Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_45125.441ON52752726940.0
ACL166W5.441ON49048914520.0
KLLA0E02333g5.441ON48047111201e-148
NDAI0B057105.441ON56347011101e-146
NCAS0F034205.441ON52547510781e-141
ZYRO0F10186g5.441ON51949510711e-140
SAKL0G02684g5.441ON53949010711e-140
TPHA0E017205.441ON53746810621e-139
Kpol_1062.255.441ON53346910551e-138
TDEL0D026005.441ON52348810491e-137
TBLA0A027905.441ON54748310381e-135
KAFR0E038105.441ON4904279831e-127
CAGL0A02904g5.441ON5014599781e-127
KNAG0C048705.441ON4584299681e-126
Suva_2.5435.441ON5115109151e-117
Kwal_55.214025.441ON5164549091e-116
KLTH0F15906g5.441ON5154578911e-113
YDR371W (CTS2)5.441ON5115038811e-112
Skud_4.6405.441ON5114938691e-110
Smik_4.6375.441ON5114968681e-110
KNAG0B043505.400ON96647761.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4512
         (527 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...  1042   0.0  
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   563   0.0  
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   436   e-148
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   432   e-146
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   419   e-141
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   417   e-140
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   417   e-140
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   413   e-139
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   410   e-138
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   408   e-137
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   404   e-135
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   383   e-127
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   381   e-127
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   377   e-126
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   357   e-117
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   354   e-116
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   347   e-113
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   343   e-112
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   339   e-110
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   338   e-110
KNAG0B04350 Chr2 (828924..831824) [2901 bp, 966 aa] {ON} Anc_5.4...    34   1.4  

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/527 (95%), Positives = 503/527 (95%)

Query: 1   MRRFSITSYSXXXXXXXXXXXXEMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQH 60
           MRRFSITSYS            EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQH
Sbjct: 1   MRRFSITSYSIWILVLLVAIILEMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQH 60

Query: 61  GKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPS 120
           GKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPS
Sbjct: 61  GKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPS 120

Query: 121 HAPGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTI 180
           HAPGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTI
Sbjct: 121 HAPGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTI 180

Query: 181 DAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELS 240
           DAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELS
Sbjct: 181 DAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELS 240

Query: 241 VATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRR 300
           VATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRR
Sbjct: 241 VATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRR 300

Query: 301 FEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDDDLLNKKYX 360
           FEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDDDLLNKKY 
Sbjct: 301 FEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDDDLLNKKYS 360

Query: 361 XXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYV 420
                      IWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYV
Sbjct: 361 GVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYV 420

Query: 421 KQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRIPTIFKDPRAIAYYLKHRQKGFL 480
           KQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRIPTIFKDPRAIAYYLKHRQKGFL
Sbjct: 421 KQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRIPTIFKDPRAIAYYLKHRQKGFL 480

Query: 481 YSLFSQHLQKINETSVDKSAGNYKNETLLPKDASNELDEGEPTPAAT 527
           YSLFSQHLQKINETSVDKSAGNYKNETLLPKDASNELDEGEPTPAAT
Sbjct: 481 YSLFSQHLQKINETSVDKSAGNYKNETLLPKDASNELDEGEPTPAAT 527

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/489 (56%), Positives = 342/489 (69%), Gaps = 5/489 (1%)

Query: 1   MRRFSITSYSXXXXXXXXXXXXEMTFIPKLMIEKFKKPRSDIERTALSTITRPV-DRNLQ 59
           MRRF    Y+            EMTF+PKL+ EK  + R   +   +   TRPV D    
Sbjct: 1   MRRFPTPVYTIWILILVAAIVLEMTFLPKLIKEKLSR-RIRPKPLEVHEETRPVPDAPYP 59

Query: 60  HGKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMP 119
            G+Y VGVYY+SWSPY+PRLH+P +IDF+RVT+V YAFFVVD KTGK+   D WSD +MP
Sbjct: 60  DGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMP 119

Query: 120 SHAPGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNST 179
            +  G+P+G+ G IGELNYLK +  T+F+L MAVGGWSNRE F KIVR EEK  NF++S 
Sbjct: 120 MNLTGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSA 179

Query: 180 IDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFEL 239
           IDAMFEYGFDGIDLDWEFPKDDGYEP MYLEMCSRLR KMD+LED IWG   T  P+F L
Sbjct: 180 IDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHL 239

Query: 240 SVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKN--NDELK 297
           S+A PAF QTL I P+ EMNK++S+WNMMTYD+HG+WS+RTGYHSNLY+   +     L 
Sbjct: 240 SMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLD 299

Query: 298 KRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDDDLLNK 357
           KRR+E M ID+ + LNA DAI +M E FKV  +K+ LGM AYGRGFTNV+  D + L+ +
Sbjct: 300 KRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRG-DGEQLIGQ 358

