTESNDVEIIMTDDATDLA------SPTRVAKISSD 925

Query: 901  QLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIE 960
            QLEN LE+GRQQDVTECIGNVL+QIES S P+ +DE +EQYDL+KQLFYG  KQ ++P+ 
Sbjct: 926  QLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLS 985

Query: 961  NPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTI 1020
              +K RTK ERF+SLLVN+GDHPKDIYDA D YFRD+ L +  +   V+R+VAV   PTI
Sbjct: 986  ATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMA-EYGDVKRTVAVTTFPTI 1044

Query: 1021 LQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAI 1080
            LQ+QIQRVYYDRE+ MPFKS EPLPF E +YMDRY  +    LLAKK+E+ QL +  + +
Sbjct: 1045 LQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDM 1104

Query: 1081 KQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDK 1140
            K R++++L+++ +GLT KD+  ET   LESS++  +   I  +K+NLIK L +   +ID 
Sbjct: 1105 KNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIE-DKKNLIKTLKNKVTDIDN 1163

Query: 1141 ELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRK 1200
            EL +L   I  +E+ ISH+FD F  +GY+LF+VFIHRGEASYGHYW+YIKDR  +G+WRK
Sbjct: 1164 ELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRK 1223

Query: 1201 YNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            YNDE+++EVPE EVF+F E NTATPYFLVY+K G E +IEPLK
Sbjct: 1224 YNDETISEVPEEEVFNFNEGNTATPYFLVYVKQGQEADIEPLK 1266

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1256 (48%), Positives = 817/1256 (65%), Gaps = 51/1256 (4%)

Query: 13   LVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF--------VLEG 64
            L G  + +  + G  + GK +LYP ++ N P KTSDRLLDDI     F        + +G
Sbjct: 39   LYGTSINQQSTPGDVDDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKG 98

Query: 65   VRGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINV 124
            ++  G+LK  ML YS  R  +R   +G L DQV+ QT  EY S+         K++KI+V
Sbjct: 99   LQSRGILKESMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCP------KYNKIHV 152

Query: 125  FMGLLCDPMV---KLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPA 181
            F  ++ +P +   ++ + DDIV    YHL+V+VK R  LER K+  G+ Q+H ++ LH  
Sbjct: 153  FQAVIFNPSLAEQQISTFDDIVKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEY 212

Query: 182  DKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTA-EEWSEFTPDSIRKRYLSI 240
            D+ DL  F+  D  ++D   YVS  TN+L+ IEI KPEF + EE   FT D+I+KRY ++
Sbjct: 213  DRVDLSTFDSSDPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAM 272

Query: 241  CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD 300
            C K   L++   P+Q +C  TLFK+FK PL+R+   +  KTI + N  LN+ L+P WL  
Sbjct: 273  CVKNESLDKSETPSQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTS 332

Query: 301  KFGFELC-EVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL 359
            K+GF+   E+ EE      EY PPD  +YVND   R +RE ++RK L+L+F G+ S  LL
Sbjct: 333  KYGFQASSEIDEETNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLL 392

Query: 360  -PKEVVAASSKLRSFQLYQTHFSHTFWFQLLGEFDRN---DFNQQQQHPYDTNPHFINLS 415
             P   +  +  ++     QT FS   WF LLGE       + N+Q   P D  PHFINLS
Sbjct: 393  APNSPLKNTKSVKGMSSLQTSFSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLS 452

Query: 416  VNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALN 475
            V++YY DRDIIRNYES   LDP+N G+Y+D LT+IAN KG++QL+ +  KQ+I+GQEAL 
Sbjct: 453  VSHYYTDRDIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALE 512

Query: 476  SALRLFHIDPSETDPKQIPDEMLLSCYKEEC--KYGNTRQH-ADLRNALRLLAKYKQSEK 532
            +AL +F I+P E +  ++ +  LLS YK E   K   T  H  +L+NALRLLAKY +S+K
Sbjct: 513  NALLMFKINPKECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDK 572

Query: 533  LKFYVELEPFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAK 592
            LKFYV+ EP++  SQAY               TAY++K++D+PGLK+DCDRALYT+AI+K
Sbjct: 573  LKFYVDHEPYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISK 632

Query: 593  RSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVIS 652
            RS+DLFN+L + CP+F  +Y      Y  AL+ LQVN NA+D+ IL+IF++KW +E V  
Sbjct: 633  RSLDLFNFLTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYE 692

Query: 653  PDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQ 712
            PDQFL L+ AL KI+ ERNS LI +FL TG ID N L   NWPTG+NNIGNTCYLNSLLQ
Sbjct: 693  PDQFLILRAALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQ 752

Query: 713  YYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDL 772
            YYF+I+PLR Y+  Y+ T  +   +++ SG +  RRIGGR +++ EVERS+QF+YQLR+L
Sbjct: 753  YYFSIAPLRRYVLEYQKTVENFNDHLSNSGHI--RRIGGREISRGEVERSIQFIYQLRNL 810

Query: 773  FNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFD 832
            F  M H++ERCVTPS+ELAYL+F+PS   VEFE         T +L + +    D + F 
Sbjct: 811  FYAMVHTRERCVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTD-DAFT 869

Query: 833  ISIEGSNVXXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITS- 891
              I+ +++                   E                      V ENE  T  
Sbjct: 870  TKIKDTSLIDLEM--------------EDGLNGDVGTDANRKKNESNDAEVSENEDTTGL 915

Query: 892  ---TCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLF 948
               T VAKIS DQLEN LE+GRQQDVTECIGNVL+QIES S P+ +DE +EQYDLVKQLF
Sbjct: 916  TSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLF 975

Query: 949  YGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARV 1008
            YG  KQ ++P+    K RTK ERF+SLL+N+GDHPKDIYDA D YF+D+ L + ++   V
Sbjct: 976  YGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTM-EEYGDV 1034

Query: 1009 RRSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQ 1068
             R+VAV   PTILQ+QIQRVYYDRE+LMPFKS EPLPF E +YMDRY  +    LLAKK+
Sbjct: 1035 IRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKK 1094

Query: 1069 ESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRN-L 1127
            E+ ++ + L+ +K R++++LS++D+GLT KD+  E+   LES  + ++   ++IE  N +
Sbjct: 1095 ETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKT--PLKIEAANDV 1152

Query: 1128 IKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWV 1187
            IK L +    ID EL  L + I  +E  ISH+FD F  +GY+LF+VFIHRGEASYGHYW+
Sbjct: 1153 IKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWI 1212

Query: 1188 YIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            YIKDR  +GIWRKYNDE+++EV E EVF+F E NTATPYFLVY+K G E +IEPLK
Sbjct: 1213 YIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQEGDIEPLK 1268

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1148 bits (2970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/1240 (49%), Positives = 817/1240 (65%), Gaps = 53/1240 (4%)

Query: 30   GKTVLYPLVSGNYPFKTSDRLLDDI-------RSTLSFVLE-GVRGNGVLKSPMLDYSKE 81
            GK +LYP ++ + P KTSDRLLDDI        ST   V+E G++  G+L+  ML YS  
Sbjct: 56   GKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSF 115

Query: 82   RGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMVK---LCS 138
            R  +R  ++G + DQV++QT  EY S          K++KI+VF  ++ +P +    + S
Sbjct: 116  RSSIRPNALGSVTDQVVIQTKIEYDSYSCP------KYNKIHVFQAVILNPSLTEQHVSS 169

Query: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVID 198
             DDIV    YHL+VTVK R  LER K+  G+ Q+H ++ LH  D+ D   F+  D  ++D
Sbjct: 170  FDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMD 229

Query: 199  SATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAE 257
               YVS  TN+L+ IEI KPEF + EE   FT ++I++RY  +C     L++ N P+QA+
Sbjct: 230  YGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQAD 289

Query: 258  CLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELC-EVQEEDGRK 316
            C  TLFK+FK PL+R+   + +KTI + N  LN+ L+P WL  K+GF++  E+ EE   +
Sbjct: 290  CFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNER 349

Query: 317  EYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL-PKEVVAASSKLRSFQL 375
              EY PPD  +YV+D  VR +RE ++RK L+LLF G+ S  LL P   +  +  ++    
Sbjct: 350  FTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSC 409

Query: 376  YQTHFSHTFWFQLLGEF-DRNDFNQQQQH-PYDTNPHFINLSVNYYYGDRDIIRNYESQI 433
             QT FS   WF LLGE   R   N  + H P D  PHF+NLSV++YY DRDIIRNYES  
Sbjct: 410  LQTSFSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLS 469

Query: 434  LLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQI 493
             LDPKN G+Y+D LT+IAN KG++QL+ +  KQ+I+GQEAL +AL +F I+P E +  ++
Sbjct: 470  SLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAEL 529

Query: 494  PDEMLLSCYKEEC--KYGNTRQH-ADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYS 550
             +  LLS YK E   K   T  H  +L+NALRLLAKY +S+KLKFYV+ EP++  SQAY 
Sbjct: 530  NEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYD 589

Query: 551  XXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQ 610
                          TAY++K++D+PGLK+DCDRALYT+AI+K+S+DLFN+L   CP+F  
Sbjct: 590  TLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLT 649

Query: 611  FYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHER 670
            +Y      Y  AL+ LQVN NA+D+ IL+IF++KW +E V  PDQFL LK AL KI+ ER
Sbjct: 650  YYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIER 709

Query: 671  NSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDT 730
            NS LI++FL TG ID N L   NWPTG+NNIGNTCYLNSLLQYYF+I+PLR YI +Y+ T
Sbjct: 710  NSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKT 769

Query: 731  ASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSREL 790
              +   +++ SG +  RRIGGR ++K EVERSVQF+YQLR+LF  M HS+ERCVTPS+EL
Sbjct: 770  VENFNDHLSNSGHV--RRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKEL 827

Query: 791  AYLSFSPSTTNVEFESAAQVPFRDTTIL--LEQEPPNED--TEVFDISIEGSNVXXXXXX 846
            AYL+F+PS   VEFE     P     I   L++E   E   T+  D    GS +      
Sbjct: 828  AYLAFAPSNIEVEFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKM------ 881

Query: 847  XXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPI---TSTCVAKISPDQLE 903
                       +D                      IV  ++     + T VAKIS DQLE
Sbjct: 882  -----------EDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLE 930

Query: 904  NTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIENPE 963
            N LE+GRQQDVTECIGNVL+QIES S P+ +DE +EQYDLVKQLFYG  KQ ++P+    
Sbjct: 931  NALEMGRQQDVTECIGNVLFQIESGSEPIKYDEDNEQYDLVKQLFYGTTKQSIVPLSATN 990

Query: 964  KRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQI 1023
            K RTK ERF+SLL+N+GDHPKDIYDA D YF+D+ L + ++   V R+VAV   PTILQ+
Sbjct: 991  KVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTM-EEYGDVTRTVAVTTFPTILQV 1049

Query: 1024 QIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQR 1083
            QIQRVYYDRE+ MPFKS EPLPF E +YMDRY  +    LLAKK E+ ++ + L  +K R
Sbjct: 1050 QIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNR 1109

Query: 1084 RKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELS 1143
            ++++LS++++GLT KD+  E+   LESSV+ ++  K  + K ++I  L +    ID EL 
Sbjct: 1110 QRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEV-KIDVINTLRTNVNNIDNELM 1168

Query: 1144 NLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYND 1203
            +L + I ++E  ISH+FD F  +GY+LF+VFIHRGEASYGHYW+YIKDR ++G+WRKYND
Sbjct: 1169 SLYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYND 1228

Query: 1204 ESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            E+V+EV E EVF+F E NTATPYFLVY+K G E +IEPLK
Sbjct: 1229 ETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLK 1268

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/1250 (48%), Positives = 817/1250 (65%), Gaps = 67/1250 (5%)

Query: 30   GKTVLYPLVSGNYPFKTSDRLLDDI-------RSTLSFVLE-GVRGNGVLKSPMLDYSKE 81
            GK +LYP ++ + P KTSDRLLDD+        ST   V+E G++ +G+L+  ML YS  
Sbjct: 56   GKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSF 115

Query: 82   RGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMV---KLCS 138
            R  +R  ++G L DQV +QT  EY S+         +++KI VF  ++ +P +   ++ S
Sbjct: 116  RSSIRPNALGSLTDQVTIQTKTEYDSISCP------RYNKIYVFQAVILNPSLSEQQISS 169

Query: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVID 198
             DDIV    YHL+VTVK R  LER K+  G+ Q+H ++ LH  D+ DL  F+  D  ++D
Sbjct: 170  FDDIVRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMD 229

Query: 199  SATYVSSGTNRLVRIEILKPEFTA-EEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAE 257
               YVS  TN+L+ IEI +PEF + EE   FT D+I+KRY  +C K   LN++  P+Q +
Sbjct: 230  YGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPD 289

Query: 258  CLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELC-EVQEEDGRK 316
            C  TLFK+FK PL+R+  ++ +KTI + N VLN+ L+  WL  K+GF+   E+ EE    
Sbjct: 290  CFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDP 349

Query: 317  EYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL-PKEVVAASSKLRSFQL 375
              EY PPD   YV DWN R +RE +++K L+L+F G+ S  LL P   +  +  ++    
Sbjct: 350  FTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSS 409

Query: 376  YQTHFSHTFWFQLLGEFDRN---DFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQ 432
             QT FS + WF LLGE       + N+Q   P D   HFINLSV++YY DRDIIRNYE+ 
Sbjct: 410  LQTSFSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEAL 469

Query: 433  ILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQ 492
              LDP N G+Y+D LT+IAN KG++QL+ +  KQNI+GQEAL +AL  F IDP E +  +
Sbjct: 470  SSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAE 529

Query: 493  IPDEMLLSCYKEEC--KYGNTRQH-ADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAY 549
            + +  LLS YK E   K   T  H  + +NALRLLAKY +S+KLKFYV+ EP++  SQAY
Sbjct: 530  LNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 589

Query: 550  SXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQ 609
                           TAY+IK++D+PGLK+DCDRALYT+AI+KRS+DLFN+L   CP+F 
Sbjct: 590  DTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFL 649

Query: 610  QFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHE 669
            ++Y      Y  AL+ LQVN NA+D+ +L+IF++KW +E V  PDQFL L+ AL +I+ E
Sbjct: 650  KYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIE 709

Query: 670  RNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYED 729
            RNS LI +FL TG ID N L   NWPTG+NNIGNTCYLNSLLQYYF+I+PLR YI  Y+ 
Sbjct: 710  RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQK 769

Query: 730  TASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRE 789
            T  +   +++ SG +  RRIGGR +++ EVERS+QF+YQLR+LF  M HS+ERCVTPS+E
Sbjct: 770  TLDNFNDHLSNSGHV--RRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKE 827

Query: 790  LAYLSFSPSTTNVEFE----------------SAAQVPFRDTTILLEQEPPNEDTEVFDI 833
            LAYL+F+PS   VEFE                S  +V     T   E++P   D E+ D 
Sbjct: 828  LAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDK 887

Query: 834  SIEGSNVXXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITSTC 893
            +   S+V                 KD                     NI +   P   T 
Sbjct: 888  T--NSDV----------------DKDIENVKANEANEANDIEITVGENITDLASP---TR 926

Query: 894  VAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLK 953
            VAKI  DQLEN LE+GRQQDVTECIGNVL+QIES S P+ +DE +EQYDL+KQLFYG  K
Sbjct: 927  VAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTK 986

Query: 954  QDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVA 1013
            Q ++P+   +K RTK ERF+SLLVN+GDHPKDIYDA D YF+D+ L + ++   V+R+VA
Sbjct: 987  QSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTM-EEYGDVKRTVA 1045

Query: 1014 VEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQL 1073
            V   PTILQ+QIQRVYYDRE+ MPFKS EPLPF E +YMDRY  +    LLAKK+E+ Q+
Sbjct: 1046 VTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQM 1105

Query: 1074 HETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDS 1133
             + L+ +K R++++L ++++GLT KD+  E+   LES+++  +E     + +++I+ L S
Sbjct: 1106 KQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIVV-TEASNSEDNKDVIRILKS 1164

Query: 1134 FSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRK 1193
              ++ID EL +L + I  +E+ ISH+FD F  +GY+LF+VFIHRGEASYGHYW+YIKDR 
Sbjct: 1165 NIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRN 1224

Query: 1194 NSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
              G+WRKYNDE+++EV E EVF+F E NTATPYFLVY+K G E +IEPLK
Sbjct: 1225 YGGVWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQESDIEPLK 1274

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1243 (49%), Positives = 820/1243 (65%), Gaps = 40/1243 (3%)

Query: 26   VREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV------------LEGVRGNGVLKS 73
            V + GK +LYP V  ++P KT++RL+DDI + LSF+            ++ + GNG+LK 
Sbjct: 34   VADDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDTMLGNGILKQ 93

Query: 74   PMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPM 133
             ML+YSK + +  ++ +G L+DQV LQT YEY S+         + +K+ VF G+L +  
Sbjct: 94   SMLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCP------ELNKLQVFFGVLFNNS 147

Query: 134  VKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDD 193
             ++ + D++  +  YHL+VTVKTR HLE  K+  G+ Q+HLV+ LH  DKQD+  F  +D
Sbjct: 148  TQITNLDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPED 207

Query: 194  ECVIDSATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRENV 252
              ++D A YVS+ TN+L+ IE+ KPEF +A+E   F  ++I +RY   CE++  LN    
Sbjct: 208  PNLLDYAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEP 267

Query: 253  PNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQEE 312
            P Q +CLNTLFKVFK PLSR+ SD+  KTI + NK LNS ++P WL  K+GF +  V +E
Sbjct: 268  PTQLDCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNI--VVDE 325

Query: 313  D---GRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSK 369
            D    ++  EY+PP+  NYV D+ VR LRE YIR+ L+L+F GK SI L   +    +SK
Sbjct: 326  DLPNAQQSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSK 385

Query: 370  -LRSFQLYQTHFSHTFWFQLLGEFDRNDF-NQQQQHPYDTNPHFINLSVNYYYGDRDIIR 427
              +S    QT+F+ T   QL     +N     + + P D N HFINLS  Y+Y DRD+IR
Sbjct: 386  SYKSINALQTNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIR 445

Query: 428  NYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSE 487
            NYE    LDP+N G+Y+D L +IAN KGS+QL+ +  KQ+IVGQEAL+ AL+ F++DP E
Sbjct: 446  NYERLCHLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPME 505

Query: 488  TDPKQIPDEMLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQ 547
             D  +I D +LL+ YK E K   T    +L+NA+RL AK K S KLKFY++ EP+++ +Q
Sbjct: 506  VDITKINDSVLLTLYKNELKIS-TSDIPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQ 564

Query: 548  AYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPR 607
            AY               TAY IKV D+PGL +DCDRALYT+AI KRS+ LF +L++RCP 
Sbjct: 565  AYETLDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPD 624

Query: 608  FQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIA 667
            FQ++Y    ++Y  AL   QVN NA D+LI++ F+ +W  E V  P+ F+    AL++I 
Sbjct: 625  FQEYYCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIG 684

Query: 668  HERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
             +RNS LI++FL+TG ID N L   +WP G+NNIGNTCYLNSLLQYYF+I+PLR+Y+  Y
Sbjct: 685  LQRNSSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQY 744

Query: 728  EDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPS 787
              T  D      ++ A T RRIGGR V+  EVERS+QF+YQLRDLF+ M +S ERCVTP 
Sbjct: 745  SKTIED--FKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPR 802

Query: 788  RELAYLSFSPSTTNVEFESAAQVPFRD------TTILLEQEPPNEDTEVFDISIEGSNVX 841
            RELAYL+F+PS   VEFE+    P         TT  L Q+   ++  V    I  S+  
Sbjct: 803  RELAYLAFAPSNIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSGDISMSDNI 862

Query: 842  XXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITSTCVAKISPDQ 901
                            K++                     +V  NE  TST VAKIS DQ
Sbjct: 863  TPKDAEEEEDQVAESNKNQDVSAIVSSPTKDIIMTDNTDTVV-SNEG-TSTKVAKISSDQ 920

Query: 902  LENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEG-HEQYDLVKQLFYGKLKQDLIPIE 960
            LEN LE+GRQQDVTECIGNVL+Q+ES S PL+  E  +EQ DLVKQLFYG+L+Q ++P+ 
Sbjct: 921  LENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDDLVKQLFYGELEQTIVPLA 980

Query: 961  NPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTI 1020
            NP++RR K ERF+SLLVN+GDHP+DIYDALDLYF+D+ L + ++   V+R+VAV + PTI
Sbjct: 981  NPDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKM-EEYGDVKRTVAVTKFPTI 1039

Query: 1021 LQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAI 1080
            LQIQIQRVYYDREK MPFKS EPLPF EK+YMDRY  +   EL+A+K E+L + E L  +
Sbjct: 1040 LQIQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPELIARKNETLLMKEKLVEL 1099

Query: 1081 KQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDK 1140
            K++++ +LS+N  GL+ KDS  E    L S  L ES+G I  EK  ++  L + +  ID 
Sbjct: 1100 KKKQRDLLSRNSVGLSKKDSYIELGKLLSSDSL-ESQGIILPEKDEMVSSLKTLTAGIDD 1158

Query: 1141 ELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRK 1200
            EL+ L  +I  +E +I+ +F++F   GY++FAVFIHRGEASYGHYW+YIKDR  +GIWRK
Sbjct: 1159 ELNQLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRK 1218

Query: 1201 YNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            YNDE+V+EVPE EV++FTE NTATPYFLVY+K+G E EIEPLK
Sbjct: 1219 YNDETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPLK 1261