Query: 358 KYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKS 417
           KY            +WLYNQLPLA+  EKFD+ WVSAY +D N KT V YDN+ SM++K 
Sbjct: 359 KYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKK 418

Query: 418 DYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRIPTIFKDPRAIAYYLKHRQK 477
           +YVK K L+G F WESCGD   D  RNLV AF++ +   R  T +KD + I YYL+ R +
Sbjct: 419 EYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKATAYKDSKLIQYYLRTRPE 478

Query: 478 GFLYSLFSQ 486
           GFL  ++  
Sbjct: 479 GFLVPMYRH 487

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  436 bits (1120), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 227/471 (48%), Positives = 309/471 (65%), Gaps = 24/471 (5%)

Query: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHG--KYAVGVYYTSWSPYEPRLH 80
           EM  +P L ++K KK  S   R    T   P  R    G   ++V  YY++WSPY  R H
Sbjct: 26  EMCIVPWLFLDKIKKGGSAGRRPP--TEIDPDTRVPSEGPDGFSVATYYSNWSPYNARNH 83

Query: 81  FPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVTGMIGELNYLK 140
            P DI   ++T+V YAFFVVD K+G V+ +DSWSD E+P     +  GV G I EL  +K
Sbjct: 84  KPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELP-----LSVGVKGCIKELQKIK 138

Query: 141 LQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKD 200
           L+    F+  + +GGWSNREA+ KI +SE+K+K F+ + +D MF YGFDGIDLDWEFP++
Sbjct: 139 LESKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEE 198

Query: 201 DGYEPGMYLEMCSRLRSKMDKLEDEIWG--ANNTDYPKFELSVATPAFSQTLKILPIIEM 258
           D  EP +YLEM   +R  MD+LE +I+G  A   D+P F+LSVATPAF++ L ILPI EM
Sbjct: 199 DSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEM 258

Query: 259 NKFVSIWNMMTYDFHGSWSKRTGYHSNLY-DGNKNNDELKKRRFEGMVIDDNEGLNADDA 317
           +K+V IWNMM YDFHG WS  TGYHSNLY  G+ +   L  R         N  L++D A
Sbjct: 259 SKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLSNRI-------SNSSLSSDTA 311

Query: 318 IKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDDDLLNKKYXXXXXXXXXXXXIWLYNQ 377
           +K+M +   + ++++ LGM AYGRGFTNV+T +DD+ L KKY            IWLYNQ
Sbjct: 312 VKLMTDRHNISSRRIALGMAAYGRGFTNVET-NDDNYLGKKYHGVGGGSEGEPGIWLYNQ 370

Query: 378 LPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDT 437
           LP+  + E+FD   VSAYCFD   +TFVGYDN+QSM++K  Y+K+K+L+GGF+WESCGD+
Sbjct: 371 LPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS 430

Query: 438 HNDPKRNLVRAFSQE--LSEMRIPTIFKDPRAIAYYLKHRQKGFLYSLFSQ 486
             DP+++LV AFS+E  LSE  + ++FK  +   ++L+   K ++ SLF +
Sbjct: 431 -KDPRKSLVNAFSKEIGLSEGFV-SLFKSDKVKQFHLQKYPKDYISSLFQK 479

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  432 bits (1110), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 222/470 (47%), Positives = 298/470 (63%), Gaps = 50/470 (10%)

Query: 63  YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA 122
           +  GVYY+SWSPY+PR HFPHDID  ++T+V Y+FF+V+  TG V  +D WSDL+M  + 
Sbjct: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152

Query: 123 P-----------------------------GIPQGVTGMIGELNYLKLQRNTNFRLFMAV 153
           P                                Q   G +GEL YLK  +  NF+L M++
Sbjct: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK--KFQNFKLIMSI 210

Query: 154 GGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCS 213
           GGWSNRE FP +VR + KL  F+ S+++ MF+YGFDGIDLDWEFP+DDG+EPG YLE+  
Sbjct: 211 GGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQ 270

Query: 214 RLRSKMDKLEDEIWGAN-------NTDY--PKFELSVATPAFSQTLKILPIIEMNKFVSI 264
           RLR +MDKLE +I+  +       + DY  PKFELSVATPAF + L ILPI EMNK++  
Sbjct: 271 RLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPIKEMNKYIDY 330

Query: 265 WNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVEN 324
           WNMMTYD++G WS+ TGYH NLY+G  N     + + E      N+GLNA+DAI  M+ N
Sbjct: 331 WNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEH--TSSNKGLNANDAINYMLYN 388

Query: 325 FKVHAKKVRLGMPAYGRGFTNVQTKDDDDL-LNKKYXXXXXXXXXXXXIWLYNQLPLANT 383
             V ++K+ LG+ AYGRGFT V+   +D+L +NKK+            +WLYNQLP+ N+
Sbjct: 389 NNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMWLYNQLPIKNS 448