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1253 (48%), Positives = 824/1253 (65%), Gaps = 51/1253 (4%)

Query: 11   VRLVGNGVVECESAGVRE--GGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV------- 61
            V ++GN +      G+ E   G  +LY  +    P KTS+R+LDDI S +  +       
Sbjct: 55   VSVIGNEM------GLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKE 108

Query: 62   -LEGVR-----GNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXX 115
                +R      N +LK PM++YSK R  +   SIG ++DQ+++Q+ +EY S+       
Sbjct: 109  NCNTLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCP---- 164

Query: 116  XDKHSKINVFMGLLCDPMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLV 175
               H+KI VFMG+L D   K  + DD+ N    H+++TVKTR  LER +R  G++++HLV
Sbjct: 165  --NHNKIEVFMGVLIDSTQKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLV 222

Query: 176  NDLHPADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIR 234
             +LHP D++DL  F+ +   +ID A YVS  TN+L+ IEI  PEF + EE   FTP+ I 
Sbjct: 223  KELHPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVIN 282

Query: 235  KRYLSICEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLD 294
            +RYL    +  + + E++P   EC+NTLFKVFK PL+R+ S+D +K I+++N +L   ++
Sbjct: 283  QRYLHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMN 342

Query: 295  PNWLVDKFGFELC-EVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGK 353
            P WLV K+GF +  E   E G +  EY+PPD T+YV++   R +RE   RK LEL+F GK
Sbjct: 343  PEWLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGK 402

Query: 354  QSIRLLPKEVVAASSK-LRSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFI 412
              I LL KE +  SSK LR+F L QT FS +F F+LL +        + Q  Y+ + HFI
Sbjct: 403  MMINLLSKEELEKSSKSLRTFNLLQTSFSTSF-FKLLIQERGVGLPIENQSNYNIDYHFI 461

Query: 413  NLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQE 472
            NLSV+Y+Y +RDII+ +E    +DP N G YYD L FIAN KGS+QL+ +  K +IVGQE
Sbjct: 462  NLSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQE 521

Query: 473  ALNSALRLFHIDPSETDPKQIPDEMLLSCYKEECKYGNTRQ--HADLRNALRLLAKYKQS 530
            +L +A++ F++D S T    + D +++S Y+ E K  +  Q  H +LRNAL++LA YK+S
Sbjct: 522  SLETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKS 581

Query: 531  EKLKFYVELEPFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAI 590
            +KLKF+V+ EP+     AY+              TAY+IKV+DAPGLK+DCDRALYT+AI
Sbjct: 582  KKLKFFVDYEPYLNTRTAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAI 641

Query: 591  AKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPV 650
            A+RS+ LFN+LL+    FQ++Y    +SYTSAL  LQVN NA+D+ ILE+F++KW EE +
Sbjct: 642  ARRSISLFNFLLENNLIFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAM 701

Query: 651  ISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSL 710
            ++ D  L LK AL KIA +RNSKLI++FLETG+ID + L + NWPTGLNNIGNTCYLNSL
Sbjct: 702  VAFDHLLKLKAALTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSL 761

Query: 711  LQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLR 770
            LQYYF ISPLRD I NY  T  D+  N+   G    RR+GGR  N  EVERSVQFVYQLR
Sbjct: 762  LQYYFAISPLRDEIINYTKTVDDIENNLQLQG--ITRRVGGRVTNTIEVERSVQFVYQLR 819

Query: 771  DLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEV 830
            DLF++M +S  RCVTP +ELAYL+F+PS   VEF+S      RD          N  TE 
Sbjct: 820  DLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRD----------NISTET 869

Query: 831  FDISIEGSNVXXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPIT 890
             D+  +G N                  +DE                     I    +P+T
Sbjct: 870  VDVGADGKN---DNLLVDFDSNIGANGRDEKLLVDLDSNISDKIKEEEVKKI-NTLKPVT 925

Query: 891  STCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYG 950
            ST VAKISPDQLEN LE+GRQQDVTECIGNVL Q+ESAS+PL+ D+  EQ DL+K  F  
Sbjct: 926  STRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLV 985

Query: 951  KLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRR 1010
            K KQ +IP+E  +  R K ERF+SLLVN+GDHPK+IYDALDLYF D+LL + ++   VR+
Sbjct: 986  KTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQM-EEYGEVRK 1044

Query: 1011 SVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQES 1070
            ++++ E P+ILQIQIQRVYYDREK +PFKS EPLPFG  LYMDRY      EL+  K ++
Sbjct: 1045 TLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKA 1104

Query: 1071 LQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQ 1130
              + + L  +K+R+K++LS+N+ GL+ K+SL ETK  L S VL ++ G     K +LI Q
Sbjct: 1105 RIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVL-DNNGIDVPMKTSLISQ 1163

Query: 1131 LDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIK 1190
            +++  LEID+EL+ L + I+DME +IS+ F +F +  YNLFAVFIHRGEASYGHYW YIK
Sbjct: 1164 IEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIK 1223

Query: 1191 DRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            D + + IWRKYNDE++TEVP+SEVF+F E NTATPYFLVY+K+ +  +IEPLK
Sbjct: 1224 DFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLK 1276

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/807 (66%), Positives = 645/807 (79%), Gaps = 12/807 (1%)

Query: 30  GKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVLEGVRGNGVLKSPMLDYSKERGELRAWS 89
           G+TVLY  ++   P KTSDRLLDD+R T+S   EG     VL++PML+Y+++R   R WS
Sbjct: 23  GRTVLYGNLARQGPVKTSDRLLDDVRVTVSLSEEGRE---VLRAPMLEYARQRANARTWS 79

Query: 90  IGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMVKLCSEDDIVNYSGYH 149
           +GYLLDQV+LQTS+EY S            ++++VFMG+LCDP  +  S+D++VNY  YH
Sbjct: 80  VGYLLDQVVLQTSFEYTSRTC-------AQNRVHVFMGVLCDPGQRFASQDELVNYRIYH 132

Query: 150 LRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVIDSATYVSSGTNR 209
           LRVTVK R  LERA++ +G+AQYHLV++LHP DK D C FED D  V+DSATYV+SGTNR
Sbjct: 133 LRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVASGTNR 192

Query: 210 LVRIEILKPEFTAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNTLFKVFKNP 269
           LVRIE+L+PEF  +E  EFT + IR RYL +C+++PDL+  ++P+QAECLNTLFKVFKNP
Sbjct: 193 LVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVFKNP 252

Query: 270 LSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQEEDGRKEYEYKPPDFTNYV 329
           LSRQ + DELKTISA+NKVLNSQL+ NWLV KFGFELCE+ EEDG+K YEYKPPDFT +V
Sbjct: 253 LSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEI-EEDGQKIYEYKPPDFTEHV 311

Query: 330 NDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKLRSFQLYQTHFSHTFWFQLL 389
            +W VR  RE YIRKSLEL+F+GKQS+RL+PK+VV ++SKLRSFQLYQTHFSH+FW+ L+
Sbjct: 312 ENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQTHFSHSFWYHLM 371

Query: 390 GEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTF 449
           GE+D NDFNQQ  HPYDTN HF++LS NYYY DRDII+NYE+QI LDP NA IYYDDL+F
Sbjct: 372 GEYDHNDFNQQM-HPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDDLSF 430

Query: 450 IANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIPDEMLLSCYKEECKYG 509
           +AN KGS QLLT+T KQN+VG EAL SALRLFH+DPS TDP+Q+ DE LL  YKE CK  
Sbjct: 431 VANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEVCKDS 490

Query: 510 NTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXXXXXXXXXXXXXTAYTI 569
             ++HADLRNALRLLA+YK+S+KLKFYVE+EPF  E QAY               TAY+I
Sbjct: 491 GPQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLEIDESVDIDIIETAYSI 550

Query: 570 KVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVN 629
           KVSDAPGLK+DC RALYTLA+AKRS+ LFN L Q+CP+F QFYH+SY SY SALQYL VN
Sbjct: 551 KVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVN 610

Query: 630 VNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYL 689
           VNATDDLILEIF+RKW+ +P++SP+Q LNLK+AL KI  ERNSKLINHFLETG++D NYL
Sbjct: 611 VNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDINYL 670

Query: 690 TSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRI 749
            +GNWPTG+NNIGNTCYLNSLLQYYFTISPLR+YI  Y+ TAS+LL N   S  M +RRI
Sbjct: 671 PAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNLLNNAVSSSDMGRRRI 730

Query: 750 GGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQ 809
           GGRA+++ EVERSVQFVYQLR LF++M HS+ER VTP+REL YLSFSPS+T VEFE    
Sbjct: 731 GGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEFEPVPP 790

Query: 810 VPFRDTTILLEQEPPNEDTEVFDISIE 836
                +  L+  E  NEDTEV DIS+E
Sbjct: 791 AVGTASNALVANEVYNEDTEVIDISME 817

 Score =  481 bits (1237), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 244/360 (67%), Positives = 302/360 (83%)

Query: 884  EENEPITSTCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDL 943
            E   P TST VAKIS DQLENTLEIGRQQDVTECIGNVLYQIESASVPL+ DE  EQ+DL
Sbjct: 1026 EAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDL 1085

Query: 944  VKQLFYGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGD 1003
            VKQLFYGKLKQ+LIP+E P+++RTK ERFMSLLVN+GDHPKDIYDALD YF+DDLL L +
Sbjct: 1086 VKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDE 1145

Query: 1004 DNARVRRSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESEL 1063
            D+ +VRRSVAV ELP +LQIQIQRVYYDREK MPFKSTEPLPFGEKLYMDRY+A+  +EL
Sbjct: 1146 DDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAEL 1205

Query: 1064 LAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIE 1123
             AKKQ+++ L E LE +++RR+++L+KND G+TL  +L +T+ FL+++ L     +++ +
Sbjct: 1206 NAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQ 1265

Query: 1124 KRNLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYG 1183
                   LD+  + +D+EL+ LD  I  ++++I+H+FD F+++GY+L AVFIHRGEASYG
Sbjct: 1266 YHATTSHLDALRVALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYG 1325

Query: 1184 HYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            HYWVYIKD +N GIWRKYNDESVTEVPESEVFDF+E+NTATPYFLVY+K+ HE +IEPLK
Sbjct: 1326 HYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLK 1385

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1104 bits (2856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1251 (48%), Positives = 805/1251 (64%), Gaps = 89/1251 (7%)

Query: 30   GKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF-----VLEGVRGNGVLKSPMLDYSKERGE 84
            GK +LY  +    P KTSDRL+DDI   LS       L   +  G+LK   + YSK+R +
Sbjct: 54   GKHLLYTDLKNGSPMKTSDRLIDDILCDLSLNGQSQCLLSEQSQGILKLLPIIYSKQRQQ 113

Query: 85   LRAWSI-GYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMVKLCSEDDIV 143
            L+  SI G LLDQVL QT +EY+S+         +H+K+ VF+G+L +      S DD+V
Sbjct: 114  LQNVSILGSLLDQVLFQTKFEYSSVSCP------QHNKLQVFLGVLLNVSSSFESTDDVV 167

Query: 144  NYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVIDSATYV 203
                +HL+VTVKTR  LE  K+  G++Q+  V+ LH  DK+DL  F+ +D  +ID A YV
Sbjct: 168  RSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAIYV 227

Query: 204  SSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNTL 262
            SS TN+LV IEI  PEF T+EE   FT D IRKRY+  C +   LN E++PNQ +CLNTL
Sbjct: 228  SSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLNTL 287

Query: 263  FKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQEEDGRKEYEYKP 322
            +K FKNP+++ D    L+TI A N +LNS ++ NWL +++GF L  +  E+   E EY+P
Sbjct: 288  YKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGFTL--LPGENEDDEDEYEP 345

Query: 323  PDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL---PKEVVAASSK-LRSFQLYQT 378
            P+FT Y+ D  VR ++E YIRK L+L+F  K  I ++    +  +AASSK  +S      
Sbjct: 346  PNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSGIAV 405

Query: 379  HFSHTFWFQLLGEFDRNDF--NQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQILLD 436
              +    +QL GE  +N F  +  Q + +DTN HFI LS +Y+Y DRDII NYE+  ++D
Sbjct: 406  QNTSKPLYQLFGE-SKNAFLNSNDQNYMWDTNYHFIALSASYHYNDRDIIMNYETYSVID 464

Query: 437  PKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIPDE 496
              N GIY+D + FIAN KGS+QLL +  KQNIVG EAL +A+R F +DP+  D  ++   
Sbjct: 465  KGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINKLDIS 524

Query: 497  MLLSCYK-EECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXXXX 555
            +LLS YK E+    NT   +DL+NALR+LAK+K +  +KFYV+ EP++  SQAY+     
Sbjct: 525  LLLSMYKHEQISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAYNELEVD 584

Query: 556  XXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHIS 615
                     TAY+IKV+D+PGLK++C RALYT+AI KRSM LFNYL++ CP FQ FY   
Sbjct: 585  ESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQDFYGPE 644

Query: 616  YWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLI 675
             +SY  AL  +QVN NA+D++IL+IF++KW +EP++  DQFL+LK AL+K+  E+NSKLI
Sbjct: 645  KYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIEKNSKLI 704

Query: 676  NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLL 735
            +HFL TG+ID + L   NWP GLNNIGNTCYLNSLLQYYF I+PLR+YI +Y+ T     
Sbjct: 705  SHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQSTTES-- 762

Query: 736  LNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSF 795
                 + A   RRIGGR V   EVERS+QF YQLRDLFN M  S  RCV+P++ELAYL+F
Sbjct: 763  FEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELAYLAF 822

Query: 796  SPSTTNVEFESAAQVPF----------RDTTILLEQEPPNED---TEVFDISIEGSNVXX 842
            SPS   VEF++ + +            +DT   L   P NED   TE  +  ++ + +  
Sbjct: 823  SPSNIEVEFDAGSGIASESGGTFSLNGKDTDAPLTDMPLNEDVTMTEAGEPQLDDTGLLA 882

Query: 843  XXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPI-----------TS 891
                                                    VE + P+           +S
Sbjct: 883  P---------------------------------------VEADVPVDQMKLAKEVINSS 903

Query: 892  TCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGK 951
            T VAKI  DQLEN LE+GRQQDVTECIGNVLYQ+ESAS P+  DE +EQYDL+K LFYGK
Sbjct: 904  TKVAKIGSDQLENALELGRQQDVTECIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGK 963

Query: 952  LKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRS 1011
             +QD++P+ N    R+K+ERF+SLLVNV DHPKDIYDALD YF ++ L L ++   VRR+
Sbjct: 964  TRQDIVPLSNSTDVRSKYERFLSLLVNVSDHPKDIYDALDSYFMEEYLTL-EEYGDVRRT 1022

Query: 1012 VAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESL 1071
            VA+ E PTILQIQIQRVYYDRE+ MPFKS EP+PF   LYMDRY A+ +  +L K++E+ 
Sbjct: 1023 VAITEFPTILQIQIQRVYYDRERFMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETS 1082

Query: 1072 QLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQL 1131
            +L   L   K R++++LS+ND GL+ K++  ET   L+S  L +       ++  ++  L
Sbjct: 1083 ELKTRLRECKVRQQELLSRNDMGLSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGL 1142

Query: 1132 DSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKD 1191
                  ID+EL  L  +I  +E  I H+FD F   GY+LFAVFIHRGEASYGHYWVY+KD
Sbjct: 1143 SDMVASIDEELVQLYTEIGQLETQIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKD 1202

Query: 1192 RKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPL 1242
             KNSGIWRKYNDE+V+EVPE EVF+FTE N ATPYFLV +K  HE +IEPL
Sbjct: 1203 FKNSGIWRKYNDETVSEVPEEEVFNFTEGNNATPYFLVLVKQTHEQDIEPL 1253

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1095 bits (2831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1237 (48%), Positives = 803/1237 (64%), Gaps = 48/1237 (3%)

Query: 30   GKTVLYP-LVSGNYPFKTSDRLLDDIRSTLSFVLEGVR---GNGVLKSPMLDYSKERGEL 85
            G T+LYP L + N+P KTS+R++DDI   LSF+  G      NG+L+  M+ YSKER   
Sbjct: 78   GNTLLYPDLGTANFPMKTSNRIIDDILCDLSFI-NGPNLSFKNGILQESMIMYSKERINN 136

Query: 86   RAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMVKLCSEDDIVN- 144
            +A+  G ++DQV LQT YEY SL          ++K+ V  G+L +    + + D+I++ 
Sbjct: 137  QAYLFGSMVDQVALQTKYEYNSLTCPA------NNKLEVQFGILMNLPSNITNVDEIISK 190

Query: 145  YSGYHLRVTVKTRLHLERAKRQFGIAQYHLVN--DLHPADKQDLCFFEDDDECVIDSATY 202
               YHL++TVKTR  LE +K+Q GI QYHL++  DLH  DK+DL  F+ D+  ++D A Y
Sbjct: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250

Query: 203  VSSGTNRLVRIEILKPEFTA-EEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNT 261
            VSS TNRL+ IEI   EF + EE   F   +I+ RY   C+K+  L+ E VP   +CLNT
Sbjct: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310

Query: 262  LFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGF-ELCEVQEEDGRKEYEY 320
            + K+ K PL+R++++D+++T+S+ N +L+S  +P WL++K+ F +     E  G++  EY
Sbjct: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370

Query: 321  KPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKE---VVAASSKLRSFQLYQ 377
            +PPD  +YV  + VR LRE+YIR+ L+L+F GK  ++L   +    +  S   R+F L  
Sbjct: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLLN 430

Query: 378  THFSHTFWFQLLGEFDRNDF----NQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQI 433
            T  S    +QLL +   N      N       D N HFINLS + YY DRDII+NYE  I
Sbjct: 431  TTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490

Query: 434  LLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQI 493
             LDP N G Y+D L++IAN KGS+QL+ +  KQ++VGQE +N AL+ F+IDP+  + + I
Sbjct: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLESI 550

Query: 494  PDEMLLSCYKEECKYGNTRQHAD---LRNALRLLAKYKQSEKLKFYVELEPFQQESQAYS 550
             D +LLS YK E    + ++ AD   L+NA+RL AK + S +LKFYV+ EP++  +QAY 
Sbjct: 551  DDSLLLSIYKNE----SVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYE 606

Query: 551  XXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQ 610
                          TAY+IK  DAPGLK+DCDRALYT+AI +RSM LFN+LL+ C  FQ 
Sbjct: 607  TLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQA 666

Query: 611  FYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHER 670
            +Y+I  + Y  AL  LQVN NA D++IL+ F+ KW  E +   DQFLN K ALMK+  ER
Sbjct: 667  YYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLER 726

Query: 671  NSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDT 730
            NSKLIN+FL  G+ID + L   NWPTG+NNIGNTCYLNSLLQYYF+ISPLR+Y+  Y  T
Sbjct: 727  NSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKT 786

Query: 731  ASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSREL 790
              D      +  A T RRIGGR V   EVERS+QF+YQLRDLF  M ++ +RCVTP REL
Sbjct: 787  YEDFY--DAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRREL 844

Query: 791  AYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISI---EGSNVXXXXXXX 847
            AYL+F+PS   VEFE+       D +          D +  D  I   EG          
Sbjct: 845  AYLAFAPSNVEVEFENGVTDAKEDVSHY-------NDDKTSDTLIKIGEGDEDLGEAERT 897

Query: 848  XXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPITSTCVAKISPDQLENTLE 907
                       D+                    N +   + + ST VAKIS DQLEN LE
Sbjct: 898  EASPTEDIYMTDDDMLGAAKATDGINKEDESTENGI---DILPSTKVAKISSDQLENALE 954

Query: 908  IGRQQDVTECIGNVLYQIESASVPLNFD-EGHEQYDLVKQLFYGKLKQDLIPIENPEKRR 966
            +GRQQDVTECIGNVLYQ+ES S PL  + E +EQ DLVKQLFYG++KQD+IP+    + R
Sbjct: 955  MGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETR 1014

Query: 967  TKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQ 1026
             K ERF+SLLVNVGDHP+DIYDALD+YF+D+ L + D+   V+R+VA+ + PTILQ+QIQ
Sbjct: 1015 PKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTM-DEYGEVKRTVAITKFPTILQVQIQ 1073

Query: 1027 RVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKK 1086
            RVYYDRE+ MPFKS EPLPF  K+YMDRY+ + + E+L  ++ + ++   L  +K+R+++
Sbjct: 1074 RVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQE 1133

Query: 1087 ILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLD 1146
            +LS+N+ GL+ K++  ET  FL+S+ L + +G +   +  L   L     +ID ELS + 
Sbjct: 1134 LLSRNEVGLSRKEAYSETVNFLQSNAL-QLQGIVFEGQDELSTILKKAGTDIDDELSTIY 1192

Query: 1147 DKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESV 1206
            ++I  +E +ISH+F+QF   GY+LFAVFIHRGEASYGHYWVYIKD   +GIWRKYNDE+V
Sbjct: 1193 NQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETV 1252

Query: 1207 TEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            +EVP+ EVF+FTE NTATPYFLVY+K+G E +IEPLK
Sbjct: 1253 SEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLK 1289

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/1253 (47%), Positives = 808/1253 (64%), Gaps = 54/1253 (4%)

Query: 3    QEQADDGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVL 62
            +  A D   + V +   + +S    + GK +LYP V  N PFKT DRL+DDI   L+F+ 
Sbjct: 11   EAHAGDSDEQSVSSTTADEKSLPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFIN 70