Query: 384 AEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKR 443
            E FD  +VSA+C+D   KTFVGYDN+ +M+VK+ YV+ +HL+GGF+WESCGD H  P+R
Sbjct: 449 KEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPER 508

Query: 444 NLVRAFSQELSEMRI------PTIFKDPRAIAYYLKH-RQKGFLYSLFSQ 486
           +L+ AF+ +L    +        I++ P  I YYL +    GFL   F Q
Sbjct: 509 SLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQ 558

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  419 bits (1078), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 216/475 (45%), Positives = 306/475 (64%), Gaps = 42/475 (8%)

Query: 44  RTALSTITRPVDRNLQHGKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPK 103
           R  +  +    + N + G Y  G+YY+SWSPY+PR HFPHDID  RV+++ YAFF+VDPK
Sbjct: 56  RQEIDYLMNQTNSNGEKG-YLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPK 114

Query: 104 TGKVQPTDSWSDLEMPSHAP-----------------------GIPQGVTGMIGELNYLK 140
           TGK+ P+D WSDL+M  + P                        +P    G IGEL YLK
Sbjct: 115 TGKLNPSDEWSDLQMDLYKPLSVKLHNLNLADNEKPVQLRDKRKLP---LGCIGELFYLK 171

Query: 141 ----LQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWE 196
               +   ++ ++ +++GGWSNR+ FP +VR   K +NF++S ++ MF YGFDGIDLDWE
Sbjct: 172 HSGIIPGGSSTKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWE 231

Query: 197 FPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELSVATPAFSQTLKILPII 256
           FPKDDG EP  YLEM S+LR KMD LE EI+G    D+PKF+LSVATPAF   L ILPII
Sbjct: 232 FPKDDGLEPNKYLEMISKLRRKMDDLELEIFGETK-DHPKFQLSVATPAFIYKLSILPII 290

Query: 257 EMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADD 316
           +M+++V  WNMMTYD++GSWS+ TGYH NL++G+ +     +  ++      N GLNA++
Sbjct: 291 QMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNGDGSE---FRAGYKHEHTAHNNGLNANE 347

Query: 317 AIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDD-DDLLNKKYXXXXXXXXXXX-XIWL 374
           AI  M+++  V + KV LGM AYGR F +V+++   D L+N+K+             +WL
Sbjct: 348 AIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWL 407

Query: 375 YNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESC 434
           YNQLPL  T E +D  + +A+C+DK  +TF+GYDN+ S+++K+ YV+ + L GGF+WESC
Sbjct: 408 YNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESC 467

Query: 435 GDTHNDPKRNLVRAFSQELSEMRIPT----IFKDPRAIAYYL-KHRQKGFLYSLF 484
           GD H + +R+L+  FS E++E+R  +    IF+    IAYYL ++   GFL  + 
Sbjct: 468 GDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLSGIL 522

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  417 bits (1071), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 215/495 (43%), Positives = 310/495 (62%), Gaps = 49/495 (9%)

Query: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHGK----------YAVGVYYTSW 72
           EM F  K+        +S  E   L  +    D +LQ  K          Y  G+YY+ W
Sbjct: 25  EMCFYRKIF-------KSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDW 77

Query: 73  SPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAP--------- 123
           SPY PR HFPHDIDF +V+++ YAFF++D  TG+++ +D WSD +M  + P         
Sbjct: 78  SPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQ 137

Query: 124 ------GIPQGVT--GMIGELNYLK----LQRNT--NFRLFMAVGGWSNREAFPKIVRSE 169
                     GV   G +GEL YL+    L R+   +F++ MAVGGWSNR+ +PK+VR  
Sbjct: 138 LKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDP 197

Query: 170 EKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGA 229
            +++NF+NS ++ MF+YGFDGIDLDWEFP++DG+EP MYLE+  ++R K D+LE+ I+ A
Sbjct: 198 RRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIF-A 256

Query: 230 NNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDG 289
              ++PKF+LS+ATPAF   L +LPI E+++++ +WNMMTYD+HG WS  TGYH NLYDG
Sbjct: 257 GEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDG 316

Query: 290 NKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTK 349
                     +++     D+EGL+A+ AI  M+  F V ++K+ LGM AYGRGFT+V+  
Sbjct: 317 PVK----VHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS 372

Query: 350 DDDD-LLNKKYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYD 408
            +D   ++K +            +WLYNQLP+  + E++D  +VS +CFD   KTFVGYD
Sbjct: 373 SNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYD 432

Query: 409 NIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEM--RIPTIFKDPR 466
           N++S++VK+DYVK+  L GGF+WESCGD H DP+R+L+ AF+  +  +     +++  P 
Sbjct: 433 NVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPE 492

Query: 467 AIAYYL-KHRQKGFL 480
           A+ YYL K  Q  FL
Sbjct: 493 ALRYYLEKFGQDEFL 507

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  417 bits (1071), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 218/490 (44%), Positives = 297/490 (60%), Gaps = 47/490 (9%)

Query: 33  EKFKKPRSDIERT----ALSTITRPVDRNLQHGKYAVGVYYTSWSPYEPRLHFPHDIDFK 88
           +KFK+  SD+        L     P   + Q   Y  GVYYT+WSPY PR HFPHD++F 
Sbjct: 57  QKFKQIYSDMNSNDNNQNLQEEVGPASNDSQ--SYISGVYYTNWSPYAPRNHFPHDMNFH 114

Query: 89  RVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVT------------------ 130
           R+TNV Y+FFVVDPK+G V+ +D WSD +M  +    PQ                     
Sbjct: 115 RITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLSSSSSSTFQSHKKEM 174

Query: 131 ---GMIGELNYLKLQR----------NTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVN 177
              G IGEL YLK             + NF++ M+VGGWSNR+AFP IVR + K   F+ 
Sbjct: 175 LPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIR 234

Query: 178 STIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKF 237
           + ++ MF+YGFDG+D+DWEFP++DG EP MYL M  RLR  +D LE +I+  +      F
Sbjct: 235 TCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERDIF-QDEHHSEHF 293

Query: 238 ELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELK 297
            L+VA PAF + L++LP+ +M+ +V  WN+M YD+HG WS+ TGYHSNLY  + N+  + 
Sbjct: 294 FLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNH--VH 351

Query: 298 KRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQT-KDDDDLLN 356
           +R F     D+   LNAD A+K +++NF ++++KV LGM AYGRGFT V+T  +    + 
Sbjct: 352 RRHFR----DEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIG 407

Query: 357 KKYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVK 416
           K Y            +WLYNQLPL  T E FD R VSAY FD   KTFVGYDN+ SM  K
Sbjct: 408 KPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCK 467

Query: 417 SDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEM--RIPTIFKDPRAIAYYLKH 474
           + YVK  +L+GGF+WESCGD H D +++L+ AF+ +L  +  + P+I+     I YYLK+
Sbjct: 468 AQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKN 527

Query: 475 RQKGFLYSLF 484
             +GFL  +F
Sbjct: 528 YPQGFLSRVF 537

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  413 bits (1062), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 209/468 (44%), Positives = 301/468 (64%), Gaps = 36/468 (7%)

Query: 59  QHGKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEM 118
           ++  Y++GVYY++WSPY PRL FPHDID  RV++V Y+F +VD   G ++ +D+WSD ++
Sbjct: 74  ENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQI 133

Query: 119 PSHAP-------------GIPQGV------TGMIGELNYLKLQR-------NTNFRLFMA 152
             + P              +P  +       G IGE  YL+  R       +T+F++FM+
Sbjct: 134 DMYKPLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMS 193

Query: 153 VGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMC 212
           VGGWSNREAFPK+VR  +K+  F+NS ID MF YGFDGIDLDWEFP+DDG+EP MYL++ 
Sbjct: 194 VGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDII 253

Query: 213 SRLRSKMDKLEDEIWG---ANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMT 269
            RL+ KM +LE  I+    ++NT YP FELS+A PAF + L+ILP+ +M+KFV  WNMMT
Sbjct: 254 KRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMT 313

Query: 270 YDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHA 329
           YD+ G WS  TGYHSNL+     +  + KR       + NE L  D+A+K M +N K+ +
Sbjct: 314 YDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQS----NSNETLCGDNAVKYMKDNLKISS 369

Query: 330 KKVRLGMPAYGRGFTNV-QTKDDDDLLNKKYXXXXXXXXXXXXIWLYNQLPLANTAEKFD 388
           +K+ LGM AYGRGF+ V ++K +  L  KK+            +WLYN+LP+  + E+FD
Sbjct: 370 RKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFD 429

Query: 389 DRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRA 448
              VSAYC+D   K FV YDN QSM +KS YV+  +L GGF WE+CG+  N+PK +L+ +
Sbjct: 430 KESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINS 489

Query: 449 FSQELSEM-RIPTIFKDPRAIAYYL-KHRQKGFLYSLFSQHLQKINET 494
           F+ +++ + +  ++F + + + YYL K+ ++GFL       L ++NET
Sbjct: 490 FTFDMNNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMNET 537

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  410 bits (1055), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/469 (45%), Positives = 294/469 (62%), Gaps = 44/469 (9%)

Query: 63  YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA 122
           Y VGVYY++WSPY PRLH PHD+DF R+T+V YAFFVVD KTG +  +D+WSD EM  + 
Sbjct: 64  YDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYK 123