Query: 63   EGVRGN---GVLKSPMLDYSKERGELR-AWSIGYLLDQVLLQTSYEYASLXXXXXXXXDK 118
            +    +   G+LKS  L YSK R ELR ++ +G  +DQ+ LQT YEY S+          
Sbjct: 71   DSDLSSEFKGILKSSPLTYSKRRQELRPSYHLGTFIDQITLQTKYEYESISCP------D 124

Query: 119  HSKINVFMGLLCDP-MVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVND 177
            H++INVF G+L D  M    S D +     YHL+VTVKTR  LE  K+  GI+ YHL+ +
Sbjct: 125  HNRINVFFGVLIDSNMENPTSFDAVAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITE 184

Query: 178  LHPADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEFT-PDSIRKR 236
            LHP DKQDL  F++ DE +ID A YVSS TN+L+ IEI KPEF++EE  E    + I  R
Sbjct: 185  LHPFDKQDLLTFDESDENLIDFAAYVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSR 244

Query: 237  YLSICEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSD-DELKTISAENKVLNSQLDP 295
            Y  +CE+Y  LN + +P+Q +C  TLF+VFK PL R+ +D D +KTI+A NK LNS +D 
Sbjct: 245  YQLVCEQYDSLNSDTIPSQVDCFRTLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDS 304

Query: 296  NWLVDKFGFELCEVQEEDGRKE-YEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQ 354
             WLV K+GF+    Q  +   +  EY+PPD  ++ NDW +R LR+ Y RK L+L F GK 
Sbjct: 305  KWLVSKYGFQENSFQNPEANDQGLEYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKL 364

Query: 355  SIRLLPKEVVAASSK-LRSFQLYQTHFSHTFWFQLLGEFDRN-DFNQQQQHPYDTNPHFI 412
            S +LL K  +    K  R F    TH S T  FQ+  +  R    +     P D N HFI
Sbjct: 365  SNKLLSKANIQKYEKSYRFFNKMHTHTSTTALFQIFNDSARRLQQDDTSASPLDNNYHFI 424

Query: 413  NLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQE 472
            NLS +YYY DRDII+NYE+   +D  N GIY+D LT+IAN KGS+QL+++  KQ++VGQE
Sbjct: 425  NLSSSYYYTDRDIIQNYETLCNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQE 484

Query: 473  ALNSALRLFHIDPSETDPKQIPDEMLLSCYKEE--CKYGNTRQHADLRNALRLLAKYKQS 530
             L ++LR+  +D +  D K + D +L S YK+E     G+ ++  +L++A+R++ K  +S
Sbjct: 485  VLQNSLRVLGLDATSVDIKSLNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRS 544

Query: 531  EKLKFYVELEPFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAI 590
            +KL+F+++ EP+     AY+              TAYTI+++D+PGLK+DCD+ALYT+AI
Sbjct: 545  KKLQFFIDHEPYPNVMDAYNLLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAI 604

Query: 591  AKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPV 650
              RS+ LFN+L+++CP F  +Y     S+  AL  LQVN NATD+L+++IF+++W ++ +
Sbjct: 605  RTRSITLFNFLMEQCPDFITYYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKIL 664

Query: 651  ISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSL 710
               DQ L LK AL KIA E+NSKLI++FLETG+ID N L   NWP GLNNIGNTCYLNSL
Sbjct: 665  NEYDQLLILKAALTKIASEKNSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSL 724

Query: 711  LQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLR 770
            LQYYF+I+PLR+YI NY+ + S    N        KRRIGGR V++ EVERS+QF+YQLR
Sbjct: 725  LQYYFSIAPLREYILNYKGSIS----NYEIDETSNKRRIGGREVSENEVERSIQFMYQLR 780

Query: 771  DLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEV 830
            DLFNDM +SK RC+TP  ELAYL+F+PS   VEF +A++V      +  ++E    D ++
Sbjct: 781  DLFNDMIYSKSRCITPKHELAYLAFAPSNIEVEF-AASEVERTTVDLPFDKEG---DIDL 836

Query: 831  FDISIEGSNVXXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPIT 890
             D+S +  N                  K                        V  N   T
Sbjct: 837  VDLSNDNLNTTNNAQEVTSDISVATEDK------------------------VMTN---T 869

Query: 891  STCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYG 950
            ST  AKIS DQLEN LE+GRQQDVTECIGNVLYQ+ESAS P+  DE  EQYDL+K+LFYG
Sbjct: 870  STKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFEQYDLIKELFYG 929

Query: 951  KLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRR 1010
            K KQ+++P+ +  K RTK+E F SLLVN+ DHP+DIYDAL+  F  + L + D+   V+R
Sbjct: 930  KTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFLKM-DEYGDVQR 988

Query: 1011 SVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQES 1070
            +V++   P ILQIQIQRVYYDRE+ MPFKS EPLPF   +YMDRY A     L  KK E+
Sbjct: 989  TVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALDNELLQTKKNET 1048

Query: 1071 LQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQ 1130
             +L   L+ +K R+ ++L++N+ GL+ K+S  ET  FL       S+G   + +  +I++
Sbjct: 1049 KELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGLSVLNRGQIIEK 1108

Query: 1131 LDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIK 1190
            L      ID ELS + D+I  +EN I H+FD+F + GY+LFAVFIHRGEASYGHYWVYIK
Sbjct: 1109 LRKAISNIDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFAVFIHRGEASYGHYWVYIK 1168

Query: 1191 DRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            D + SGIWRKYNDE+VTEV E EVF+FTE NTATPYFLV++KD ++ +IEPLK
Sbjct: 1169 DPERSGIWRKYNDETVTEVNEEEVFNFTEGNTATPYFLVFVKDYYKGDIEPLK 1221

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1281 (46%), Positives = 818/1281 (63%), Gaps = 95/1281 (7%)

Query: 28   EGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVL-----EGVRG--------------- 67
            + GK +LY   S +  FKT+DRLLDD+   LS++L     E +                 
Sbjct: 62   DDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNNT 121

Query: 68   --------------NGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXX 113
                          NG+L+ P   YSK+R     +++G ++DQ+ LQT +E+ S+     
Sbjct: 122  SNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCP-- 179

Query: 114  XXXDKHSKINVFMGLLCD-----PMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFG 168
                + + ++V +G+L D     P+              YH ++TVKTR +LE+ K+  G
Sbjct: 180  ----EFNDVHVLLGVLMDNRSQAPLGTFLP--------VYHFKITVKTRSYLEKTKKHVG 227

Query: 169  IAQYHLVN--DLHPADKQDLCFFEDD--DECVIDSATYVSSGTNRLVRIEILKPEFTA-E 223
            I+ +HL++  DLH  DK+DL     D   + ++DSA ++S  TN+LV +EI KPEF   E
Sbjct: 228  ISHFHLIDFDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELE 287

Query: 224  EWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTIS 283
            E   F+ +SI +RY++ C ++P+L+++ +P Q ECLNT+FK+FK PL+ ++ ++ LK I+
Sbjct: 288  EIESFSQESIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAIN 347

Query: 284  AENKVLNSQLDPNWLVDKFGFELCEVQEEDGRKEY-EYKPPDFTNYVNDWNVRHLRERYI 342
            A+N +LNS  +PNWL+ K+GF        D ++E+ EY PP+  +Y+ND N R LRE YI
Sbjct: 348  ADNPLLNSHWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYI 407

Query: 343  RKSLELLFVGKQSIRLL-PKEVVAASSKLRSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQ 401
            RK LEL+F+ K++I L+ P ++   S  +RSF + QT F+ +FW Q L E      ++ Q
Sbjct: 408  RKCLELIFISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYE------HKPQ 461

Query: 402  QHPY---DTNPHFINLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQ 458
               Y   D   H+INL  ++YY +RDIIRNY     LDP N GIYYD L +IA  K S+Q
Sbjct: 462  LDTYNKLDYEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQ 521

Query: 459  LLTFTLKQNIVGQEALNSALRLFHIDPSETDP-KQIPDEMLLSCYKEECKYGN--TRQHA 515
            L++F  KQ+++GQEALN AL LF+ID +++     + + M+ + YK E K  N  + + A
Sbjct: 522  LISFVSKQDVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANISSARLA 581

Query: 516  DLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAP 575
            +++NALRLLAKYK S++LKFY + EP+   SQ Y+              TAYTIKV+DAP
Sbjct: 582  EMKNALRLLAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAP 641

Query: 576  GLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDD 635
            GLK+DCDRAL T+A  ++S+ LF +LLQ CP+F +FY +  + Y  AL  LQVN NATD+
Sbjct: 642  GLKIDCDRALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDE 701

Query: 636  LILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWP 695
             ILEIF+++W+ +  +  D  LNL+ AL KIA+E+NSKLI++F++TGI+D   L   NWP
Sbjct: 702  TILEIFQQRWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWP 761

Query: 696  TGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTA----SDLLLNMNQSGAMTKRRIGG 751
             GLNNIGNTCYLNSLLQYYF+I PLRD+I  Y+ T     ++++LN        +RRIGG
Sbjct: 762  AGLNNIGNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEK---RRRIGG 818

Query: 752  RAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAA--- 808
            R VN+ EVERSVQF+YQ+RDLF +M  S+ RCV+P +ELAYL+F PS   VEFESA+   
Sbjct: 819  REVNELEVERSVQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTED 878

Query: 809  ----QVPFRDTTILLEQEPPNEDTEVFDISIEGSNVXXXXXXXXXXXXXXXXXKDEXXXX 864
                +   +D  +L  Q+    DT   DI++   N+                  D     
Sbjct: 879  DMGDKSNAQDAVVL--QDEAKNDT---DINLTEVNLIDLEPATKVSTSNDQPTMDAIEIL 933

Query: 865  XXXXXXXXXXXXXXXXNIVEENEPIT-STCVAKISPDQLENTLEIGRQQDVTECIGNVLY 923
                              V  NE IT ST VAKIS DQLEN  E+GRQQDVTECIGNVL+
Sbjct: 934  TNSDNKSKELSKTNPFREVSPNEDITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLF 993

Query: 924  QIESASVPLNFD-EGHEQYDLVKQLFYGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDH 982
            Q+E+   P++ D E +EQYDLVK+LFYGK KQ +IP+ +    R K ERF+SLLVN+ DH
Sbjct: 994  QLETGFDPISLDNEDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDH 1053

Query: 983  PKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVYYDREKLMPFKSTE 1042
            PKDIYDAL+ YF D+ L + ++   V++++++ E P ILQIQIQRVYYDRE+ MPFKS E
Sbjct: 1054 PKDIYDALNQYFADEFLTM-EEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIE 1112

Query: 1043 PLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLK 1102
            PLPF + +YMDRY  S++ EL++KK+E+ QL   L+  + R+K++LSKN+ GL+ K+++ 
Sbjct: 1113 PLPFEQVIYMDRYAESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMM 1172

Query: 1103 ETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQ 1162
            ET  FL+S V+ E+ G     K  L+++L  +   I+ ELSNL +KI  ++N I H+FD 
Sbjct: 1173 ETIKFLKSPVILEN-GIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDD 1231

Query: 1163 FTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNT 1222
            F    Y+LFAVFIHRGEASYGHYWVYIKD   +GIWRKYNDESVTEVPE EVF+FTE NT
Sbjct: 1232 FKKLAYSLFAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNT 1291

Query: 1223 ATPYFLVYIKDGHEHEIEPLK 1243
            ATPYFLVY+K     +IEPLK
Sbjct: 1292 ATPYFLVYVKQDSLSDIEPLK 1312

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1268 (44%), Positives = 793/1268 (62%), Gaps = 53/1268 (4%)

Query: 6    ADDGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVLEGV 65
             D     L G  +   +   + + G+ +LYP +  + P KTSDRLLDDI  ++ F+  G 
Sbjct: 17   GDPPEADLQGEPIPSADVTNIEDDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSG- 75

Query: 66   RGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVF 125
                +L S  L+YSK+R  ++  ++G+  DQV++QT YEY S          +H+KI V 
Sbjct: 76   DNKSILNSNTLEYSKQRPHIKGSAVGFFQDQVIIQTKYEYPS------KSCPEHNKIFVI 129

Query: 126  MGLL--CDPMVKLCSE--DDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPA 181
            MG+L   D + K   +   ++     YH++++VK R  LE +K+  G+++Y+ ++ LH  
Sbjct: 130  MGILIGTDYLEKAEKKQISEVTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQLHDY 189

Query: 182  DKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWS-EFTPDSIRKRYLSI 240
            D+ D   ++  D  ++DSA Y +  TN++V IEI KPEF  E+     +   I+ R+   
Sbjct: 190  DRVDFPSYDPTDSKLLDSALYATDDTNKIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQA 249

Query: 241  CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD 300
             EK+P L +E  P Q + +NTLFK+FK PL R+  D   K+I AE+ +L S ++P+ LV 
Sbjct: 250  KEKFPQLAKEESPTQLDSINTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVT 309

Query: 301  KFGFELCEVQEEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLP 360
             FGF         G    EY  PD  NY+ D N++ LR+ + RK LEL+  G   I  LP
Sbjct: 310  HFGFTYTNENIPGG----EYMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLP 365

Query: 361  KEVVAA---SSKLRSFQLYQTHFSHTFWFQLLGEF-DRN----DFNQQQQH--------- 403
            + + +    S K R  +  Q  FS   W QLLG+F  RN    + N+ + +         
Sbjct: 366  QNITSTAEFSKKYRILRTIQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRV 425

Query: 404  ---PYDTNPHFINLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLL 460
               P+D + +F NLSV  +Y +RDII+NYE  I LD  N GIY+D L+ +AN KGS+QLL
Sbjct: 426  YYSPFDIDSNFTNLSVCLHYAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLL 485

Query: 461  TFTLKQNIVGQEALNSALRLFHIDPSETDPKQIPDEMLLSCYKEECKYG-NTRQHADLRN 519
            ++  KQ+++GQEAL ++L +F ID ++   + + + +LLS YK E K   +  + +DL+N
Sbjct: 486  SYCGKQDVIGQEALQNSLAVFGIDYTKVTLESLDENLLLSVYKHEWKENPDNNRISDLKN 545

Query: 520  ALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKV 579
            ALRLLAKY  S+ LKFYV+ EP++   +AY               TAYTIK++DAPGLK+
Sbjct: 546  ALRLLAKYFTSDYLKFYVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKI 605

Query: 580  DCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILE 639
            DCDRALYT+A ++RS+ LFN+L  +CP FQ++Y      Y  + + LQ+N N T+  +L 
Sbjct: 606  DCDRALYTIAYSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLH 665

Query: 640  IFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLN 699
            +F++KW    +  PDQ L  + AL KIA ERNS L+ +FLETG I+ N L + NWPTG+N
Sbjct: 666  VFQQKWKNTLLEEPDQLLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGIN 725

Query: 700  NIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEV 759
            NIGNTCYLNSLLQ+YF ISPLR+YI  Y+ T +D  L+ N    ++KRRIGGR V K E+
Sbjct: 726  NIGNTCYLNSLLQFYFAISPLREYIVQYQKTIAD--LSSNPDSIISKRRIGGRQVGKNEI 783

Query: 760  ERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESA-AQVPFRDTTIL 818
            ERSVQF+YQLRDL+NDM  S +RCVTP RELAYL+F+PS+ +VEFE+A  + P  +    
Sbjct: 784  ERSVQFLYQLRDLYNDMIFSSQRCVTPKRELAYLAFAPSSIDVEFENAKTKSPISNI--- 840

Query: 819  LEQEPPNEDTEVFDISIEGSNVXXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXX 878
               E  N  T+   +   G N+                                      
Sbjct: 841  ---EGSNSTTDSQPMPSTGENIDHNMDIEQEERNNEEINSTNNIESNDLVSNNHDIEMLD 897

Query: 879  XXNIVEENEPITSTC--VAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDE 936
                 E N  I  T   VAKI P+QLEN LE+GRQQDVTECIGNVL+Q+ES+S P +  E
Sbjct: 898  TDKENEGNMEIEDTAIKVAKIDPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSLSE 957

Query: 937  GHEQYDLVKQLFYGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRD 996
             HEQ DL+K+LF+G+  Q + P++     RTK ERF+SLLVN+ DHPKD+YDALDLYF++
Sbjct: 958  DHEQNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYFKE 1017

Query: 997  DLLALGDDNARVRRSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYM 1056
            + L + ++   V+R +A+++ PTILQIQIQRVYYDRE+ MP+KS EPLPF   +Y+DRY 
Sbjct: 1018 EYLTM-EEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRYA 1076

Query: 1057 ASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAES 1116
             + + +LL K++E+ +L   L + K+R+K++LS+N+ GL+ +D+ KET  FL S VL  +
Sbjct: 1077 DTDDVKLLQKREETAELKRQLRSFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQNT 1136

Query: 1117 EGKIRIEKRNLIK-QLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFI 1175
               I I   +L+  +L+  + ++  ELS+L  KI ++E  I+H+FD FT  GY LFAVFI
Sbjct: 1137 --NISISDPDLLATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFI 1194

Query: 1176 HRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGH 1235
            HRGEASYGHYWVYIKD  NS IWRKYNDE+VTEVPE EV +FTE NTATPYF+V++K GH
Sbjct: 1195 HRGEASYGHYWVYIKDFVNS-IWRKYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGH 1253

Query: 1236 EHEIEPLK 1243
            E +IEPLK
Sbjct: 1254 EKDIEPLK 1261

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/836 (50%), Positives = 576/836 (68%), Gaps = 22/836 (2%)

Query: 8   DGRVRLVGNGVVECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF------- 60
           D   + + +G +E +    ++ GK +LYP     +PFKTS+RLLD+I++ L++       
Sbjct: 17  DSISKPIDDGGLE-DGGSTQDNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD 75

Query: 61  VLEGVRGNGVLKSPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHS 120
           +L     +GVLK P+L+YS+ +     +SIG+LLDQV+L+T YEY S            +
Sbjct: 76  ILYSALHSGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGL------N 128

Query: 121 KINVFMGLLCDPMVKLCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHP 180
           K++VFMG+L  P +     +D+     YHL++TVKTR+HLE  ++Q G+ QYH++++LHP
Sbjct: 129 KVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHP 188

Query: 181 ADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSI 240
           +DKQDL   E+ D  ++DSA YVSS TN+LV IEI KPEF+ E+ + F+PDSIR+R+   
Sbjct: 189 SDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDSIRRRFAEA 248

Query: 241 CEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVD 300
           C K+PDL+ E VP+QAEC +TL K+FK PL+R+  DD LKTISA+NK LNSQ++P WL +
Sbjct: 249 CGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTE 308

Query: 301 KFGFELCEVQ-EEDGRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL 359
           +F F+LCE Q  E+     EY+PPD T+YVN+ +VR LRE Y RK LEL+F+GK ++ L+
Sbjct: 309 RFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALM 368

Query: 360 PKEVVAASSKLRSFQLYQTHFSHTFWFQLLGEF-DRNDFNQQQQHPYDTNPHFINLSVNY 418
            K+ VA  S+ RSF LYQ  +S +F+F LLGE     D+  Q+    D N HFINLS  +
Sbjct: 369 SKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQE---IDKNYHFINLSACH 425

Query: 419 YYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSAL 478
           YY D+DII+NYE+Q  LDP+N GIY+D L FIAN KGS+QL+T+  KQ++VG+EAL+SAL
Sbjct: 426 YYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSAL 485

Query: 479 RLFHIDPSETDPKQIPDEMLLSCYKEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVE 538
            LF ID S+TD   +PD++LL  Y++E    + ++ + L+N+LRL+AK K+S+ L+FY  
Sbjct: 486 SLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQILQFYTA 545

Query: 539 LEPFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLF 598
            EP+    QAYS              TAYT+KV+D+PGLK+DCDRA+YT+A+++RSM LF
Sbjct: 546 YEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLF 605

Query: 599 NYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLN 658
           N+L ++CP F +FY     +Y  AL  LQVN NA+DD+ILE+F+RKW +EPV SPDQFL 
Sbjct: 606 NFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLI 665

Query: 659 LKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTIS 718
              AL KI   RNS LIN +LETGIID + L +GNWPTGLNNIGNTCYLNSLLQYYF IS
Sbjct: 666 SSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCIS 725

Query: 719 PLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAH 778
           PLR  I  Y+ T S+   ++      +KRRIGGR V++ EVERS+QFVYQLRDLF DM H
Sbjct: 726 PLRQSIVEYQKTLSEFHQSIGH--LESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVH 783

Query: 779 SKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDIS 834
           ++ R VTP++ELAYL+F+PS   VEFE              E+    E TEV D++
Sbjct: 784 TENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVGEAEDEEEGAIKETTEVIDLT 839

 Score =  439 bits (1128), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/353 (61%), Positives = 272/353 (77%), Gaps = 3/353 (0%)

Query: 890  TSTCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFY 949
            TST VAKIS DQLEN LE+GRQQDVTECIGNVL+Q+ESAS P   D   EQ DL+KQLF+
Sbjct: 883  TSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFF 942

Query: 950  GKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVR 1009
            GKL+Q L P+ +P K RTK ERF+SLLVNVGDHPKD+YDALD YF++D+L L D +  V 
Sbjct: 943  GKLRQVLTPLNDPTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGD--VN 1000

Query: 1010 RSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQE 1069
            RSVA++ELP +LQIQIQRVYYDRE+ MPFKS EPLPF + +YMDRYM + +  +L K++E
Sbjct: 1001 RSVAIKELPAVLQIQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREE 1060