Query: 123 P--------------------GIPQGVTGMIGELNYLKLQR------NTNFRLFMAVGGW 156
           P                    G+P G    IGEL YL+  +      +  F+L M+VGGW
Sbjct: 124 PLAMKLKKLQLDHFFNPKFKNGLPMGC---IGELFYLRHSQLFDSNNSRKFKLIMSVGGW 180

Query: 157 SNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLR 216
           SNREAFP+++R  +KL  FVNS I+ MF YGFDGI+LDWEFPKDD  EP MYLE+  +L+
Sbjct: 181 SNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLK 240

Query: 217 SKMDKLEDEIWG----ANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDF 272
            K ++LE +I+      N++  PKF LS+A PAF + L IL + EM+ +V +WNMMTYD+
Sbjct: 241 WKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDY 300

Query: 273 HGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDN-------EGLNADDAIKIMVENF 325
           HG WS++TGYHSNLY   +  +E           +D+         LN D AI  +++ +
Sbjct: 301 HGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKY 360

Query: 326 KVHAKKVRLGMPAYGRGFTNVQTKDDDD-LLNKKYXXXXXXXXXXXXIWLYNQLPLANTA 384
            ++ KK+ LGM AYGRGFT V     D   +NK Y            +WLYNQLP+ N+ 
Sbjct: 361 HINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSL 420

Query: 385 EKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRN 444
           E+FD  +VSA+C+DK  KTFVGYDN  SM+VK+ YVK+ +L GGF+WESCGD H +P+++
Sbjct: 421 EEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKS 480

Query: 445 LVRAFSQELSEM--RIPTIFKDPRAIAYYLKHR-QKGFLYSLFSQHLQK 490
           L+ AF+ E+  +  +  T+F +   + YYLK +   GFL +   + L +
Sbjct: 481 LLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYR 529

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  408 bits (1049), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 210/488 (43%), Positives = 304/488 (62%), Gaps = 46/488 (9%)

Query: 1   MRRFSITSYSXXXXXXXXXXXXEMTFIPKLMIEKFKKPRSDIERTA---LSTITRPVDRN 57
           M+R    S++            EM F  K+     ++   D  ++       +T P    
Sbjct: 1   MQRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNP--GT 58

Query: 58  LQHGKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLE 117
           ++ G+Y  G+YY++WSPY PR+HFPHDID  RV+++ YAFF+VD  TG ++  D WSD+ 
Sbjct: 59  VEPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVG 118

Query: 118 MPSHAPG---------------------IPQGVTGMIGELNYLKLQRNTN---------F 147
           M  + P                      +P G    +GEL Y+   RN N         F
Sbjct: 119 MDLYKPMAIKLNKLNPEVKNDLERQRRILPNGC---LGELFYM---RNANLFPNRNIRDF 172

Query: 148 RLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGM 207
           ++ M VGGWSNRE FPK+VR+ +++  F++S I+ MF+YGFDGIDLDWEFP+DDG+EP M
Sbjct: 173 KVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQM 232

Query: 208 YLEMCSRLRSKMDKLEDEIWGANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNM 267
           YL++  RL+ +M++LED I+G  N ++PKF+LS+ATPAFS+ L ILPI EM+K++ IWNM
Sbjct: 233 YLQLAKRLKERMNELEDAIFGP-NMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNM 291

Query: 268 MTYDFHGSWSKRTGYHSNLYDGN-KNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFK 326
           MTYD+HG WS++TGYH NLY+G+ K+ DE  ++       +  EGL+A  AI+ M+    
Sbjct: 292 MTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQKHIYS--TESVEGLDAHSAIEHMLNVAG 349

Query: 327 VHAKKVRLGMPAYGRGFTNVQTKDDDD-LLNKKYXXXXXXXXXXXXIWLYNQLPLANTAE 385
           V++ K+ LGM AYGRGFTNV  +  D   ++K +            +WLYNQLP+  T E
Sbjct: 350 VNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHE 409

Query: 386 KFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNL 445
            FD  +VS +C+    KTFVGYD+++S+  K+ YV++K+L+GGF+WESCGD H +  R+L
Sbjct: 410 LFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSL 469

Query: 446 VRAFSQEL 453
           + AF+ E+
Sbjct: 470 LNAFTNEI 477

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  404 bits (1038), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/483 (43%), Positives = 293/483 (60%), Gaps = 70/483 (14%)

Query: 63  YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA 122
           Y  GVYY++WSPY PR HFPHDIDF R+++V Y+FF+V+   GKV+  D WSD+EM  + 
Sbjct: 77  YTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYK 136

Query: 123 P---------------GIPQGVT--------GMIGELNYLK---------LQRNTNFRLF 150
           P                 PQ  +        G IGE  YL+          + + NF++ 
Sbjct: 137 PLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMI 196

Query: 151 MAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLE 210
           M +GGWSNR++FPK+ +S +K+ NFV S I+ MFEYGFDGIDLDWEFPK++  EP +YL+
Sbjct: 197 MTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLK 256

Query: 211 MCSRLRSKMDKLEDEIWGANNTDYP-----KFELSVATPAFSQTLKILPIIEMNKFVSIW 265
           +  +LR  M++LE+EI+   N+  P      F+LSVA+PAF + L +LPI EMNK +  W
Sbjct: 257 IMQQLRQGMNELEEEIY--KNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYW 314

Query: 266 NMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENF 325
           NMMTYD++G WS++TGYHSNLYDG+K             V  D E LNAD AIK M+E  
Sbjct: 315 NMMTYDYNGEWSEKTGYHSNLYDGSK-------------VKHDEEVLNADSAIKYMIETQ 361

Query: 326 KVHAKKVRLGMPAYGRGFTNV---------------QTKDDDDLLNKKYXXXXXXXXXXX 370
            V   K+ LG+  YGRG+TNV               +   D+  ++ +Y           
Sbjct: 362 GVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEP 421

Query: 371 XIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFF 430
            +W+YNQLP+  + E+FD ++VSAYC+D    T V YDN++SM VK  YVK K L+GGF 
Sbjct: 422 GMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFM 481

Query: 431 WESCGDTHNDPKRNLVRAFSQELSEMRI--PTIFKDPRAIAYYLKH-RQKGFLYSLFSQH 487
           WESCGD H++PKR+L+ AF+ EL +++    +IF+D +   +YL+    +G+L    ++ 
Sbjct: 482 WESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541

Query: 488 LQK 490
           L K
Sbjct: 542 LNK 544

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  383 bits (983), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 270/427 (63%), Gaps = 16/427 (3%)

Query: 63  YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA 122
           ++ G+YY++WS YEPRLHFPH+I+F  +++V YAFF+VD K GK+   D W+D + P   
Sbjct: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK 117

Query: 123 PGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDA 182
               + V G +GEL  LK++     +  M +GGWSNREA+        K+++F    +  
Sbjct: 118 NN--KLVKGNVGELFDLKMKNRV--KCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKM 173

Query: 183 MFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELSVA 242
           MFEYGFDGIDLDWE+P+DDG EP +YLE+  R++  M+KLE EI+   +     FELSVA
Sbjct: 174 MFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVA 233

Query: 243 TPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFE 302
           TPAF   L+I P+ EM+  +  WNMMTYD++G WS+RTGYHSNLYDG+K +  ++     
Sbjct: 234 TPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRH 293

Query: 303 GMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQT-----KDDDDLLNK 357
           GM   + EGLN D A+K M+ N  +   K+ LGM AYGRGFTNV        +    + +
Sbjct: 294 GM--SEVEGLNGDYAVKYMI-NQGIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGR 350

Query: 358 KYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKS 417
            +            +W Y+QLP+  T E+FD R+VS YCF+    TFVGYD I S+ VK+
Sbjct: 351 TFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKT 410

Query: 418 DYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRI---PTIFKDPRAIAYYLKH 474
            Y+K K + GGF+WESCGDTH +P+R+LV A+ +EL    I    +I+K+   +++Y + 
Sbjct: 411 QYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYKQS 470

Query: 475 -RQKGFL 480
              KGFL
Sbjct: 471 FHGKGFL 477

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 200/459 (43%), Positives = 277/459 (60%), Gaps = 35/459 (7%)

Query: 58  LQHGKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLE 117
           L +  Y  G+YY++WSPYEPRLHFPHDIDF++V+++ YAF ++DP+TG +  +D WSD +
Sbjct: 51  LSNTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQ 110

Query: 118 M-----------------PSHAPGIPQGVTGMIGELNYLKLQ----RNTNFRLFMAVGGW 156
           +                    A    +   G IGELNYL+      +  N +L M+VGGW
Sbjct: 111 LNLAKQCREYMFKRFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGW 170

Query: 157 SNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLR 216
           SNRE+FP +VR E K KNF+NS I+ M  YGFDGIDLDWEFP+DD YEP  YL M   L+
Sbjct: 171 SNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELK 230

Query: 217 SKMDKLEDEIWGANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSW 276
            ++ KLE  I G ++     F+LS+ATPAF   L ILPI +++K++ +WN+MTYD++G W
Sbjct: 231 LQLQKLEANILGDHSN--KTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEW 288

Query: 277 SKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGM 336
           S+RTG H+NLY  N+    L   R      D++ GL+ D AI  MV   K+  +KV LGM
Sbjct: 289 SERTGLHANLY--NEKGKLLHLHRH-----DEDAGLSGDAAINYMVNRCKIDPRKVILGM 341

Query: 337 PAYGRGFTNVQTKDDD--DLLNKKYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSA 394
            AYGRGFTNV  K  +  +    K+            +WLYNQLP+  + EK+D R V A
Sbjct: 342 AAYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGA 401