Query: 1070 SLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIK 1129
            +  L + L  +K++++ +L KN +G++ K SL ETK FL+S VL E+       K   I+
Sbjct: 1061 AATLKKELVTLKEKQRSLLDKNGSGMSFKSSLLETKRFLQSDVL-ENNDIESPNKEQSIQ 1119

Query: 1130 QLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYI 1189
             +DS  L+ID+EL+++  +I  +E  +S  FD F   GY+LFAVFIHRGEASYGHYW+YI
Sbjct: 1120 TIDSMLLKIDEELASVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYI 1179

Query: 1190 KDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPL 1242
            KD   +GIWRKYNDESVTE PESEVF+F+E NTATPYFLVY+K+G E +IEPL
Sbjct: 1180 KDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPL 1232

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/794 (51%), Positives = 538/794 (67%), Gaps = 25/794 (3%)

Query: 26  VREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV-------LEGVRGNGVLKSPMLDY 78
            ++ GK  LYP  +  +PFKT+DRLLDDI   LSF+       L     NG+LKSP+L Y
Sbjct: 56  TQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSY 115

Query: 79  SKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMVK-LC 137
           S++ G+ RA+++G L+DQV+LQT +EY S+         +H+ + VFMG+L D   + + 
Sbjct: 116 SRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCP------QHNHLQVFMGVLIDVTQQNVA 169

Query: 138 SEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVND--LHPADKQDLCFFEDDDEC 195
           + +++     +HL+VTVKTR  LER K++ GI  YH +++  +HP DKQDL  F+  D  
Sbjct: 170 TFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQ 229

Query: 196 VIDSATYVSSGTNRLVRIEILKPEFTA-EEWSEFTPDSIRKRYLSICEKYPDLNRENVPN 254
           ++D A YVSS +N+L+ IEI KPEF + EE   F  +SI  RY   C ++  L+   +P 
Sbjct: 230 LLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPT 289

Query: 255 QAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFEL-CEVQEED 313
           Q +C+NTLFK+FK PL+R+ S++  KTI+  N  LNS +DP WL  K+GFEL  E  EE 
Sbjct: 290 QPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEET 349

Query: 314 GRKEYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKL-RS 372
           G    EY PPD TNY  DW VR LRE + R+ LEL+F+G+ SIRLL +E V  + K+ R 
Sbjct: 350 GEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRI 409

Query: 373 FQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQ 432
           F + QT+FS  FWFQLLGE+ R  F+ +   P D++ HFI+LS  Y Y DRDIIRNYE+Q
Sbjct: 410 FSMMQTNFSTMFWFQLLGEY-RAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQ 468

Query: 433 ILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQ 492
             LDP+N G+Y D L FIAN KG++QL+ +  KQ+ VGQEAL+ AL +F ID  E DP  
Sbjct: 469 CTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHN 528

Query: 493 IPDEMLLSCYK-EECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSX 551
           + D +LLS YK E     N  +HA+L+N+LRLLAK+K+S KLKFY + EP++  +QAY  
Sbjct: 529 LNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588

Query: 552 XXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQF 611
                        TAYT+KV+D+PGLK+DCDRALYT+A+  RS+ LFN+L+Q+   FQ++
Sbjct: 589 LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648

Query: 612 YHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERN 671
           +    +SY  AL  LQVN NA DD ILEIF+RKW +EPV   DQFL LK AL KI  ERN
Sbjct: 649 FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708

Query: 672 SKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTA 731
           SKLI+HF++TG +D + L + NWPTGLNNIGNTCYLNSLLQYYF+IS LR Y+ +Y +T 
Sbjct: 709 SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768

Query: 732 SDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELA 791
              L N   +     RRIGGR + + EVERSVQFVYQLRDLF+ M H+++RCVTP +ELA
Sbjct: 769 QHFLNNQEYAS----RRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELA 824

Query: 792 YLSFSPSTTNVEFE 805
           YL+F PS   VEFE
Sbjct: 825 YLAFVPSGLGVEFE 838

 Score =  454 bits (1169), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/355 (63%), Positives = 285/355 (80%), Gaps = 4/355 (1%)

Query: 890  TSTCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFY 949
            TST VAKIS DQLEN LE+GRQQDVTECIGNVL+Q+ESAS P++  + +EQ DLVKQLFY
Sbjct: 947  TSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFY 1006

Query: 950  GKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVR 1009
            G +KQ++IP+++  + RTK+ERF+SLLVN+GDHPKDIYDALDLYFRD+ L L ++   V+
Sbjct: 1007 GNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKL-EEYGDVK 1065

Query: 1010 RSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQE 1069
            R+VAV + PTILQIQIQRVYYDRE+ MPFKS  PLPF E +YMDRY  +    L+ +K+E
Sbjct: 1066 RTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRE 1125

Query: 1070 SLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKR-NLI 1128
            + +L + L  +K R++++LSKN+ GL+ K +L ET  FL+S VL E++G I+I+ R  L 
Sbjct: 1126 TEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVL-ETQG-IQIDNRTGLA 1183

Query: 1129 KQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVY 1188
            ++LD+  L I+ ELS L   I  +E+ ISH+FD F + GY+LFAVFIHRGEASYGHYW+Y
Sbjct: 1184 QELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIY 1243

Query: 1189 IKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            IKDR  SGIWRKYNDE++TEVPESEVF+F+E NTATPYFLVY+K GHE EIEPLK
Sbjct: 1244 IKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLK 1298

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/804 (47%), Positives = 538/804 (66%), Gaps = 22/804 (2%)

Query: 20  ECESAGVREGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVLEGVR-------GNGVLK 72
           +  S   ++ GK +LYP      PFKTS+RLLD+I  ++ ++L   +        NG+LK
Sbjct: 44  DATSVSWKDDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGLLK 103

Query: 73  SPMLDYSKERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDP 132
             +L YSK R  ++ +S+G ++DQ++LQT +EY S          + + I V +G+L D 
Sbjct: 104 KQLLSYSKSRHNVQPFSVGTIVDQIILQTKFEYKS------TTCPEFNNIYVRLGVLIDT 157

Query: 133 MVK-LCSEDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFED 191
             + L + DD+ +   YHL++TVK R  LER KR  G+ +YHL++ LHP D+QDL  F+ 
Sbjct: 158 NHQPLSTFDDVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDP 217

Query: 192 DDECVIDSATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRE 250
            D  ++D A YVS  TN+LV +EI +PEF + EE +  T  +I++R++   +KY  L+++
Sbjct: 218 KDPKLVDHAIYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKD 277

Query: 251 NVPNQAECLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQ 310
            +P Q +C+NT+FK+FK PL+R+ +D+ +KT+S++N VLNSQ++P WLV K+GF+     
Sbjct: 278 EIPTQIDCINTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIET 337

Query: 311 EEDGRKEY-EYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLL-PKEVVAASS 368
           EE+  ++  +Y PP+  ++  D +VR  RE   RK LEL+++GK SI L+ P++  +AS 
Sbjct: 338 EEETEEQLIDYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASK 397

Query: 369 KLRSFQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRN 428
            LR+F L QT FS  FW Q+L E ++N    ++    + + H I+LS +Y+Y DRDII+N
Sbjct: 398 SLRTFNLLQTSFSTLFWSQILDE-NKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQN 456

Query: 429 YESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSET 488
           YE Q  LDP N GIY+D L FIAN +GS+ L+ +  KQ+IVGQEAL  AL+ F +DP   
Sbjct: 457 YELQCKLDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTI 516

Query: 489 DPKQIPDEMLLSCYKEECK-YGN-TRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQES 546
           D     D + ++ YK E K +GN   +  +LRNALR+LAK+K S +LKFYV+ EP+    
Sbjct: 517 DLSDTNDAIFMTIYKNEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQ 576

Query: 547 QAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCP 606
           +A++              TAY+IKV+D PGLK+DCDRALYT+A++KRSM L N+L Q CP
Sbjct: 577 RAFNILEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECP 636

Query: 607 RFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKI 666
            FQ FY    ++Y+ ALQ LQVN NA DD ILEIF+R+W  + VI  D+ L+LK  L KI
Sbjct: 637 PFQDFYGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKI 696

Query: 667 AHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN 726
           A ERNSKLI+ +LETG+++   L + NWP GLNNIGNTCYLNSLLQYYF ISPLR+Y+ +
Sbjct: 697 AFERNSKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVAD 756

Query: 727 YEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTP 786
           Y+ T  + + N  + G   KRRIGGR +NK EVERSVQFVYQLRDLFN+M HS  RCVTP
Sbjct: 757 YQKTL-EAVENCLEDG-WDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTP 814

Query: 787 SRELAYLSFSPSTTNVEFESAAQV 810
           ++ELAYL+F+PS   VEF+   ++
Sbjct: 815 TKELAYLAFAPSNVEVEFDQPNEL 838

 Score =  440 bits (1132), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 217/354 (61%), Positives = 277/354 (78%), Gaps = 2/354 (0%)

Query: 890  TSTCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFY 949
            TST VAKIS DQLEN LE+GRQQDVTECIGNVL+Q+ESAS P++ +E  EQYDL+K+LFY
Sbjct: 912  TSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFY 971

Query: 950  GKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVR 1009
            GK KQ +IP++N  + R K ERF+SLLVNV DHPKD+YDALDLYF D+ L + D+   V+
Sbjct: 972  GKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTM-DEYGEVK 1030

Query: 1010 RSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQE 1069
            +S+AV E PTILQIQIQRVYYDRE+ MPFKS EPLPF E +YMDRY  +T+++LL KK E
Sbjct: 1031 KSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDE 1090

Query: 1070 SLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIK 1129
            + +L + L  +++R+K++LS+N+ GL+ K++  ET+ FL S  L E +G     K+ LI 
Sbjct: 1091 TFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSDAL-EKQGIETENKQMLID 1149

Query: 1130 QLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYI 1189
            +L     +ID EL+ L + I ++E  I  +FD+F N GY+LFAVFIHRGEASYGHYWVYI
Sbjct: 1150 RLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYI 1209

Query: 1190 KDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
            KD   +GIWRKYNDE++TEVPE+EVF+FTE NTATPYFLVY+K  + +EIEPLK
Sbjct: 1210 KDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLK 1263

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/805 (44%), Positives = 513/805 (63%), Gaps = 24/805 (2%)

Query: 28  EGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVLEGVRGNGVLKSPMLDYSKERGELRA 87
           + GKT+LY  +S ++PFKT DR+LDDIR +  F+ +   G+ V+K PML YS+ER +L+ 
Sbjct: 39  DDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLKKF--GSSVMKQPMLQYSRERQQLQP 96

Query: 88  WSIGYLLDQVLLQTSYEYASLXXXXXXXXDKHSKINVFMGLLCDPMVKLCSEDDIVNYSG 147
           W++ +L+DQV L++ Y+Y S+           + I+V   LL DP       DDI  +  
Sbjct: 97  WNLVHLIDQVNLRSRYDYDSMTCP------GKNTISVMFALLVDPNFTPNDFDDIDKFPE 150

Query: 148 Y--HLRVTVKTRLHLERAKRQFGIAQYHLVN--DLHPADKQDLCFFEDDDECVIDSATYV 203
           Y  HL++TVK R +LE   R  GI  YH++    LHP DK+D+   E+ D  ++D + +V
Sbjct: 151 YFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLVDQSIFV 210

Query: 204 SSGTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNTLF 263
           S+ TN+L+ +EI+KPEF +E  +E+    I +RY + C+++  LN +++P+QAECL TLF
Sbjct: 211 SADTNKLILVEIIKPEFNSENLAEYRTAKIEERYKNACQEFDLLNPDDIPSQAECLKTLF 270

Query: 264 KVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQEEDG-RKEYEYKP 322
            +FKNPL R+ ++ E K IS ++  LNSQ++ +WL   F F L +   ED  +   EYKP
Sbjct: 271 MIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQSGEEYKP 330

Query: 323 PDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKLRSFQLYQTHFSH 382
           PD  +Y+ D+ VR +RE Y RKS+E++ +GKQS+ L  +      +  + F       SH
Sbjct: 331 PDLVDYITDFKVRGIREAYTRKSMEVVLIGKQSMLLENELGTEKKTVAKCFSNQHFSASH 390

Query: 383 TFWFQLLGEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQILLDPKNAGI 442
           T+WF +L           +  PYD N HFINLSV + Y D+DII+NYE+QI LD +N   
Sbjct: 391 TWWFNILNH------QHIEPFPYDINYHFINLSVAFKYIDKDIIKNYETQIALDQENISH 444

Query: 443 YYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIPDEMLLSCY 502
           Y+D L ++ N KGS+QL+ +  KQ++VG E LN+AL++F +DP++ D   +    ++  Y
Sbjct: 445 YFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDASLLDANTMIEYY 504

Query: 503 KEECKYGNTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXXXXXXXXXXX 562
                  +  Q  DLRNALR+L KY  S+K+ F VE EP+    QAY+            
Sbjct: 505 NSHLLRSSDNQRKDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQAYTLLKVDETVDDDI 564

Query: 563 XXTAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHISYWSYTSA 622
             TAYTI ++DAPGLK D DRA++T+A+ +RS+ L N L   CP F Q+Y+ +  SY  A
Sbjct: 565 IQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEFAQYYNCTDISYDEA 624

Query: 623 LQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLINHFLETG 682
           L  +++++NA+DD+ILE+F++KW+   +  PD  L LK+AL  I   RNSKLINHFL+TG
Sbjct: 625 LNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGFTRNSKLINHFLDTG 684

Query: 683 IIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSG 742
           I+D + L    WP G+NN+GNTCYLNSLLQ++FTI PLRD+I NY+D ++ LL   + S 
Sbjct: 685 IVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLL---DASE 741

Query: 743 AMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFSPSTTNV 802
             ++RRIGGR V+K E  RSVQFVY LRDLFNDM H+  RCVTP++EL YL+F+PS   V
Sbjct: 742 YHSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKELVYLAFAPSNVEV 801

Query: 803 EF--ESAAQVPFRDTTILLEQEPPN 825
           EF  ++ AQ    D T  + ++P +
Sbjct: 802 EFGDDTVAQKELIDLTTDVVEDPTD 826

 Score =  452 bits (1163), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 227/357 (63%), Positives = 282/357 (78%), Gaps = 9/357 (2%)

Query: 891  STCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYG 950
            S  VAKIS DQLENTLEIGRQQDVTECIGNVL Q+E AS PL+ ++  EQ DLVKQLFYG
Sbjct: 862  SVQVAKISADQLENTLEIGRQQDVTECIGNVLAQLEIASEPLSLEDDLEQNDLVKQLFYG 921

Query: 951  KLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRR 1010
            ++KQDLIP+ +    RTK+ERF+SLLVN GDHPKDIYDALD YF++D L L ++   V+R
Sbjct: 922  RIKQDLIPVNDEASVRTKYERFLSLLVNTGDHPKDIYDALDFYFQNDYLNL-EEYGDVKR 980

Query: 1011 SVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQES 1070
            +V++ ELP +LQIQIQRVYYDREK MPFKS EPLPFGE LYMDRYMA+ + +LLA+ Q++
Sbjct: 981  TVSISELPAVLQIQIQRVYYDREKFMPFKSIEPLPFGETLYMDRYMATEDPKLLAEIQQN 1040

Query: 1071 LQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNL--- 1127
             +L + L+ +KQR++K+LS+N+ GLTLK SL ETK FL+S  L   +    I+  N+   
Sbjct: 1041 AELKQKLQDLKQRQRKLLSQNEIGLTLKSSLIETKKFLQSGTLKAHD----IDADNIPSS 1096

Query: 1128 IKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWV 1187
            I  +D     ID+EL +L +KI D+E +IS +F +F + GY+LFAVFIHRGEASYGHYWV
Sbjct: 1097 IAYIDILINNIDEELKSLFNKITDLETTISQQFSEFKHIGYSLFAVFIHRGEASYGHYWV 1156

Query: 1188 YIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHE-IEPLK 1243
            YIKD   +GIWRKYND+SVTEVP+SEVF+FTE NTATPYFLVY+++G E E IEPLK
Sbjct: 1157 YIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATPYFLVYVREGQEQETIEPLK 1213

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  551 bits (1419), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 385/1252 (30%), Positives = 618/1252 (49%), Gaps = 140/1252 (11%)

Query: 28   EGGKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFV-LEGVRGN------GVLKSPMLDYSK 80
            + G  +LY  +     FKTS R+LDDI + ++F+ L+  + +      GVL  P + YS 
Sbjct: 69   DDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSDDIDFKDGVLNLPTIKYSL 128

Query: 81   ERGELRAWSIGYLLDQVLLQTSYEYASLXXXXXXXXD-KHSKINVFMGLLCDPMVKLCSE 139
             R  ++ + I      +L  T+     +          K++ I    GLL  P +   SE
Sbjct: 129  WRKYIKPFKI------ILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLV-PKIPRRSE 181

Query: 140  -----DDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVND---LHPADKQDLCFFED 191
                 + I +   Y +R+TVKTR  LE  K+   +  Y L++D   LH  DK D   F  
Sbjct: 182  LNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFNK 241

Query: 192  DDECVIDSATYVSSGTNRLVRIEILKPEFTAEEWSEF-TPDSIRKRYLSIC----EKYPD 246
            D + ++D + Y+SS TN+++ IEI KP F   E     +  S+  R   +     E  PD
Sbjct: 242  DSKDLLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQPD 301

Query: 247  LNRENVPNQAEC----LNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKF 302
             N   V  Q +     L+ + +  K    R+    +   + +++  L + +D  WL + F
Sbjct: 302  YNDAIVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEENF 361

Query: 303  GFELCEVQEEDGRK-------EYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQS 355
              ++ E + +D          +  +  P+  N           ++  R ++EL+++GK  
Sbjct: 362  DIKVKEQKRKDHVSITLDEALKLSFDDPNPKNQAK-------FDKITRYAMELMYLGKVL 414

Query: 356  IRLLPKEVVAASSKLRS-FQLYQTHFSHTFWFQLLGEFDRNDFNQQQQHPYDTNPHFINL 414
                  E         + F+  + H + +FW Q+L E+ ++ F+ Q+      + HFINL
Sbjct: 415  QSFYSNEEEIEEYMEDTIFKQVKVHHTTSFWTQILNEY-QSIFSSQKTSTRCVDEHFINL 473

Query: 415  SVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQN-IVGQEA 473
             ++    ++DII NYE Q+  DP N   Y++ L +++     + +L    K+N I+ + A
Sbjct: 474  CIDSNVSEKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAA 533

Query: 474  LNSALRLFHIDPSETDPKQIPDEMLLSCYKEECKYGNT---RQHADLRNALRLLAKYKQS 530
               AL +F       +  +   E +   Y E  +  N    +   DL ++   LA  K+S
Sbjct: 534  YLHALEIFKYSEEYFNAIEHVSE-IWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVKKS 592

Query: 531  EKLKFYVELEPFQQESQAYSXXXXXXXXXXXXXXTAYTIKVSDAPGLKVDCDRALYTLAI 590
              L +  + EPF     AY                AYT+++ + P  K+  DRAL+ +AI
Sbjct: 593  SPLIYITKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIAI 652

Query: 591  AKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPV 650
             +  + L   L Q C  F +       +   A + + +   +++  I+  F + W E   
Sbjct: 653  QRHDLSLLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETDD 712

Query: 651  ISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSL 710
             +P  F+    AL +++  R S L+ HF E G ++   + S  WPTG+NNIGNTCYLNSL
Sbjct: 713  SNPVNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSL 772

Query: 711  LQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLR 770
            LQYYF+I+  R++I+NY+   SDLL   N +  M+KRR+GGR +   E+ RSVQF+YQ++
Sbjct: 773  LQYYFSITLFREFIENYQSIESDLL---NSNAEMSKRRVGGREIQNNEINRSVQFIYQVQ 829

Query: 771  DLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEV 830
            DLF  M H+K R VTPS +LAYL+F+P+   ++F+  ++         LE    ++ T  
Sbjct: 830  DLFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKFKHKSE---------LESSEEHQLTTS 880

Query: 831  FDISIEGSNVXXXXXXXXXXXXXXXXXKDEXXXXXXXXXXXXXXXXXXXXNIVEENEPIT 890
              I++  +                                          +I   +   +
Sbjct: 881  HSIALSSAT-----------------------------SISHSDIDTQDHDISLNSTSYS 911

Query: 891  STCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYG 950
            +  VA ++ D LE TLEIG QQDVTECI  VLYQ+E+ S+PL  D  +EQ DLVK+LFYG
Sbjct: 912  NRLVAMVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYG 971

Query: 951  KLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRR 1010
            +  Q++ PI+   K   K E + SLLVN+ D P D+Y+ LD YF D+ +++ ++   V++
Sbjct: 972  ETIQEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSM-EEYGEVKK 1030

Query: 1011 SVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQES 1070
            ++++ +LPTIL IQIQRVYYD+EKL+P+K    LPF  ++++DRY+   + E        
Sbjct: 1031 TLSITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRYIKGNKKE-------- 1082

Query: 1071 LQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQ 1130
               ++ LE              A L LK              LA      +++ R L+ +
Sbjct: 1083 ---NDVLEK-------------ARLELK--------------LA------KVKYRELVSE 1106

Query: 1131 LDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIK 1190
             +S +  I   +    D+I+++   I  +  +     Y+LFAVFIHRG+AS+GHYWVYI+
Sbjct: 1107 YNSVNKSISDRIITTYDRIEELNAVIEEEVTKDAKIRYSLFAVFIHRGQASFGHYWVYIR 1166

Query: 1191 DRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPL 1242
            D +N GIWRKYND  VT   E E+F   + + +TPYFL Y+    +  ++PL
Sbjct: 1167 DFEN-GIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPL 1217