Query: 395 YCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELS 454
           YC+D    T VGYDN  S+  K++Y+    L G F+WESCGDTH +PKR+L+  + + + 
Sbjct: 402 YCYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIR 461

Query: 455 EMR--IPTIFKDPRAIAYYLK-HRQKGFLYSLFSQHLQK 490
            ++    TI+   +   YYL+ +   GFL       +Q+
Sbjct: 462 NVKNNKETIYSTTKLHDYYLENYDTNGFLTGFIKDIIQE 500

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  377 bits (968), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 190/429 (44%), Positives = 272/429 (63%), Gaps = 27/429 (6%)

Query: 62  KYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSH 121
           KY  GVYY+ WSPYEPR+HFP +ID  ++T++ Y+FF+VD  +  ++  DSWSD+EMP  
Sbjct: 50  KYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPM- 108

Query: 122 APGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTID 181
             G    + G IG LN L+ ++   F+  MAVGGWSN++AFP  +R +  ++    S ++
Sbjct: 109 --GKNTVLKGCIGALNSLRDEK-PGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVE 165

Query: 182 AMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELSV 241
            MF+YGFDGIDLDWE+PKDDG EP +YLE+  ++R  M++LE  IWG       +F LSV
Sbjct: 166 TMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKR---RFHLSV 222

Query: 242 ATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRF 301
           ATPAF   L+  PI EM++++  WNMMTYD++G WS  TG+HSNLYDG     E      
Sbjct: 223 ATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFSE------ 276

Query: 302 EGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKD---DDDLLNKK 358
                     L AD AI+ M     ++++KV LGM  YGRGFTNV+  D      L+N+K
Sbjct: 277 --------HSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSGLINRK 328

Query: 359 YXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSD 418
           +            +WLYNQLP+  T E FD+++ SAYCFD   KT VGYDN+ S   K+ 
Sbjct: 329 FKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQ 388

Query: 419 YVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEM-RIPT-IFKDPRAIAYYLK-HR 475
           YV+  +L+GGF+WESCG+  ++ +++LV  F++++  + R  T +++DP+   +YL+   
Sbjct: 389 YVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFA 448

Query: 476 QKGFLYSLF 484
           + GFL + F
Sbjct: 449 KSGFLAATF 457

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  357 bits (915), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/510 (39%), Positives = 288/510 (56%), Gaps = 70/510 (13%)

Query: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHGK-------YAVGVYYTSWSPY 75
           EM    KL    FK  RS+  R         V   +Q+ K       Y  GVYY++WSPY
Sbjct: 30  EMCLYNKL----FKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPY 85

Query: 76  EPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVT----- 130
           +PR HFPHDI+ ++V++V YAFF +DPKTG +  TDSWSDLEM  + P   +        
Sbjct: 86  KPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDN 145

Query: 131 ------------GMIGELNYLK-LQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVN 177
                       G IGEL YLK       F+  M++GGWS+ E F  IV++E+ L+NFV+
Sbjct: 146 LDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVD 205

Query: 178 STIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKF 237
           S+++ MF+ GFDGID+DWEFP+++  EP  YL++   LR K++ LE +I+G +  D+  F
Sbjct: 206 SSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGSTKDH--F 263

Query: 238 ELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELK 297
           ELS+A PAF   L  LPI E+++++  WNMMTYD++GSWS+ TGYHSNL+   +      
Sbjct: 264 ELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSETE------ 317

Query: 298 KRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDD----- 352
                         L+ + AI  M+  F V+ +K+ LGM AYGR F     KDD      
Sbjct: 318 --------------LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF---HIKDDKFRPFT 360

Query: 353 ---DLLNKKYXXXXX------XXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKT 403
               L+N+++                  IW Y  LP   T E++D ++VSAYCFD+    
Sbjct: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420

Query: 404 FVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQEL--SEMRIPTI 461
           F+GYDN +S++ K+DYV    L GGF+WESCG+ + D  R+L+ AF++ L  +    P++
Sbjct: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480

Query: 462 FKDPRAIAYYLKHRQKGFLYSLFSQHLQKI 491
           F+D R + YYL     G   + + +HL+ +
Sbjct: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESL 510

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  354 bits (909), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 192/454 (42%), Positives = 268/454 (59%), Gaps = 46/454 (10%)

Query: 66  GVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAP-- 123
           G+YY++WSPY+ R HFPHDIDF+R+T V Y+F VV+ +TG+ Q +D WSD++M  +    
Sbjct: 74  GIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQMF 133

Query: 124 ----------GIPQGV-----TGMIGELNYLKL----------QRNTNFRLFMAVGGWSN 158
                       PQ        G IGEL YLK           +   NF+  M+VGGWSN
Sbjct: 134 SAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIMSVGGWSN 193