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score =  368 bits (944), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 258/793 (32%), Positives = 413/793 (52%), Gaps = 81/793 (10%)

Query: 54  IRSTLSFVLEGVRGNGVLKSPMLDYSKERGELRAWSIGYLLDQV-LLQTSYEYASLXXXX 112
           I S+   + E     G+L+ P  DYSK R     + I  L ++  L+   +EY S     
Sbjct: 123 INSSADEIKELGLNKGILRLPTTDYSKFRSSFSEYKIINLSNKNNLINYRFEYES----- 177

Query: 113 XXXXDKHSKINVFMGLLCDP----------MVKLCSEDDIVNYSGYHLRVTVKTRLHLER 162
                + +KI  F  +L  P          M K  S+++      YHL+V++KTR  LE 
Sbjct: 178 -KTNHQDNKILEFFSILHKPKDASNLDYESMAKFWSQNEF-----YHLKVSIKTRNQLEL 231

Query: 163 AKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVIDSATYVSSGTNRLVRIEILKPEFTA 222
           +K+   I  ++++++ +  DK D   F  D+  ++D A ++SS TN++V +EI K EF  
Sbjct: 232 SKKHTPIQHFYVIDEFNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLVEIFKSEFNL 291

Query: 223 EEWSEFTPDSIRKRYLSICEKYPDLNRE-NVPNQAECLNTLFKVF---KNPLSRQDSDDE 278
            +      D    + L+  EKY + N +  +P Q + L  L   F   +N  +   S+DE
Sbjct: 292 NDKLIILDDL---QVLNNYEKYKNSNHKLKLPTQTDVLLVLMYCFNKQQNFDNIHSSEDE 348

Query: 279 LKTISAENKVLNSQLDPNWLVDKFGFELCEVQEEDGRKEYEYKPPDFTNYVNDWNVRHLR 338
           +K    ++K +   L+P+WL ++F  +    QE++           F N  N+ N+    
Sbjct: 349 IKL--KDSKAIKISLNPSWLTERFSLKF---QEDESLI--------FMNLRNNLNLIKKE 395

Query: 339 ER----YIRKSLELLFVGKQSIRLLPKEVVAASSK----LRSFQLYQTHFSHTFWFQLLG 390
           +R    + R  LEL  +    I+  P+++V  +SK    ++       + S +FW Q+LG
Sbjct: 396 KRRFDVFTRCLLELFVL----IKSAPQKLVKCNSKDTNIIKVVDTISINSSLSFWSQILG 451

Query: 391 EF----DRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDD 446
           E+     +N+FNQ  +H       FINLS+   Y + +I++NYE   +L+P   G+Y+D 
Sbjct: 452 EYKSILSQNNFNQYSKHA-----EFINLSILPTYTESEIVKNYEILTILNPDKIGVYFDS 506

Query: 447 LTFIANVKGSHQ-LLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIPDEMLLSCYKEE 505
           L F++     ++ L  +  K  I+G E  N +L++F +D  E       D +L   Y   
Sbjct: 507 LKFVSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDKLEF--TNCSDSVLWEKYLTY 564

Query: 506 CKYGN-TRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSXXXXXXXXXXXXXX 564
            +  N    HA LRN+++ L+  K S  LKF  + EP++    A+               
Sbjct: 565 YEDKNFDYNHAILRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVDSDTII 624

Query: 565 TAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQ 624
            +YT K++D    K   D+AL T+AI ++ + LF+ L + C  F   YH     Y +ALQ
Sbjct: 625 VSYTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTALQ 684

Query: 625 YLQVN-VNATDDLILEIFRRKWAEEPVISPDQF-------LNLKVALMKIAHERNSKLIN 676
            +  + +N+ ++LIL  F+++W    V + D F       L L+  +M I+  RNS L+N
Sbjct: 685 AIDSSELNSDNELILS-FKKRWYRIDV-NNDTFGDDTVNLLTLRKVMMVISSNRNSLLLN 742

Query: 677 HFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLL 736
           +++E GI++  +L S +WP GLNNIGNTCYLNSLLQYYF ISPLR+Y+ N+    +D+ L
Sbjct: 743 NYIEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLINF----NDIEL 798

Query: 737 NMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFS 796
           +  +   + KRR+GGR ++  E  RS+QFVYQLRDL+ +M HS  R V+P  +LAYL+F+
Sbjct: 799 DGREMKNLEKRRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFA 858

Query: 797 PSTTNVEFESAAQ 809
           PS T +EF    Q
Sbjct: 859 PSDTPIEFRDGIQ 871

 Score =  320 bits (820), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 220/352 (62%), Gaps = 47/352 (13%)

Query: 892  TCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGK 951
            T + KIS  QLE TLE+G QQDVTECI NVL+QIE+AS P++ DE +EQ DLVKQLF+GK
Sbjct: 936  TLIPKISSSQLETTLEMGSQQDVTECIENVLFQIEAASNPISIDEDNEQVDLVKQLFFGK 995

Query: 952  LKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRS 1011
             +Q + P     K   K ERF+SLLV+V D P+DIYDALD YF+D++  + ++  +V++S
Sbjct: 996  TEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIYDALDTYFKDEVFDM-EEYGKVKKS 1054

Query: 1012 VAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESL 1071
            + +   PTILQ+QIQRVYYD EK +PFK  EPL F E LY+DRY    + +L  KK E  
Sbjct: 1055 LTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSESLYLDRYANDIDEKLAEKKIEVA 1114

Query: 1072 QLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQL 1131
             L + L+ +   +K++  KND                             +E R + K+ 
Sbjct: 1115 SLKKRLKGLITIKKELEKKND----------------------------NVEIRTISKE- 1145

Query: 1132 DSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKD 1191
                             I D+E  I   F +F   GY+LFAVFIHRG+A++GHYW+YIKD
Sbjct: 1146 -----------------INDVETKIDTAFSEFHKHGYSLFAVFIHRGQATFGHYWIYIKD 1188

Query: 1192 RKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243
             KN G WRKYND  VTE+   EVF+F+E N++TPYFLVYIK+G E ++EPLK
Sbjct: 1189 FKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLVYIKNGSEFDVEPLK 1240

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 43/99 (43%), Gaps = 23/99 (23%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAV 754
           P GL N+GNTCY+NS LQ  + I PLRD + NY+                          
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPRE---------------------- 96

Query: 755 NKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYL 793
            KP  E+  Q V +LR  F  +    +  VTP   LA L
Sbjct: 97  -KPSEEQHHQLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +I+D  +   W ++ND+ V+ + + ++
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKI 427

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 40/92 (43%), Gaps = 27/92 (29%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAV 754
           P GL N+GNTCY N+ LQ  + I PLR+ +  Y                           
Sbjct: 105 PMGLRNMGNTCYFNASLQALYRIKPLREKVLAY--------------------------- 137

Query: 755 NKPEVERSVQFVYQLRDLFNDMAHSKERCVTP 786
           N+P  +   Q V QLR+ FN  A  KE+  TP
Sbjct: 138 NEPNPDLHGQLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +++D  +   W KYND+ V  V   +V
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKV 462

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 22/92 (23%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAV 754
           P GL N+GNTCYLN+ LQ  F I PLR+ I NY+ ++S                      
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSS---------------------- 145

Query: 755 NKPEVERSVQFVYQLRDLFNDMAHSKERCVTP 786
             P  E   + V +LR+ F+ +   K + V P
Sbjct: 146 VSPADEVHQKIVLELRNCFDSLDKKKFQAVMP 177

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  +  H+G  S  GHY  +I+DR++  IW K+ND+ VT V + ++
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKI 481

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 23/99 (23%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAV 754
           P GL N+GNTCY+NS LQ  + I PLR+ I N++          N+SG            
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKE------NRSG------------ 146

Query: 755 NKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYL 793
                E+ +Q V +L+  F  +    +   TP   LA L
Sbjct: 147 -----EQHIQLVAELKRCFQQLRDRPQESTTPILLLATL 180

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +I+D  +   W ++ND+ V+ + + ++
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKI 473

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 32/56 (57%)

Query: 673 KLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYE 728
           K  NHF+E    D       + P GL N+GNTCY+N+ LQ  F +  +RD I NY+
Sbjct: 84  KGTNHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNYD 139

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  +  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKI 471

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTAS 732
           + F+E    +  +  + + P G  N+GNTCYLN+ LQ  + I PLRD I +Y   ++
Sbjct: 89  SQFIEDLAPEQQFQHANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNST 145

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y L  V  H+G  S  GHY  +I+D  +   W  +ND+ V+ VP+ ++
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKI 472

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           N F+E    +     S + P G  N+GNTCYLNS LQ  + I PLR+ I +Y
Sbjct: 88  NQFIEDLAPEEQLQRSSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSY 139

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKI 478

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 20/111 (18%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLL 735
           NHF+E    +       + P G  N+GNTCYLN+ LQ  + I  LRD + N+     D+ 
Sbjct: 87  NHFIEDLTPEQQVQQFNDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNF-----DVS 141

Query: 736 LNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTP 786
           +N +++G               E E  ++ V +L+  F  + +   + V P
Sbjct: 142 INNDKNG---------------ENETHIKLVTELKRCFEGLKNKSFKSVMP 177

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y+L  +  H+G  S  GHY  +I+D  +  IW K+ND+ V+ + + ++
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKI 477

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 673 KLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTAS 732
           K  +HF+E    D         P G  N+GNTCYLN+ LQ  F +  LR+ I NY+  A 
Sbjct: 85  KTASHFIEDLSPDQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKA- 143

Query: 733 DLLLNMNQSGAMTKRRI 749
               N+N    M  + I
Sbjct: 144 --FTNLNPQDEMHHKLI 158

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +I+D  +  +W K+ND+ V+ V +  V
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIVEKERV 477

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDL 734
           P GL N+GNTCY+N+ LQ  + I+PLR+ I N++  + + 
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y+L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ + + ++
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKI 470

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 47/93 (50%), Gaps = 9/93 (9%)

Query: 1155 SISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESE 1213
            +++  FD      Y L  V IH G +  +GHY    K+ K    W  ++DE+V  V ES 
Sbjct: 679  NVASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCKNDKFG--WLLFDDETVESVSEST 736

Query: 1214 VFDFTED--NTATPYFLVY--IKD--GHEHEIE 1240
            V +FT D  N AT Y L Y  IKD   + H IE
Sbjct: 737  VLEFTGDPNNQATAYVLFYKEIKDIVKYYHSIE 769

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 48/116 (41%), Gaps = 21/116 (18%)

Query: 678 FLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLN 737
           F+E    D       + P G  N+GNTCY+NS LQ  F +  L+D I NY+   +++   
Sbjct: 91  FIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTEGNNI--- 147

Query: 738 MNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYL 793
                              PE E   + V +L+  F  +   K + V P   L+ L
Sbjct: 148 ------------------SPEDELHHKIVIELKKCFETLDGKKFKAVMPVVLLSVL 185

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y+L  +  H+G  S  GHY  +I+D  +   W K+ND+ V+E  + ++
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKI 483

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 44/91 (48%), Gaps = 19/91 (20%)

Query: 651 ISPDQFLNLKVALMKIAHERNSKLINHFLETG---IIDTNYLTSGNWPT----------- 696
           I+P QFL+L    + IA +   KL+          II+T  L  G WP+           
Sbjct: 227 ITPLQFLSLSSKEL-IAEDMFHKLLKSTSSQPCDIIIETRNLNDGKWPSYFFMYNNPMTM 285

Query: 697 ----GLNNIGNTCYLNSLLQYYFTISPLRDY 723
               GL+N+GNTCY+NS LQ    I  LRDY
Sbjct: 286 TGIVGLSNLGNTCYMNSGLQCLVHIPKLRDY 316

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           N+F+E    +         P G  N+GNTCYLN+ LQ  + ++ LRD I NY
Sbjct: 89  NNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKI 477

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           N+F+E    +         P G  N+GNTCYLN+ LQ  + +  LRD I NY
Sbjct: 89  NNFIEDLAPEQQVQQFAETPVGFKNMGNTCYLNATLQALYRVDDLRDMILNY 140

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKI 477

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYED 729
           P G+ N+GNTCY+N+ LQ  + I PLR+ I  ++D
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAFDD 93

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y+L  V  H+G  S  GHY  +++D  +   W K+ND+ VT + + ++
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKI 424

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 21/92 (22%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAV 754
           P G+ N+GNTCY+N+ LQ  F I PLR+ +  +++                      RA+
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEFDEK---------------------RAI 139

Query: 755 NKPEVERSVQFVYQLRDLFNDMAHSKERCVTP 786
            +       Q V +L+  F  +   K   +TP
Sbjct: 140 KEGVDTYHAQLVRELKVTFQKLKDRKGENITP 171

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTAS 732
           P GL N+GNTCY+NS LQ  + +  LRD +  Y++ A+
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQAN 145

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y+L  V  H+G  S  GHY  +I+D K+   W K+ND+ V+ V   ++
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKI 474

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 687 NYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQ 725
           N + +G    GLNN+GNTCY+NS LQ    I P+RDY +
Sbjct: 389 NPIQNGVGNVGLNNLGNTCYMNSALQCLAHIPPIRDYFK 427

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 77/195 (39%), Gaps = 32/195 (16%)

Query: 610 QFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVAL-----M 664
           + Y IS  S T+    L++   A +   + I R+K+  +  +S D   +L   +     +
Sbjct: 16  KLYPISIPSKTTTA--LELKTQAEELTQVPISRQKYMVKGGLSNDSMTDLDSVIKPNSTI 73

Query: 665 KIAHERNSKLI------NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTIS 718
            +    ++ LI      NHF+E    D       + P G  N+GNTCY+N+ LQ  +   
Sbjct: 74  MMLGTPDANLITKPKSQNHFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTD 133

Query: 719 PLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAH 778
            +R  I +Y+  A     N                   PE E   + V +++  F ++  
Sbjct: 134 DIRQMILDYKPPAQSSTYN-------------------PEDEMHHKIVLEIKRCFENLEK 174

Query: 779 SKERCVTPSRELAYL 793
              + V P   L  L
Sbjct: 175 KNFKSVMPMMLLTVL 189

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  +  H+G  S  GHY  +++D  +   W K+ND+ VT V + ++
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKI 480

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           N+F+E    +         P G  N+GNTCYLN+ LQ  + +  +RD I NY
Sbjct: 89  NNFIEDLAPEQQVQQFAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +I+D  +   W K+ND+ VT V + ++
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKI 478

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y+L +V +H G  +YGHY  +   RK  G W + +DESVT V E+EV 
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDESVTIVDEAEVL 731

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 689 LTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           L  G +  GL N GNTC++NS+LQ   +   L +++
Sbjct: 82  LNRGGFVAGLVNDGNTCFMNSVLQSLASSKTLLEFL 117

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           N+F+E    +         P G  N+GNTCYLN+ LQ  + ++ LR+ I NY
Sbjct: 89  NNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLREMILNY 140

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            YNL  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKI 477

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            ++  FD      Y L  V IH G +  +GHY    K+ K    W  ++DE+V  V E  V
Sbjct: 576  VASTFDSSIAKKYELTGVVIHMGGSPQHGHYVSLCKNDKFG--WLLFDDETVESVTEKTV 633

Query: 1215 FDFTED--NTATPYFLVYIKDGHEHEIEPL 1242
             +FT D  N AT Y L Y K+  E + +P+
Sbjct: 634  LEFTGDSSNQATAYVLFY-KELDEKDTKPV 662

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLR 721
           Y    N   G  N GNTCY NS+LQ  + ++ LR
Sbjct: 129 YGDGSNKVFGYENFGNTCYCNSVLQCLYNLTELR 162

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 43/99 (43%), Gaps = 20/99 (20%)

Query: 651 ISPDQFLNLKVA-----------LMKIAHERNSKLI-------NHFLETGIIDTNYLTSG 692
           I+P QFL L +            L KI    +  +I       NH   +     N L   
Sbjct: 301 ITPLQFLELPIKKLLIPDMFENRLDKITSNPSDLVIEIKPIEGNHHWPSNYFAYNKLEPA 360

Query: 693 NWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI--QNYED 729
           +  TGL N+GNTCY+NS LQ    I  LRDY     YED
Sbjct: 361 SGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYED 399

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1155 SISHKFDQFTNFG---YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPE 1211
            +I  KFD  T  G   Y+L +V +H G  +YGHY  +   RK  G+W + +DE+V  V E
Sbjct: 707  TIRKKFDS-TPIGPLTYSLRSVIVHYGTHNYGHYIAF---RKYRGVWWRISDETVYIVDE 762

Query: 1212 SEVF 1215
            +EV 
Sbjct: 763  AEVL 766

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%)

Query: 684 IDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           +D+N L  G +  GL N GNTC++NS+LQ   +   L D++
Sbjct: 116 MDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFL 156

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 1155 SISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESE 1213
            ++S  FD   +  Y L +  IH G+   YGHY    K       W  ++DE+V  V E  
Sbjct: 546  TVSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCKTETFG--WLLFDDETVEAVDEQT 603

Query: 1214 VFDFTEDNTATPYFLVY 1230
            V  FT +N+ T Y L Y
Sbjct: 604  VLSFTGENSDTAYVLFY 620

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASD 733
           Y    N   G  N GNTCY NS+LQ +F  S  R  + ++  + SD
Sbjct: 119 YGDGSNKIFGYENFGNTCYCNSILQCFFNHSVFRTSMLSFPSSNSD 164

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 44/99 (44%), Gaps = 25/99 (25%)

Query: 1167 GYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD-------FTE 1219
             YNL  V +H G+ S GHY+  IK   +   W +++DE V  V + +VFD         E
Sbjct: 495  NYNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKVWRVTKKQVFDENFGLNRLPE 553

Query: 1220 DNT----------------ATPYFLVYIKDGHEHEI-EP 1241
            D                   + Y LVY+KD  E+ I EP
Sbjct: 554  DTLRKMTRKEYQDYLIARHTSAYMLVYVKDLAENGILEP 592

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRR 748
            G  N G TCYLNSLLQ YF     RD +  Y+   +D   N N S A+  +R
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV--YQIPTAD--ENPNDSVALALQR 307

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 32/66 (48%)

Query: 658 NLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTI 717
           NLK+       E   +  N+   +     N LT      GLNN+GNTCY+NS LQ    I
Sbjct: 304 NLKIETGDFVIEIKQEGKNYHWLSNYFHYNALTPSRGNIGLNNLGNTCYMNSALQCLVHI 363

Query: 718 SPLRDY 723
             LRDY
Sbjct: 364 PQLRDY 369

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L +V +H G  +YGHY  Y   RK  G+W + +DESV  V E+EV 
Sbjct: 689  YALRSVIVHYGTHNYGHYIAY---RKFRGVWWRISDESVYVVDEAEVL 733

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y+L AV IH G  +YGHY  Y   RK    W + +DESV EV E EV 
Sbjct: 422  YDLKAVIIHYGTHNYGHYISY---RKFMNQWWRISDESVIEVDEMEVL 466

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 14/111 (12%)

Query: 1127 LIKQLDSFSLEIDKELSNLDDKIK-----DMENSISHKFDQFT-NFGYNLFAVFIHRGEA 1180
            L+ QL  F  +++ + + L+D+++     +++  +    D++  N  Y+L  V  H+G  
Sbjct: 342  LVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQGTV 401

Query: 1181 SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYI 1231
              GHY    K     G W K+ND  VT V E +V +         Y L YI
Sbjct: 402  DQGHYTTVSKTE--DGQWFKFNDSVVTSVTEEQVLE------QQAYLLFYI 444

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 24/37 (64%)

Query: 687 NYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
           N L  G+  TGL N+GNTCY+NS LQ    I  LRDY
Sbjct: 355 NKLEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDY 391

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 17/117 (14%)

Query: 1133 SFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDR 1192
            SFS +ID  + N      D+   + HK D   +  Y+L+AV  H G    GHY  Y+K+ 
Sbjct: 1021 SFSDKIDATV-NFPVTALDLSKHVVHKDDPRGSI-YDLYAVDNHYGGLGGGHYTAYVKNF 1078

Query: 1193 KNSGIWRKYNDESVTE-VPESEVFDFTEDNTATPYFLVYI---KDGHE---HEIEPL 1242
             +S  W  ++D  VTE VPE+ +       + + Y L YI   KDG+E   HE++ +
Sbjct: 1079 ADSK-WYYFDDSRVTETVPENSI-------SGSAYLLFYIRRAKDGNELGSHELQEI 1127

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 695 PTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYE 728
           P GL N+GNTCYLN+ LQ  F    L+D I  Y+
Sbjct: 108 PLGLQNMGNTCYLNATLQALFRADELKDLILQYD 141

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            Y+L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ + + ++
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKI 473

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD--FTEDN---- 1221
            YNL  V +H G+ S GHY+  IK       W +++D+ V +V +++ FD  F  DN    
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNVTDQ-WFRFDDDKVWKVTKTQAFDENFGHDNLPDE 497

Query: 1222 -----------------TATPYFLVYIKDGHEHEI 1239
                               + Y LVYI++  E ++
Sbjct: 498  KLRTFTREQYQNYLIARQTSAYMLVYIREDMEEKV 532

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 24/38 (63%)

Query: 687 NYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           N LT  +  TGL N+GNTCY+NS LQ    I  LRDY 
Sbjct: 284 NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYF 321

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            T   Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 620  TPLTYSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVGIVTEAEVL 668

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 672 SKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQ 712
           +K +  +     +D   L  G +  GL N GNTC++NS+LQ
Sbjct: 42  AKRMTSYYSAPSMDDVILKRGGFVAGLVNDGNTCFMNSVLQ 82

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y+L +V +H G  +YGHY  +   RK+ G W + +DE+V  V E+EV 
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAF---RKHRGFWWRISDETVYIVDEAEVL 752

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 20/92 (21%)

Query: 651 ISPDQFLNLKVALMKIAHERNSKLINHFLETG---IIDTN-YLTSGNWPT---------- 696
           ++P QFL+   A+ KI  +   K +  F  T    +I+T     S +WP+          
Sbjct: 267 LNPIQFLSFN-AITKITTQLMDKQMKEFTPTSFDFVIETKPKQKSSHWPSNFLIYNNLQS 325

Query: 697 -----GLNNIGNTCYLNSLLQYYFTISPLRDY 723
                GL N+GNTCY+NS LQ    I   RDY
Sbjct: 326 SPGTIGLTNLGNTCYMNSALQCITHIPIFRDY 357

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
            Y L  V +H G+ S GHY+  IK       W +++DE V +V +++VFD
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFD 478

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 681 TGIIDTNYLTSGNWPT----GLNNIGNTCYLNSLLQYYFTISPLR 721
           TG++  N+L   +       G  N G TCYLNSLLQ YF     R
Sbjct: 174 TGVLWHNFLNYNSKKVTGYVGFKNQGATCYLNSLLQSYFFTKYFR 218

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            +S  FD   +  Y L  V IH G    +GHY    K+ K    W  Y+DE+V  V E  V
Sbjct: 592  VSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICKNEKFG--WLLYDDETVESVSEETV 649

Query: 1215 FDFT--EDNTATPYFLVY 1230
              FT    +  T Y L Y
Sbjct: 650  LKFTGHSGDQTTAYVLFY 667

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 19/40 (47%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           Y    N   G  N GNTCY NS+LQ  + I   R  +  Y
Sbjct: 128 YGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 9/63 (14%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y+L ++ +H G   YGHY  Y   R+    W + +DESV +V E EVF      +A+  F
Sbjct: 428  YSLKSIVVHYGSHDYGHYISY---RRFEDQWWRISDESVLKVDEDEVF------SASGIF 478

Query: 1228 LVY 1230
            +V+
Sbjct: 479  IVF 481

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            T   Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 679  TPLTYSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 727

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 684 IDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN-----YED 729
           +D   L  G +  GL N GNTC++NS+LQ   +   L D++ N     YED
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYED 139

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            T   Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 678  TPLTYSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 726

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 684 IDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN 726
           +D   L  G +  GL N GNTC++NS+LQ   +   L +++ N
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSKELMEFLDN 131

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 677 HFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
           H+L    I  N L      TGL N+GNTCY+NS LQ    I  LRDY
Sbjct: 284 HWLSNYFI-YNTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDY 329

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 23/174 (13%)

Query: 1062 ELLAKKQESLQLHETLEAIKQRRKKILSKNDAGL--TLKDSLKETKIFLESSVLAESEGK 1119
            E   +++ ++ LH+ L+     +K++LS ND+    T KD  + TK      +   S   
Sbjct: 861  EAEGQEKRAISLHDCLKLFS--KKEVLSMNDSWYCPTCKDHRQATK-----QIQLWSTPD 913

Query: 1120 IRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGE 1179
            + +      +   SFS +ID  + +   K  DM   + H+  + +   Y+L AV  H G 
Sbjct: 914  VLLIHLKRFENQRSFSDKIDDTV-HFPIKSLDMTEHLVHEDPRGS--IYDLIAVDNHFGG 970

Query: 1180 ASYGHYWVYIKDRKNSGIWRKYNDESVTEV-PESEVFDFTEDNTATPYFLVYIK 1232
               GHY  Y+K       W  ++D  VTE  PES +         + Y L Y++
Sbjct: 971  LGGGHYTAYVKTNDK---WFYFDDSRVTETKPESSI-------AGSAYLLFYLR 1014

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 40/91 (43%), Gaps = 18/91 (19%)

Query: 651 ISPDQFLNLKVA-----------LMKIAHERNSKLI-------NHFLETGIIDTNYLTSG 692
           I+P QFL L +            L KI    +  +I       +H   +     N L   
Sbjct: 301 ITPLQFLELPIKKLLIPAMFGNRLDKITSNPSDLVIEIKPIEGHHHWASNYFAYNKLEPA 360

Query: 693 NWPTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
           +  TGL N+GNTCY+NS LQ    I  LRDY
Sbjct: 361 SGTTGLVNLGNTCYMNSALQCLVHIPQLRDY 391

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 54/108 (50%), Gaps = 14/108 (12%)

Query: 1133 SFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDR 1192
            SFS +ID  + N      D+  ++ +K D   +  Y+L+AV  H G    GHY  Y+K+ 
Sbjct: 1015 SFSDKIDATV-NFPITDLDLSKNVVYKDDPRGSI-YDLYAVDNHYGGLGGGHYTAYVKNF 1072

Query: 1193 KNSGIWRKYNDESVTE-VPESEVFDFTEDNTATPYFLVYI---KDGHE 1236
             N+  W  ++D  VTE VPE+ +         + Y L YI   KDG E
Sbjct: 1073 ANNK-WYYFDDSRVTETVPENSI-------AGSAYLLFYIRRPKDGDE 1112

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 8/69 (11%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y L +V +H G  +YGHY  +   RK  G+W + +DE+V  V E+EV      +T   + 
Sbjct: 679  YALRSVIVHYGTHNYGHYIAF---RKFRGLWWRISDETVYVVDEAEVL-----STPGIFM 730

Query: 1228 LVYIKDGHE 1236
            L Y  D +E
Sbjct: 731  LFYEHDYNE 739

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 689 LTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN 726
           L  G +  GL N GNTC++NS+LQ   +   L  ++ N
Sbjct: 92  LKRGGYVGGLVNDGNTCFMNSVLQSLASSKTLLQFLDN 129

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            T   Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 681  TPLTYSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 729

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 684 IDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN 726
           +D   L  G +  GL N GNTC++NS+LQ   +   L D++ N
Sbjct: 89  LDEEVLKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDN 131

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y L +V +H G  +YGHY  +   RK  G+W + +DE+V  V E+EV      +T   + 
Sbjct: 678  YALRSVIVHYGSHNYGHYIAF---RKFRGLWWRISDETVYVVDEAEVL-----STPGVFM 729

Query: 1228 LVYIKD 1233
            L Y  D
Sbjct: 730  LFYEHD 735

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 685 DTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGA 743
           +   L  G +  GL N GNTC++NS++Q   +   L  ++      AS  L N N++ +
Sbjct: 87  EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELMEASKELENPNETSS 145

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 29/59 (49%), Gaps = 11/59 (18%)

Query: 676 NHFLETGIIDTNYLTSGNW-----------PTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
           N  +E   ID NY    N+             GL+N+GNTCY+NS LQ    I  LRDY
Sbjct: 292 NFIIEVKQIDKNYHWVSNYFKYNDFHHAKGTMGLSNLGNTCYMNSALQCLVHIPQLRDY 350

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV      +T + + 
Sbjct: 672  YELRSVIVHYGTHNYGHYIAF---RKYRGTWWRISDETVHMVDEAEVL-----STPSVFM 723

Query: 1228 LVY 1230
            L Y
Sbjct: 724  LFY 726

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            T   Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 677  TPLTYSLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVDEAEVL 725

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 684 IDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQN 726
           +D   L  G +  GL N GNTC++NS+LQ   +   L +++ N
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 27/100 (27%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIK-DRKNSGIWRKYNDESVTEVPESEVF----------- 1215
            YNL  V +H G+ S GHY+  IK D ++   W +++DE V +V + +VF           
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLEDQ--WYRFDDEKVWKVTKKQVFEENFGLDRRSE 495

Query: 1216 ------------DFTEDNTATPYFLVYI-KDGHEHEIEPL 1242
                        D+      + Y LVYI KD  E  ++P+
Sbjct: 496  DDLKCMTREQYEDYLITRHTSAYMLVYIRKDKEEELLQPV 535

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 40/95 (42%), Gaps = 24/95 (25%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD--FTEDNT--- 1222
            Y L  V +H G+ S GHY+  IK       W +++DE V +V   +VFD  F  D     
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIKPDLGDQ-WYRFDDERVWKVDRKQVFDENFGLDKLPDS 506

Query: 1223 ------------------ATPYFLVYIKDGHEHEI 1239
                               + Y LVY+KD  E EI
Sbjct: 507  ELRGMTKEEYQSYLITRHTSAYMLVYVKDEVEEEI 541

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 651 ISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSL 710
           ++ D  LN+ V  ++I  ++N  L ++F+     D+  +T      G  N G TCYLNSL
Sbjct: 171 VTEDGQLNITV-YVRILEDKNGVLWHNFVN---YDSKKVTGY---VGFRNQGATCYLNSL 223

Query: 711 LQYYFTISPLRDYI 724
           LQ YF     R  +
Sbjct: 224 LQSYFFTKYFRKLV 237

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 17/75 (22%)

Query: 1145 LDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGI---WRKY 1201
            L+D  K+ EN          N  YNL  V +H G+ S GHY+  IK     G+   W ++
Sbjct: 426  LEDSKKEKEN----------NCVYNLHGVLVHAGDISTGHYYTLIK----PGLEDQWYRF 471

Query: 1202 NDESVTEVPESEVFD 1216
            +DE V +V +++VF+
Sbjct: 472  DDERVWKVTKNQVFE 486

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 676 NHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
           NHF+       N L   +  TGL N+GNTCY+NS LQ    +  LRDY
Sbjct: 347 NHFV------YNKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDY 388

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 12/73 (16%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTE-VPESEVFDFTEDNTATPY 1226
            Y+L+AV  H G    GHY  Y+K+  ++  W  ++D  VTE VPE+ V         + Y
Sbjct: 1051 YDLYAVDNHYGGLGGGHYTAYVKNFMDNK-WYYFDDSRVTETVPENSV-------AGSAY 1102

Query: 1227 FLVYI---KDGHE 1236
             L YI   KDG+E
Sbjct: 1103 LLFYIRRTKDGNE 1115

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 687 NYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
           N +T  N   GL N+GNTCY+NS LQ    I   +DY
Sbjct: 340 NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDY 376

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            +S  FD   +  Y L  V IH G    +GHY    K+ K    W  Y+DE+V  + E  V
Sbjct: 581  VSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICKNEKFG--WLLYDDETVESIREETV 638

Query: 1215 FDFT--EDNTATPYFLVYIKDGHEHEIE 1240
              FT    +  T Y L Y K+ H +E +
Sbjct: 639  LKFTGHPGDQTTAYVLFY-KETHVNEAD 665

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 20/40 (50%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           Y    N   G  N GNTCY NS+LQ  + IS  R  +  Y
Sbjct: 118 YGDGSNKVFGYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y+L +V +H G  +YGHY  +   R+  G W + +DESV  V E+EV 
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RRYRGCWWRISDESVYIVEEAEVL 718

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 670 RNSKLINHFLET-GIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQ 712
           RN+  +N FL +   +D   L  G    GL N GNTC++NS+LQ
Sbjct: 59  RNNSTLNRFLPSYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQ 102

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 1161 DQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
            D   N  YNL  V +H G+ S GHY+  IK       W +++D+ V  V + +VF+
Sbjct: 420  DSPANAKYNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVFE 474

 Score = 35.8 bits (81), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 1/22 (4%)

Query: 696 TGLNNIGNTCYLNSLLQ-YYFT 716
            GL N G TCYLNSLLQ YYFT
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFT 211

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAF---RKFRGCWWRISDETVYIVDEAEVL 688

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 655 QFLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQ 712
           QF+  K++ +    + N+         G ID   L  G +  GL N GNTC++NS+LQ
Sbjct: 50  QFIKYKMSDLTNKFKNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQ 107

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G+W  Y+DE + ++ + EV   T       Y
Sbjct: 673  YQLISVVVHEGRSLSSGHYVAHCK--QPDGLWATYDDEYINKISDKEVLRET-----NAY 725

Query: 1227 FLVY 1230
            +LVY
Sbjct: 726  YLVY 729

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+GNTCY+NS+LQ  F  S  RD
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRD 614

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
            YNL  V +H GE S GHY+  IK       W +++D+ V  V + + FD
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDVGDQ-WFRFDDDKVWRVTKEQAFD 486

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 17/28 (60%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           GL N G TCYLNSLLQ YF     R  +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            +S  FD   +  Y L  V IH G    +GHY    K+ K    W  Y+DE+V  + E  V
Sbjct: 587  VSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICKNEKFG--WLLYDDETVESIREETV 644

Query: 1215 FDFT--EDNTATPYFLVY 1230
              FT    +  T Y L Y
Sbjct: 645  LQFTGHPGDQTTAYVLFY 662

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 19/40 (47%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           Y    N   G  N GNTCY NS+LQ  + I   R  I  Y
Sbjct: 126 YGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+GNTCY+NS+LQ  F  +  RD
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRD 634

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L  +  HRG  + GHY  + K   + G W K+ND  VT + + EV 
Sbjct: 411  YELIGIVSHRGTVNEGHYIAFCK--ISGGQWFKFNDSVVTSIAQGEVL 456

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVP 1210
            Y L  +  HRG  + GHY  Y K     G+W ++ND  V +VP
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTKTA--DGVWYQFNDSVVMKVP 463

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y+L +V +H G  +YGHY  +   RK  G+W + +DE+   V E+EV 
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RKFRGVWWRISDETAYIVDEAEVL 718

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y+L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAF---RKYRGYWWRISDETVYIVDETEVL 621

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%)

Query: 656 FLNLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYF 715
            L L     K  +  N+          I D  ++  G +  GL N GNTC++NS+LQ   
Sbjct: 18  ILKLSYPFTKRMYNNNNFFSRKMYNNAINDKKFIKRGGYIAGLVNDGNTCFMNSVLQSLA 77

Query: 716 TISPLRDYIQNYEDTASD 733
           +   L  ++ N  +  S+
Sbjct: 78  SSKELAAFLDNVIENGSE 95

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  +   R+  G W  Y+DE + ++  SE+   TE N    Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHC--RQPDGTWATYDDELINKI--SELKLLTEPNA---Y 813

Query: 1227 FLVYIK 1232
            +LVY +
Sbjct: 814  YLVYTR 819

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 685 DTNYLTSGNWPT---GLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           ++ +L  G+  T   GL N GNTCY NS+LQ  F +S LR  I  Y
Sbjct: 119 ESEHLPCGDGSTKVFGLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            +  K D      Y L  + IH G    +GHY    K   +   W  Y+DE+V  + E  V
Sbjct: 625  VCTKSDTIVCKNYELNGIVIHMGGGPQHGHYVAICK--HDMFGWLLYDDETVESIDEETV 682

Query: 1215 FDFTED--NTATPYFLVY 1230
            F F  D  +  T Y L +
Sbjct: 683  FKFVGDEKDMTTAYVLFF 700

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGI---WRKYNDESVTEVPESEVF 1215
            YNL  V +H G+ S GHY+  IK     G+   W +++DE V  V + +VF
Sbjct: 448  YNLHGVLVHSGDISTGHYYTLIK----PGVEDQWYRFDDERVWRVTKKQVF 494

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 681 TGIIDTNYLTSGNWPT----GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           TG++  N+L   +       G  N G TCYLNSLLQ YF     R  +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV      +T+  + 
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAF---RKYRGCWWRISDETVYVVEEAEVL-----STSGVFM 709

Query: 1228 LVY 1230
            L Y
Sbjct: 710  LFY 712

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 66/144 (45%), Gaps = 27/144 (18%)

Query: 682 GIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI-----QNYEDTASDLLL 736
           G +D + L  G +  GL N GNTC++NS++Q   + + L  ++     +  E   ++LL 
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDDEIAKKEEIDETELLQ 137

Query: 737 NMNQSGAM----TKRRIGGRAVNKP---------------EVERSVQFVYQLRDLFNDM- 776
           +  +  ++     +R++ G++  K                E    V F   LR++ N + 
Sbjct: 138 DEEKPTSVEPDTIERKVKGKSYGKAKKHANRKLANGVSDEEKTPDVTFSLALREMLNKLN 197

Query: 777 -AHSKER-CVTPSRELAYLSFSPS 798
             + KER C   ++ L  ++ SP+
Sbjct: 198 TKYYKERPCFKTNKLLKSMTKSPN 221

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 1157 SHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            S++ D      Y L  V +H G + S GHY V+ K  +  G W  Y+DE + ++ E +V 
Sbjct: 538  SNEKDHVVPVKYQLTTVVVHEGRSLSSGHYIVHCK--QPDGTWATYDDEYINKITERDV- 594

Query: 1216 DFTEDNTATPYFLVYIK 1232
               E N    Y+L+Y +
Sbjct: 595  -LKEPNA---YYLLYTR 607

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYI--QNYEDTASDLLLNMNQ 740
           TGL N+GNTCY+NS+LQ  F     RD      YED  S    N +Q
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSNPHQ 602

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGI---WRKYNDESVTEVPESEVF 1215
            YNL  V +H G+ S GHY+  IK     G+   W +++DE V  V + +VF
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIK----PGVEDQWYRFDDERVWRVTKKQVF 495

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 681 TGIIDTNYLTSGNWPT----GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           TG++  N+L   +       G  N G TCYLNSLLQ YF     R  +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGI---WRKYNDESVTEVPESEVF 1215
            YNL  V +H G+ S GHY+  IK     G+   W +++DE V  V + +VF
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIK----PGVEDQWYRFDDERVWRVTKKQVF 495

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 681 TGIIDTNYLTSGNWPT----GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           TG++  N+L   +       G  N G TCYLNSLLQ YF     R  +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
            YNL  V +H G+ S GHY+  IK   +   W +++D+ V +V + +VF+
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLDDK-WYRFDDDKVWQVTKKQVFE 483

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 17/22 (77%), Gaps = 1/22 (4%)

Query: 696 TGLNNIGNTCYLNSLLQ-YYFT 716
            GL N G TCYLNSLLQ YYFT
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFT 220

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 644 KWAEEPV---ISPDQFL----NLKVALMKIAHERNSKLINHFLETGIIDTNYLTSGNWPT 696
           ++ E PV   I P+ +     NL      +A E      +H   +     N L+  +   
Sbjct: 292 RFVEIPVKQQIKPEHYATPIGNLHFTAADLAVEVKEPGKSHHWTSHYFVYNRLSPSSGTM 351

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           GL N+G+TC++NS+LQ    I+ LRDY 
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYF 379

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E ++    E N    Y
Sbjct: 639  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEKQLLK--EPNA---Y 691

Query: 1227 FLVYIK 1232
            FLVY +
Sbjct: 692  FLVYTR 697

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 1167 GYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
             Y L  V +H G+ S GHY+  IK       W +++DE V +V + +VFD
Sbjct: 440  NYKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKVWKVDKKQVFD 488

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+GNTCY++S+LQ  F  + LRD
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLRD 651

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E +V        +  Y
Sbjct: 645  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKITERDVL-----RESNAY 697

Query: 1227 FLVYIK 1232
            +LVY +
Sbjct: 698  YLVYTR 703

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 13/94 (13%)

Query: 630 VNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYL 689
           +  TDD++ +  R              L++   +  I  +R S+       +     N L
Sbjct: 268 IKVTDDILSKSLRE-------------LDILNGIFIIETKRRSRKTKQHWASNYFHYNKL 314

Query: 690 TSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
                  GL+N+GNTCY+NS LQ    I  +RDY
Sbjct: 315 NRSTGTIGLSNLGNTCYMNSGLQCLVHIPQIRDY 348

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            T   Y+L +V +H G  +YGHY  +   R+  G W + +DE+V  V E+EV 
Sbjct: 650  TPLTYSLRSVVVHYGTHNYGHYIAF---RRYRGYWWRISDETVYIVDETEVL 698

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L ++  H+G  + GHY V +K   N G W K+ND  V+ + E E  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVK--VNDGQWFKFNDSMVSAITEEEAL 478

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%)

Query: 687 NYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           N L S     GL+N+GNTCY+NS LQ    I   +DY 
Sbjct: 337 NQLLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYF 374

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           G  N GNTCY NS+LQ  + +SPLR+ I
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENI 168

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTED--NTAT 1224
            Y L  + +H G    +GHY    K +K    W  ++DE+V  V E  V +FT +  N AT
Sbjct: 602  YELAGIVVHMGGGPQHGHYVSLCKHQKFG--WLLFDDETVEAVKEETVLEFTGESANMAT 659

Query: 1225 PYFLVY 1230
             Y L Y
Sbjct: 660  AYVLFY 665

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 687 NYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           N L+  +   GL+N+GN+CY+NS LQ    I  LRDY 
Sbjct: 289 NKLSPPSGIVGLSNLGNSCYMNSALQCLVHIPELRDYF 326

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           TGL+N+GN+CY+NS LQ    I  L+DY 
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYF 362

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 1165 NFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            N  Y L A+  H G    GHY      R N  IW K+ND  VT + E ++ 
Sbjct: 406  NMMYKLSAIISHHGTVHQGHYTTIC--RINGDIWAKFNDSMVTVISEEDML 454

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 20/86 (23%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E  V           Y
Sbjct: 638  YQLISVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKITERNVL-----KEVNAY 690

Query: 1227 FLVYIK------------DGHEHEIE 1240
            +LVY +            D H H+++
Sbjct: 691  YLVYTRLTPKSVKLTEKMDSHAHDLK 716

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 1157 SHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
            S  FD   +  Y L  V +H G   +  ++V +   +  G W  ++DE+V  V ES V D
Sbjct: 600  SSTFDSSVSKSYRLQGVVVHMGNGPHHGHYVSLCHTELFG-WLLFDDETVESVDESYVLD 658

Query: 1217 F--TEDNTATPYFLVYIK-DGHEHEIE 1240
            F  + ++  T Y L Y + DG E  ++
Sbjct: 659  FVGSHESPTTAYVLFYSEIDGSERAVQ 685

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 30/98 (30%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGI---WRKYNDESVTEVPESEVFD-------- 1216
            YNL  V +H G+ S GHY+  IK     G+   W +++DE V  V + +VF         
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIK----PGVEDQWYRFDDERVWRVTKKQVFQENFGCDRL 504

Query: 1217 -------FTEDN--------TATPYFLVYIKDGHEHEI 1239
                    T D+          + Y LVYI+   E ++
Sbjct: 505  PDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL 542

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 681 TGIIDTNYLTSGNWPT----GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           TG++  N+L   +       G  N G TCYLNSLLQ YF     R  +
Sbjct: 186 TGVLWHNFLNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
            YNL  V +H G+ S GHY+  I+    S  W +++D+ V  V + + FD
Sbjct: 441  YNLHGVLVHAGDISTGHYYTMIRPGV-SDEWYRFDDDKVWRVTKKQAFD 488

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 13/78 (16%)

Query: 656 FLNLKVALMKIAHERNSKLINHFLETGII-----------DTNYLTSGNWPTGLNNIGNT 704
            +NL  A   + HERN ++  H  +T  +             N   S +  TGL N+GNT
Sbjct: 559 LMNLHSA-RPLLHERNYQIPPHLQQTTTLTRRPSIPTIERSPNLYVSLSI-TGLRNLGNT 616

Query: 705 CYLNSLLQYYFTISPLRD 722
           CY+NS+LQ  F     RD
Sbjct: 617 CYINSMLQCLFATRRFRD 634

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 39.3 bits (90), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 12/98 (12%)

Query: 1121 RIEKRNLIKQLDSFSLEIDKELSNLDD--------KIKDMENSISHKFDQFTNFGYNLFA 1172
            ++ ++ L++ L+  +  ++   S+ DD          +D  N+ + KF       Y L+ 
Sbjct: 653  KLCRKALLQYLNDVASSVEWVFSHPDDDGSLETETAPQDTANA-ARKFGHPGGSIYKLYG 711

Query: 1173 VFIHRGEASY-GHYWVYIKDRKNSGIWRKYNDESVTEV 1209
            +  H+G ++  GHY  YI+ R   G W  YNDE +  V
Sbjct: 712  IVCHKGNSTQSGHYVAYIRQR--DGQWTLYNDEKIVCV 747

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E +V   T       Y
Sbjct: 644  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISERDVLKET-----NAY 696

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 697  YLLYTR 702

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIK-DRKNSGIWRKYNDESVTEVPESEVFD 1216
            Y L  V +H G+ S GHY+  IK D ++   W +++DE V +V + +VF+
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQDQ--WYRFDDEKVWKVTKKQVFE 491

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E +V    E N    Y
Sbjct: 669  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKISERDVLK--EPNA---Y 721

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 722  YLLYTR 727

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYIQ--NYE 728
           TGL N+G TCY+NS+LQ  F  +  RD  +  NYE
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYE 633

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  +   R+  G W  Y+DE + ++ E  V        A  Y
Sbjct: 691  YELLSVVVHEGRSLSSGHYIAHC--RQPDGSWATYDDEYINKISELNVL-----KEANAY 743

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 744  YLLYTR 749

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD----------- 1216
            Y L  V +H G+ S GHY+  I+   + G W +++D+ V +  + +VF+           
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPDAH-GSWYRFDDDRVIKATDKQVFEENFGKAKLPDD 489

Query: 1217 ----FTED--------NTATPYFLVYIKDGHEHEI 1239
                FT+D           + Y LVYI+   E  I
Sbjct: 490  EIQGFTKDEYQNYLLARQTSAYMLVYIRKDMEESI 524

>Ecym_1534 Chr1 complement(1097497..1098129) [633 bp, 210 aa] {ON}
            similar to Ashbya gossypii ABR237C
          Length = 210

 Score = 37.7 bits (86), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 76/166 (45%), Gaps = 20/166 (12%)

Query: 994  FRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVYYD---REKLMPFKSTEPLPFGEKL 1050
            FR  L+  GD N +   +V V+ +   L+  +  V  D   REKL      + + F +  
Sbjct: 39   FRQLLMEKGDFNTQQANAV-VDIMSDALRGGVTHVSQDLASREKLTKLTYQQRVDFAK-- 95

Query: 1051 YMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLES 1110
              D+ + +  SE+     E  ++   LE ++ + ++ ++K +AG  L  SL++       
Sbjct: 96   LKDQLLTADRSEIHLIHSEQERIRNDLEQLRNKLREEITKANAGFKLDLSLEK------- 148

Query: 1111 SVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENSI 1156
                   G+IR E RN   Q+      ID+E+SN+  +I  ++  +
Sbjct: 149  -------GRIREEARNHDLQIKEIDTRIDQEVSNMKMQIDSVKTQV 187

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 38.5 bits (88), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 15/110 (13%)

Query: 1127 LIKQLDSFSLEIDKELSNLDDKIK-----DMENSISHKFDQFTNFGYNLFAVFIHRGEAS 1181
            L+ QL  F   ++   + L+D ++     +M N      D   +  + L  +  HRG  +
Sbjct: 361  LVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDG--DDVPDIIFELIGIIAHRGTVN 418

Query: 1182 YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYI 1231
             GHY  + K    +G W K+ND  V+ + E E+           Y L Y+
Sbjct: 419  EGHYIAFTK--VTTGHWFKFNDSMVSSITEEELLQ------EQAYLLFYV 460

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L  V +H G + S GHY V+ K  +  G W  Y+DE +  + E +V    E N    Y
Sbjct: 587  YQLITVVVHEGRSLSSGHYIVHCK--QPEGHWATYDDEYINNINEKDV--LREPNA---Y 639

Query: 1227 FLVYIK 1232
            +LVY +
Sbjct: 640  YLVYTR 645

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L +V +H G  +YGHY  +   R+  G W + +DESV  V E EV 
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAF---RRFRGCWWRISDESVYIVDEQEVL 725

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTED--NTAT 1224
            Y L  + +H G    +GHY    K  K    W  ++DE+V  V E  V +FT +  N AT
Sbjct: 602  YELAGIVVHMGGGPQHGHYVSLCKHEKFG--WLLFDDETVEAVKEETVLEFTGESPNMAT 659

Query: 1225 PYFLVY 1230
             Y L Y
Sbjct: 660  AYVLFY 665

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           Y    N   G  N GNTCY NS+LQ  + +S LR+ I
Sbjct: 132 YGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENI 168

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+GNTCY+NS+LQ  F     RD
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFRD 704

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 7/52 (13%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGI---WRKYNDESVTEVPESEVFD 1216
            Y L  V +H G+ S GHY+  IK     G+   W +++DE V +V + + FD
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIK----PGLEDQWYRFDDERVWKVSKKQAFD 487

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 64/153 (41%), Gaps = 17/153 (11%)

Query: 1068 QESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNL 1127
            Q    LHE L++  +R     S  D     K+ +  +    + S +A+    + ++ +  
Sbjct: 317  QNKSTLHECLDSFHRRE----SLTDFNYCCKNCMSTSNPIRQLS-MAKLPPVLMLQLKRF 371

Query: 1128 IKQLDSFSLEIDKEL-----SNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASY 1182
               ++  S++I+  +      N+ D  K M++          N  + L A+  H+G    
Sbjct: 372  EHLINGTSVKINDYIFFSVDLNMKDYCKPMDDQ-----HPVPNLTFKLSAIIPHQGTVDK 426

Query: 1183 GHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            GHY      R N  +W K+ND  VT + E ++ 
Sbjct: 427  GHYTTIC--RINGDVWAKFNDSMVTLISEEDML 457

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTED--NTAT 1224
            Y L  + +H G    +GHY    K  K    W  ++DE+V  V E  V +FT +  N AT
Sbjct: 605  YQLAGIVVHMGGGPQHGHYVSLCKHEKFG--WLLFDDETVEAVKEETVLEFTGESPNMAT 662

Query: 1225 PYFLVY 1230
             Y L Y
Sbjct: 663  AYVLFY 668

 Score = 36.2 bits (82), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           G  N GNTCY NS+LQ  + +S LR+ I
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLRENI 169

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 665 KIAHERNSKLINHFLETGII-DTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRD 722
           K   E  S  I+   E   I D+  L S    TGL N  NTCY+NS++Q  F  +P RD
Sbjct: 260 KQKEEAASSFISETFEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRD 318

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+GNTCY+NS+LQ  F  +  R+
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRN 779

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYI--QNYEDTASDLLLNMNQ 740
           TGL NIG TCY+NS+LQ  F     RD      YE   S    N NQ
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQ 602

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E EV    E N    Y
Sbjct: 662  YELLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEREV--LKERNA---Y 714

Query: 1227 FLVYIK 1232
            +++Y +
Sbjct: 715  YVLYTR 720

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E E+           Y
Sbjct: 755  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEREML-----KEPNAY 807

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 808  YLLYTR 813

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLL 735
           G  N GNTCY NS+LQ  F ++  R+ I  + + A D L
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQFPERAPDEL 153

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            ++ KFD   +  Y L  V +H G    +GHY V +    N G W  ++DE+V  + E +V
Sbjct: 583  VASKFDPSVSKKYELTGVVLHMGGGPQHGHY-VSVCKTDNFG-WLFFDDETVETLDEPQV 640

Query: 1215 FDFT 1218
             +FT
Sbjct: 641  LNFT 644

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 62/154 (40%), Gaps = 25/154 (16%)

Query: 630 VNATDDLILEIFRRKWAEEPVISPDQFLNLK-VALMKIAHERNSKLINHFLETGIID--- 685
             AT  +I+E  R       V + D   N + +A+   +H+  S + +  L T + +   
Sbjct: 34  ATATPPIIIEPTRNHNGSSLVHNDDSERNTEPIAITNGSHDSTSDISHDPLHTEVFEYMP 93

Query: 686 ----TNYLTS----GNWPT---GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDL 734
                N +T+    G+  T   G  N GNTCY NS+LQ  + ++  R  I  Y       
Sbjct: 94  SYTIPNTITADLPFGSGSTKVFGYENFGNTCYCNSVLQCLYNLTEFRTEILKYP------ 147

Query: 735 LLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQ 768
               ++ G + +RR       KP V     F  Q
Sbjct: 148 ----SRDGLLRRRRKSSVVGVKPRVFTEASFTSQ 177

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 47/101 (46%), Gaps = 14/101 (13%)

Query: 1127 LIKQLDSFSLEIDKELSNLDDKIK-----DMENSISHK-FDQFTNFG------YNLFAVF 1174
            L+ QL  F   ++     LDD I+     +M+N  S K  D+ +  G      Y L  + 
Sbjct: 358  LVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIV 417

Query: 1175 IHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
             H+G  + GHY  + K   + G W K+ND  V+ + + EV 
Sbjct: 418  SHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 696  TGLNNIGNTCYLNSLLQYYFTISPLRD 722
            TGL N+ NTCY+NS+LQ  F+ S  R+
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRN 1131

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 57/145 (39%), Gaps = 30/145 (20%)

Query: 601 LLQRCPRFQQFY----HISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQF 656
           ++QRC   + FY    H+   S T  + Y  +N    D    +     +    V+SP  F
Sbjct: 230 VIQRC--LEVFYAKEPHLDKSSLTHRIWY--INERVADPKSTQTLLSNY----VLSPSAF 281

Query: 657 LNLKVA------------------LMKIAHERNSKLINHFLETGIIDTNYLTSGNWPTGL 698
           L L+                    ++ +  E   K  N    +     N L + +   GL
Sbjct: 282 LELQTKHEITKSMYSRQLKDYDSQIISLVVEVKQKSSNQHWPSNFFHYNKLNAPSGIMGL 341

Query: 699 NNIGNTCYLNSLLQYYFTISPLRDY 723
           +N+GNTCY+NS LQ    I  L +Y
Sbjct: 342 SNLGNTCYMNSALQCLLHIPELNEY 366

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 21/37 (56%)

Query: 691 SGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           S N   G  N GNTCY NS+LQ  + I  LRD +  Y
Sbjct: 107 SSNKVFGYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  +   R+  G W  Y+DE + ++ E  V    E N    Y
Sbjct: 607  YQLISVVVHEGRSLSSGHYIAHC--RQPDGSWAIYDDEYINKISERNV--LKEPNA---Y 659

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 660  YLIYTR 665

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E ++           Y
Sbjct: 395  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKISEKQML-----KEPGAY 447

Query: 1227 FLVYIK 1232
            +LVY +
Sbjct: 448  YLVYTR 453

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD 1216
            Y+L  V +H G+ S GHY+  IK       W +++D+ V  V +++VF+
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVTKNQVFE 490

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+G+TCY+NS+LQ  F     RD
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRD 639

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 691 SGNWPTGLNNIGNTCYLNSLLQYYFT 716
           +GN+  GL N+GN+CYLNS+LQ  F 
Sbjct: 314 NGNFGCGLINLGNSCYLNSILQALFA 339

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E +V    E N    Y
Sbjct: 657  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGNWATYDDEYINKISERDV--LKEPNA---Y 709

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 710  YLLYTR 715

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+GNTCY+NS++Q  F     R+
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFRN 717

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 1155 SISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESE 1213
            +IS  FD   +  Y L ++ +H GE+   GHY    K +  S  W  Y+DE+V  V +  
Sbjct: 574  NISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKHK--SYGWLIYDDETVQAVSDEL 631

Query: 1214 VFDF--TEDNTATPYFLVY 1230
            V      E  +AT Y L Y
Sbjct: 632  VSRILNNEQRSATAYLLFY 650

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 16/28 (57%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           G  N G TCY NS+LQ  F I   RD I
Sbjct: 107 GFQNFGYTCYCNSILQALFNIGSFRDGI 134

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L  +  H+G  + GHY  + K   + G W K+ND  V+ + + EV 
Sbjct: 413  YELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 458

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           +GL N+GNTCY+NS+LQ  F  +  R+
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRN 472

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 1149 IKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTE 1208
            I++ E  I +K  +  +  Y L  +  H+G  + GHY  + K   + G W K+ND  V+ 
Sbjct: 394  IRESEKHIGNK--KVPDIIYELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSS 449

Query: 1209 VPESEVF 1215
            + + EV 
Sbjct: 450  ISQEEVL 456

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE + ++ E ++           Y
Sbjct: 627  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEKQML-----KEPGAY 679

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 680  YLIYTR 685

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
            Anc_8.202 YER151C
          Length = 854

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 4/83 (4%)

Query: 1153 ENSIS-HKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPE 1211
            E S+S H + Q TN  Y L  V  H G +S G ++      K +  W + +D ++TE+ +
Sbjct: 772  EESLSPHSWSQ-TNRKYQLTGVIYHHGLSSDGGHYTADVFNKTADKWYRIDDINITELKK 830

Query: 1212 SEVFDFTED--NTATPYFLVYIK 1232
             +V    ED  +T T Y L+Y K
Sbjct: 831  DDVLKGGEDGTDTRTAYILMYQK 853

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 1152 MENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDES 1205
            M NS+  K  Q   F Y L AV  H G    GHY  Y+    + G W  ++D S
Sbjct: 718  MTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNKGPDVG-WYYFDDSS 770

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRD 722
           G+ N+GNTCY+NS+LQ  F  +  RD
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRD 239

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 21/35 (60%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTA 731
           G  N GNTCY NS+LQ  +  S LRD +  Y + A
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILYPEEA 162

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 1156 ISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEV 1214
            +S  F+      Y L  V IH G    +GHY    ++ K    W  Y+DE+V  + E  V
Sbjct: 589  VSSTFNTSVYKKYELSGVVIHMGSGPQHGHYVCICRNEKFG--WLLYDDETVESIKEETV 646

Query: 1215 FDFT--EDNTATPYFLVY 1230
              FT    +  T Y L Y
Sbjct: 647  LQFTGHPGDQTTAYVLFY 664

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 19/40 (47%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           Y    N   G  N GNTCY NS+LQ  + I   R  +  Y
Sbjct: 126 YGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 21/100 (21%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVN 755
           TGL N+GNTCY+N +LQ  F               A++ L N+  SG   + ++      
Sbjct: 648 TGLRNLGNTCYINCMLQSLF---------------ATNELKNLFISGKYREYQM------ 686

Query: 756 KPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSF 795
           KP   +         +LFN M  +    V PS  L   +F
Sbjct: 687 KPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNF 726

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + + GHY  + K  +  G W  Y+DE + ++ E ++           Y
Sbjct: 648  YQLISVVVHEGRSLTSGHYIAHCK--QPDGSWSTYDDEYINKISERQML-----KEPGAY 700

Query: 1227 FLVYIK 1232
            +LVY +
Sbjct: 701  YLVYTR 706

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y L  +  H G  + GHY  + K    +G W K+ND  VT++ E +V           Y 
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCKIE--NGEWFKFNDSMVTKILEKDVL------KEQAYL 452

Query: 1228 LVYI 1231
            L YI
Sbjct: 453  LFYI 456

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLR 721
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFR 634

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 1168 YNLFAVFIHRGEAS-YGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNT--AT 1224
            Y L  + +H G    +GHY    K+  N G W  ++DE+V  V E  V DF  D++   T
Sbjct: 658  YELSGIVVHMGGGPQHGHYVSLCKN-DNFG-WLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1225 PYFLVY 1230
             Y L Y
Sbjct: 716  AYVLFY 721

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLR 721
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623

>ABR237C Chr2 complement(843933..844562) [630 bp, 209 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YFL046W
          Length = 209

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 16/125 (12%)

Query: 1032 REKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKN 1091
            REKL      + + F +    D+ + +  SE+ + + E  ++   LE ++ R ++ ++K 
Sbjct: 78   REKLTKLTYQQRVDFAK--LRDQLLTADRSEIHSIQNEQERIRNDLEQLRNRLREEITKA 135

Query: 1092 DAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKD 1151
            +AG  L  SL+              +G+IR E  N   Q+      ID+E+SN+  +I  
Sbjct: 136  NAGFKLDLSLE--------------KGRIREESSNHNLQIKEIDTRIDQEVSNMKMQIDS 181

Query: 1152 MENSI 1156
            ++  +
Sbjct: 182  VKTQV 186

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 690 TSGNWPTGLNNIGNTCYLNSLLQYYF 715
            S  +  GLNN+GN+CY+NS+LQ  F
Sbjct: 307 ASKEYGCGLNNLGNSCYMNSVLQVLF 332

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N+ NTCY+NS+LQ  F+ +  R+
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRN 772

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 36.6 bits (83), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLR 721
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPY 1226
            Y L +V +H G + S GHY  + K  +  G W  Y+DE +  + E +V    E N    Y
Sbjct: 674  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINIISERDV--LKEPNA---Y 726

Query: 1227 FLVYIK 1232
            +L+Y +
Sbjct: 727  YLLYTR 732

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 44/108 (40%), Gaps = 21/108 (19%)

Query: 683 IIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSG 742
           I D+N L S    TGL N  NTCY+NS++Q  F  +  RD    +      L LN N+  
Sbjct: 285 IEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDL---FLTKKYRLFLNTNK-- 339

Query: 743 AMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSREL 790
                             + VQ    +  LF  M  +  R + P+R L
Sbjct: 340 ----------------YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFL 371

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 36.2 bits (82), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLR 721
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFR 626

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 10/71 (14%)

Query: 657 LNLKVALMKIAHERNSK----LINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQ 712
           LN+    + I  E+++K    L N+F+   ++ +  +T      GL N+GNTCY+NS LQ
Sbjct: 284 LNIASGDLVIETEQHNKNYHWLSNYFIYNDLVPSLEIT------GLVNLGNTCYMNSALQ 337

Query: 713 YYFTISPLRDY 723
               I   R+Y
Sbjct: 338 CITHIPVFREY 348

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 1155 SISHKFDQFTNFGYNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESE 1213
            ++   FD      Y L  V +H G + ++GHY    K  K    W  Y+DE++  +PE  
Sbjct: 570  TVCSCFDNSLCKTYELTGVVLHVGASPTHGHYVSICKHEKYG--WLMYDDETIESIPEEA 627

Query: 1214 VFDFT--EDNTATPYFLVY 1230
            V       +N  T Y L Y
Sbjct: 628  VTSHVGEPNNPITAYVLFY 646

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar to
            uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
            Ubiquitin hydrolase required for recycling ubiquitin from
            proteasome-bound ubiquitinated intermediates acts at the
            late endosome/prevacuolar compartment to recover
            ubiquitin from ubiquitinated membrane proteins en route
            to the vacuole
          Length = 861

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 1162 QFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDES 1205
            Q   F YNL+AV  H G    GHY  Y+ D+ +   W  ++D S
Sbjct: 792  QVPPFNYNLYAVACHFGTLYGGHYTSYV-DKGDKAGWCYFDDTS 834

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L  V  H G  + GHY   +K   N+  W K+ND  VT + E EV 
Sbjct: 380  YELNGVISHIGTVNEGHYIATLKLDSNN--WFKFNDSMVTSISEEEVL 425

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 35.8 bits (81), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 36/95 (37%), Gaps = 24/95 (25%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFD----------- 1216
            Y L  V +H G+ S GHY+  IK       W +++D+ V    + ++FD           
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRVWRATKKQIFDDNFGFDRLPDE 498

Query: 1217 ------------FTEDNTATPYFLVYIKDGHEHEI 1239
                        +        Y LVYI +  E EI
Sbjct: 499  KIRTMTREQYQDYLIQRHTNAYMLVYIAEEKEEEI 533

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 16/22 (72%), Gaps = 1/22 (4%)

Query: 696 TGLNNIGNTCYLNSLLQ-YYFT 716
            G  N G TCYLNSLLQ YYFT
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFT 224

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 10/69 (14%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNK 756
           G  N GNTCY NS+LQ  + +S +R+ I  + +         N+S    K  + G   NK
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQFPEKP-------NESTHPRKYEVKG---NK 191

Query: 757 PEVERSVQF 765
           P +     F
Sbjct: 192 PRIFTEASF 200

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 1168 YNLFAVFIHRGEA-SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTED--NTAT 1224
            Y L  + +H G    +GHY    K       W  ++DE+V  V E  V +FT +  N AT
Sbjct: 604  YELSGIVVHMGGGPQHGHYVSLCKHEIFG--WLLFDDETVEAVKEEAVLEFTGESPNMAT 661

Query: 1225 PYFLVY 1230
             Y L Y
Sbjct: 662  AYVLFY 667

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
            YBR058C
          Length = 780

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 16/99 (16%)

Query: 1121 RIEKRNLIKQLDSFSLEIDKELSNLDD----KIKDMENSISHKFDQFTNFG------YNL 1170
            ++ K+ LI      +  +D   +N+DD      KD + + SH      N G      Y L
Sbjct: 664  KLCKKALILNNGDVTSSVDWVFNNMDDDGELPQKDTQPAKSHT----ANLGHSSASPYKL 719

Query: 1171 FAVFIHRGEASY-GHYWVYI-KDRKNSGIWRKYNDESVT 1207
             AV  H+G +++ GHY  +I K  +    W  YNDE + 
Sbjct: 720  VAVVCHKGNSAHSGHYVAFIRKSVEQEEKWVLYNDEKIV 758

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
            GL N GNTCY+NS++Q  F    LRD
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLRD 264

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 687 NYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDY 723
           NYL       GL N+GNTCY+NS LQ    +    +Y
Sbjct: 405 NYLVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEY 441

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
            YBR058C (UBP14) - Ubiquitin-specific protease [contig
            183] FULL
          Length = 762

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 1144 NLDDKI---KDMENSISHKFDQFTNFGYNLFAVFIHRGEASY-GHYWVYIK-DRKNSGIW 1198
            N DD +   +D  +S S+     T   + L AV  H+G + + GHY  +IK D +N   W
Sbjct: 671  NTDDTLLETQDGLDSNSYGISDETKANFRLSAVICHKGSSVHSGHYVAFIKKDVENETKW 730

Query: 1199 RKYNDESVT 1207
              YNDE + 
Sbjct: 731  VLYNDEKMV 739

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           GL N GNTCY NS+LQ  + ++  R+ I
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENI 159

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L  +  H G  + GHY V +K   N G W K+ND  ++ + E E  
Sbjct: 406  YELTGILSHIGSINEGHYVVVLK--INDGRWFKFNDSMISVIKEDEAL 451

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 12/94 (12%)

Query: 943  LVKQLFYGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALG 1002
            +   +F G+LK  ++  E     +T  + FM L +++ D   D+Y  LD + + +   L 
Sbjct: 275  VAHSIFQGELKSSIVCPECQNDSKTIIDPFMDLSLDIKD-KTDLYQCLDSFHKKE--KLH 331

Query: 1003 DDNARVRRS---------VAVEELPTILQIQIQR 1027
            D N    R            + +LP +L +Q++R
Sbjct: 332  DFNYHCSRCNTSLDPIKQFTINKLPPMLVLQLKR 365

>KAFR0B04920 Chr2 complement(1025332..1025799) [468 bp, 155 aa] {ON}
           Anc_2.357 YMR158W
          Length = 155

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 223 EEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNTLFKVFKNPLSRQDSDDELKTI 282
           +E+ E TPD+I  R L +  KY    REN P     LN    + K  L  Q S+DELK +
Sbjct: 58  KEYVEVTPDNISTRRLWVGLKY----RENRP----ILNKCQLISKPSLRIQLSNDELKKV 109

Query: 283 SAENKVLNSQ-LDPNWLV 299
            +   V N + L P  L+
Sbjct: 110 CSGKVVRNIKPLQPGELI 127

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 1164 TNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            T+  Y L  V  H G  + GHY   ++   NSG W K+ND  ++ V   +V 
Sbjct: 392  TSIVYRLSGVVSHSGTVNEGHYTAVLQ--LNSGEWFKFNDSMISVVSAEDVL 441

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTA 731
           GL N GNTCY NS+LQ  + +  LR  +  Y   A
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKYPTRA 134

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L  +  H+G  + GHY    K     G W K+ND  VT V E +V 
Sbjct: 394  YELIGLISHQGSVNQGHYTSICKIP--GGQWFKFNDSMVTAVAEIDVL 439

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722
           TGL N  NTCY+NS++Q  F+ +  RD
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRD 322

>KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON}
            Anc_8.8 YFL046W
          Length = 212

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 68/134 (50%), Gaps = 16/134 (11%)

Query: 1023 IQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQ 1082
            + + +    RE+L+     + + F +    D+ ++S   E    + E  ++H  LE +K 
Sbjct: 72   VHVSKDLAKRERLIQLTYQQRVDFAK--LKDQLLSSDRKEFYNLQNEYERVHNDLEKMKT 129

Query: 1083 RRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKEL 1142
            + K+ + K++AG  L  SL++ +I  ES+       K  ++    IK++DS    IDKE+
Sbjct: 130  KLKEDIIKSNAGFKLDLSLEKGRIKDEST-------KFDLQ----IKEIDS---RIDKEV 175

Query: 1143 SNLDDKIKDMENSI 1156
            +N+  +I  ++  +
Sbjct: 176  TNMKMQIDSVKTQV 189

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDL 734
           G  N GNTCY NS+LQ  + +  LR ++  Y    + L
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEYPARPASL 181

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVNK 756
           GL N+GN+CYLN ++Q       L     NY   + +  +N+N        ++G + V  
Sbjct: 748 GLQNMGNSCYLNCIIQCLLGTHELTKIFLNY---SFERYINLNS-------KLGSKGVLA 797

Query: 757 PEVERSVQFVYQLRDLFNDMAHSKER 782
             + + +  +Y    L N+   +K++
Sbjct: 798 KNLSKLIHLMYNHSTLKNNGDKTKKK 823

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%)

Query: 683 IIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRD 722
           I D+  L S    TGL N  NTCY+NS++Q  F  +  RD
Sbjct: 290 IEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRD 329

>Suva_6.7 Chr6 (16281..16904) [624 bp, 207 aa] {ON} YFL046W (REAL)
          Length = 207

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 75/156 (48%), Gaps = 16/156 (10%)

Query: 993  YFRDDLLALG---DDNARVRRSVAVEELPTILQIQIQRVYYD---REKLMPFKSTEPLPF 1046
            +F+D L+A G   +D A    +  VE +   ++  +  V  D   REKL      + + F
Sbjct: 35   HFKDLLIAKGKFQEDQA----TTIVEIMTEAIRGGVYHVSQDLAKREKLTQLSYQQRVDF 90

Query: 1047 GEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKI 1106
             +    D+ +++  SE    + E   +   LE ++ + ++ ++K +AG  L  SL++ +I
Sbjct: 91   AK--LRDQLLSADRSEFHNIQNEYESVKNDLEKLRNKLREEITKTNAGFKLDLSLEKGRI 148

Query: 1107 FLESS----VLAESEGKIRIEKRNLIKQLDSFSLEI 1138
              ESS     + E + KI  E  N+  Q+DS   ++
Sbjct: 149  REESSHHDLKIKEIDTKIEQEVTNMKMQIDSVKTQV 184

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 694 WPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNY 727
           + TGL N GN CY NS++Q   +I    DYI  +
Sbjct: 70  YTTGLVNKGNYCYANSVIQALSSIDYFSDYINKF 103

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
            [1476 nt, 492 aa]
          Length = 491

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 1056 MASTESELLAKKQESLQLHETLEAIKQ----RRKKILSKNDAGLTLKDSLKE-------- 1103
            + ST  +LLA KQ+ +   ETLEA            L K   GL + DSL          
Sbjct: 294  LQSTVEDLLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSM 353

Query: 1104 TKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKEL 1142
              +F ES  L+ S+ + +I +R +I QL S S +  K L
Sbjct: 354  VIVFSESCKLSVSKNEEKITQRIVINQLQSGSKKSSKAL 392

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
            (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 9/51 (17%)

Query: 1166 FGYNLFAVFIHRGEASYGHYWVYIKDRKNSG-------IWRKYN--DESVT 1207
            F YNL+AV  H G    GHY  Y+     +G        WRK    DE +T
Sbjct: 359  FHYNLYAVACHFGTLYGGHYTAYVNKEDKNGWCYFDDTCWRKAKSEDECIT 409

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLL 735
           GL N+GN+CYLNS+LQ        R  ++   D   D+L
Sbjct: 310 GLQNLGNSCYLNSVLQVLLNGDLSRWSLEGLGDFPGDVL 348

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 672 SKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPL 720
           S LI        +  N +   ++  GL N+GN+CY+N ++Q  F  + L
Sbjct: 501 STLIRKNSPEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTEL 549

>TBLA0I00610 Chr9 complement(106947..109685) [2739 bp, 912 aa] {ON}
           Anc_2.521 YKR009C
          Length = 912

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 3/124 (2%)

Query: 147 GYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVIDSATY-VSS 205
           GY   +TV +   L R++   G+   H++  L P     L  +   +   I ++ + +++
Sbjct: 187 GYKYNITVNSIAPLARSRMTEGVIPPHILQQLGPEKIAPLVLYLTHESTKITNSIFELAA 246

Query: 206 GTNRLVRIEILKPEFTAEEWSEFTPDSIRKRYLSICEKYPDLNRENV--PNQAECLNTLF 263
           G    +R E    +        FTP+++  R+ S+ +   D   + V  PNQ    N L 
Sbjct: 247 GYFGQIRWERSSGQIFNPNSETFTPEAVLHRWSSVVDFKHDKPFKGVEHPNQLADYNKLI 306

Query: 264 KVFK 267
              K
Sbjct: 307 TAAK 310

>TBLA0C00530 Chr3 (97938..99389) [1452 bp, 483 aa] {ON} Anc_8.97
           YFR005C
          Length = 483

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 49/125 (39%), Gaps = 27/125 (21%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLL--NMNQSGAMTKRRIGGRAV 754
            LN+  +T Y+ +++  +  I+P+RDY    +D   D+L   N+     +  R+I    +
Sbjct: 151 NLNSTSDTSYITTIVLAFAHITPIRDYFLLKKDDVGDILKSPNLENKLGLLIRKIWSPQL 210

Query: 755 NKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQVPFRD 814
            KP                          ++P+  + YL+    + N    S   VP ++
Sbjct: 211 AKPH-------------------------ISPNELIDYLNIHQKSNNESTPSQQTVPLKN 245

Query: 815 TTILL 819
            T  L
Sbjct: 246 PTTFL 250

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTED--NTATP 1225
            Y+L  V  H G +S G ++      K +  W + +D ++TEV +  V    ED  ++ T 
Sbjct: 728  YSLSGVIYHHGLSSDGGHYTADVYHKETDKWYRIDDINITEVQKDSVLKGGEDGVDSRTA 787

Query: 1226 YFLVYIK 1232
            Y L+Y K
Sbjct: 788  YILMYQK 794

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
            YDR069C
          Length = 986

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 1121 RIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEA 1180
            R+ K N++ Q   F+L++    +N  D    +  S      Q   F Y L+ V  H G  
Sbjct: 876  RLNKNNILVQY-PFTLDLTTFWANDFDGKLPLNVSELPTRGQKPPFNYKLYGVACHFGSL 934

Query: 1181 SYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVY 1230
              GHY  Y+     +G W  ++D S   +  S      E  T++ Y L Y
Sbjct: 935  YGGHYTAYVDKGIKNG-WYYFDDTSCRPIKNS-----MEPITSSAYVLFY 978

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 688 YLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDL 734
           Y    N   G  N GNTCY NS+LQ  + +  LR  +  + +  S L
Sbjct: 135 YGDGSNKVFGYENFGNTCYCNSVLQVIYNLPELRVNLLEFPERPSSL 181

>SAKL0B00638g Chr2 (61811..62449) [639 bp, 212 aa] {ON} highly similar
            to uniprot|P43557 Saccharomyces cerevisiae YFL046W FMP32
            The authentic non-tagged protein was localized to the
            mitochondria
          Length = 212

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 83/183 (45%), Gaps = 26/183 (14%)

Query: 983  PKDIYDALDLY------FRDDLLALGDDNARVRRSVAVEELPTILQIQIQRVYYD---RE 1033
            P+ +YD   ++      FR  L+  G+  ++   ++ V+ +   L+  +  V  D   RE
Sbjct: 24   PRYLYDFETIHIKNTNKFRQQLVEKGEFTSQQANAI-VDIMADALRGGVAHVSQDLASRE 82

Query: 1034 KLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDA 1093
            KL      + + F +    D+ + +  SE  + + E  ++   LE ++ + ++ ++K +A
Sbjct: 83   KLTKLMYQQRVDFAK--LRDQLLTADRSEFHSIRNEHERIRNDLEKLRTKLREEVTKANA 140

Query: 1094 GLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDME 1153
            G  L  SL+              +G+IR E  +   Q+      ID+E+SN+  +I  ++
Sbjct: 141  GFKLDISLE--------------KGRIREESSHHDMQIKEIDTRIDQEVSNMKMQIDSVK 186

Query: 1154 NSI 1156
              +
Sbjct: 187  TQV 189

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPLRDYI 724
           G  N GNTCY NS+LQ  + ++ LR  I
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNI 544

>Suva_13.443 Chr13 complement(763923..768179) [4257 bp, 1418 aa] {ON}
            YMR259C (REAL)
          Length = 1418

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 8/100 (8%)

Query: 1055 YMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTL--------KDSLKETKI 1106
            +  S  SE L K Q  LQ+ + L   K    KILS+ +  L+L        KD+ +ETK+
Sbjct: 1110 WTTSRSSEFLEKLQMLLQVDDLLPMAKALVVKILSRKEGALSLSTSTNLIEKDNSEETKL 1169

Query: 1107 FLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLD 1146
               SS+ A+   K   +  +L+++  S S   D  L++L+
Sbjct: 1170 SAISSLSAQLSSKTFNQIWSLMQEFFSDSCSKDFRLASLN 1209

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVF 1215
            Y L AV  H G  + GHY    K     G W ++ND  +  + E E  
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCKIP--GGQWFRFNDSMIVSISEEEAL 439

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 697 GLNNIGNTCYLNSLLQYYF 715
           GL N+GN+CYLNS+LQ ++
Sbjct: 327 GLINLGNSCYLNSILQCFY 345

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 1121 RIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFG------YNLFAVF 1174
            ++ ++ LI      +  ++   +N+DD  +  +   + K +   N+G      Y L AV 
Sbjct: 668  KLCRKALILNSGDVNRSVEWVFNNMDDDGELPKEEPTTKNNNKDNYGNLNHVPYKLTAVV 727

Query: 1175 IHRGEASY-GHYWVYIKDRKNSGI-WRKYNDESV 1206
             H+G++++ GHY  +I+   +  + W  YNDE +
Sbjct: 728  CHKGQSAHSGHYVAFIRKIVDGKLSWVLYNDEKI 761

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 8/63 (12%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y L  +  H G  + GHY    K  +  G W K+ND  VT + E  +           Y 
Sbjct: 406  YELIGIICHTGTVNEGHYTAICKIPE--GQWIKFNDSMVTIISEETML------KEQAYL 457

Query: 1228 LVY 1230
            L+Y
Sbjct: 458  LIY 460

>TBLA0D01500 Chr4 (374387..375796) [1410 bp, 469 aa] {ON} Anc_5.550
           YML017W
          Length = 469

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 678 FLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLR-DYIQNYEDTA 731
           FL    +D N ++  N P  LN+I NT  L+ L Q+    + +R  Y  NYED  
Sbjct: 6   FLGDPTLDVNGISDNNMPIDLNSITNTTSLDLLKQHAPNSNAVRHSYHNNYEDMG 60

>YFL046W Chr6 (42815..43438) [624 bp, 207 aa] {ON}  FMP32Putative
            protein of unknown function; the authentic, non-tagged
            protein is detected in highly purified mitochondria in
            high-throughput studies
          Length = 207

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 74/156 (47%), Gaps = 16/156 (10%)

Query: 993  YFRDDLLALG---DDNARVRRSVAVEELPTILQIQIQRVYYD---REKLMPFKSTEPLPF 1046
            +F+D L+  G   +D A    +  VE +   ++  +  V  D   REKL      + + F
Sbjct: 35   HFKDLLIENGKFQEDQA----TTIVEIMTDAIRGGVNHVSQDLAKREKLTQLSYQQRVDF 90

Query: 1047 GEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKI 1106
             +    D+ +++  SE    + E   +   LE ++ + ++ ++K +AG  L  SL++ +I
Sbjct: 91   AK--LRDQLLSADRSEFHNIQNEYESVKNDLEKLRNKLREEITKTNAGFKLDLSLEKGRI 148

Query: 1107 FLESS----VLAESEGKIRIEKRNLIKQLDSFSLEI 1138
              ESS     + E + KI  E  N+  Q+DS   ++
Sbjct: 149  REESSHHDLQIKEIDTKIEQEVTNMKMQIDSVKTQV 184

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 8/63 (12%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227
            Y L  V  H G  + GHY    K   N   W K+ND  +T V    V           Y 
Sbjct: 403  YELIGVICHTGTVNEGHYICSCKLANNQ--WVKFNDSMITIVDNETVL------KEQAYL 454

Query: 1228 LVY 1230
            L+Y
Sbjct: 455  LIY 457

>SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40151 Saccharomyces cerevisiae
           YNL218W MGS1 Protein with DNA-dependent ATPase and ssDNA
           annealing activities involved in maintenance of genome
           interacts functionally with DNA polymerase delta homolog
           of human Werner helicase interacting protein (WHIP)
          Length = 550

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 486 SETDPKQIPDEMLLSCYKEECKYGNTRQHADLRN 519
            E D +  PDE+L  C KEE K+ N R   D+R+
Sbjct: 508 GEVDQEYFPDEVLEKCNKEELKFMNGRHLGDVRD 541

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 690 TSGNWPTGLNNIGNTCYLNSLLQ 712
            S N+  GL N+GN+CYLNS++Q
Sbjct: 317 ASKNYGCGLINLGNSCYLNSVIQ 339

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 697 GLNNIGNTCYLNSLLQYYFTISPL-RDYIQNYEDTASDLLLNMNQSGAMTK 746
           GL NIGN+CYLN ++Q       L + ++ N+ +   +L   +   G + K
Sbjct: 560 GLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAK 610

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
            similarities with uniprot|P32571 Saccharomyces cerevisiae
            YDR069C DOA4 Ubiquitin hydrolase required for recycling
            ubiquitin from proteasome-bound ubiquitinated
            intermediates acts at the late endosome/prevacuolar
            compartment to recover ubiquitin from ubiquitinated
            membrane proteins en route to the vacuole
          Length = 877

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 1162 QFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYND 1203
            Q   F Y L+AV  H G    GHY  Y+    N G W  ++D
Sbjct: 809  QVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLNKG-WYYFDD 849

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
            complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 27/69 (39%), Gaps = 6/69 (8%)

Query: 1162 QFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDN 1221
            Q   F Y L AV  H G    GHY  Y+    N G W  ++D S   +        TE  
Sbjct: 814  QVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRG-WHYFDDTSYRPIKNE-----TECI 867

Query: 1222 TATPYFLVY 1230
            T   Y L Y
Sbjct: 868  TPNAYVLFY 876

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
            YBR058C (REAL)
          Length = 782

 Score = 32.3 bits (72), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 18/102 (17%)

Query: 1142 LSNLDD--KIKDMENSISHKFDQFTNFGYN------LFAVFIHRGEASY-GHYWVYIKDR 1192
             +N+DD  ++ D E     +  +  + GY+      L AV  H+G +++ GHY V+I+ +
Sbjct: 687  FNNMDDDGRLPDPEGPTGRQQRKQKDLGYSTSRPYALTAVVCHKGNSAHSGHYVVFIR-K 745

Query: 1193 KNSGIWRK--YNDESVTEVPESEVFDFTEDNTATPYFLVYIK 1232
              +G W+   YNDE +       V +  ED     Y   Y +
Sbjct: 746  LVAGEWKWVLYNDEKLV------VAESIEDMKTNGYIYFYTR 781

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 32.3 bits (72), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTED--NTATP 1225
            Y L  V  H G +S G ++      ++   W + +D +VTE+ + EV    E+  ++ T 
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADVLHQDEEKWYRIDDTTVTEINKEEVVTGGEEGSHSRTA 826

Query: 1226 YFLVY 1230
            Y L+Y
Sbjct: 827  YILIY 831

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,560,147
Number of extensions: 6226343
Number of successful extensions: 21537
Number of sequences better than 10.0: 367
Number of HSP's gapped: 22050
Number of HSP's successfully gapped: 475
Length of query: 1246
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1125
Effective length of database: 39,606,813
Effective search space: 44557664625
Effective search space used: 44557664625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)