Query: 159 REAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSK 218
           REAF  +V+S  K+K F+NS +D MF+YGFDGID+DWEFPK+D  EP  YL+M   LR K
Sbjct: 194 REAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMRSLRKK 253

Query: 219 MDKLEDEIWGANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSK 278
           +D LE +I+G        F L+ A  A    L+ LP+ E++++V  WN+M YDF G+WS+
Sbjct: 254 LDDLESDIFGTEKHT-QHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSR 312

Query: 279 RTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPA 338
            T Y SNLY    +   L KR       +++EG +AD A+++++   K+ AKK+ LGMPA
Sbjct: 313 HTAYQSNLY----SRSSLGKRS------ENSEGGSADTAVRLLLNKHKLPAKKIVLGMPA 362

Query: 339 YGRGFTNVQT--KDDDDLLNKKYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYC 396
           YGRGF  V      + +++ + +            I LYNQLPL    E FD   VSAY 
Sbjct: 363 YGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQDAVSAYS 422

Query: 397 F----DKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQE 452
                +K +   V YDN+QSM++K+ YV + +L GGF+WESCG+ + D  R+L RAF+QE
Sbjct: 423 VKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQE 482

Query: 453 LSEMR--IPTIFKDPRAIAYYLKHRQKGFLYSLF 484
           +  +   +PTI+  P+   YY K    GFL S+ 
Sbjct: 483 IKYLNKTVPTIYALPQVGEYYHKKYPDGFLASII 516

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  347 bits (891), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/457 (42%), Positives = 267/457 (58%), Gaps = 49/457 (10%)

Query: 63  YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA 122
           +  G+YY++WSPY  R HFPHDIDF+++T+V YAF VV+ +TG+ Q +D WSD++M  + 
Sbjct: 71  FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK 130

Query: 123 PGI------------PQGV-----TGMIGELNYLK----LQRN------TNFRLFMAVGG 155
             I            P G       G IGEL +LK    L RN       NF+  M+VGG
Sbjct: 131 QMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGG 190

Query: 156 WSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRL 215
           WSNREAF  +V S  KL+ F++S +  MFEYGFDGID+DWEFPK+D  EP +YL+M   L
Sbjct: 191 WSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKAL 250

Query: 216 RSKMDKLEDEIWGANNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGS 275
           R ++D LE +I+G+ +  +  F L+ A  A  + LK LP+ E +++V  WN+M YDF G+
Sbjct: 251 RERLDTLESQIFGSKDHKH-HFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGA 309

Query: 276 WSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLG 335
           WS +T Y SNLY   K N    KR   G         +AD A++ + +  K+ +KK+ LG
Sbjct: 310 WSAQTAYQSNLYTPAKTN----KRSTNGRG-------SADKAVRFLTDKSKLASKKIVLG 358

Query: 336 MPAYGRGFTNVQT--KDDDDLLNKKYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVS 393
           MPAYGRGF  V+   K  ++++ K +            I LY QLPL    E FD   VS
Sbjct: 359 MPAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVS 418

Query: 394 AYCF----DKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAF 449
           AYC     +K     + YDN+ SM  K+ YV++ HL GGF+WESCG+ +    ++LV AF
Sbjct: 419 AYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAF 476

Query: 450 SQELSEMRI--PTIFKDPRAIAYYLKHRQKGFLYSLF 484
           ++E+  +    PTI+  P  + +YLK    GFL S F
Sbjct: 477 TKEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTF 513

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  343 bits (881), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/503 (38%), Positives = 285/503 (56%), Gaps = 63/503 (12%)

Query: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQ-HG------KYAVGVYYTSWSPY 75
           EM    K+    FK  RSD  R   +     V  N+Q HG       +  GVYY++WSPY
Sbjct: 30  EMCLYNKI----FKNQRSDDIRDNFNNGGHRVPSNVQNHGTHIRDEAFISGVYYSNWSPY 85

Query: 76  EPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEM--------------PSH 121
           +PR HFPHDI+ K+V+++ YAFF ++ +TG ++ TDSWSDLEM                 
Sbjct: 86  KPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSELIKES 145

Query: 122 APGIPQGVT--GMIGELNYLK-LQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNS 178
           +    Q +   G IGEL YLK    +  F++ M++GGWS+ E F  I++ ++ L+NFV+S
Sbjct: 146 SNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSIGGWSDSENFKIIIKDDKLLQNFVDS 205

Query: 179 TIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFE 238
           +++ MF  GFDGIDLDWEFP ++  EP  YL++   LR K++ LE +I+G    D+  F+
Sbjct: 206 SVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFGKRTEDH--FQ 263

Query: 239 LSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKK 298
           LS+A PAF   L  LPI E++++V  WNMMTYD++GSWS+ TGYHSNL+   +       
Sbjct: 264 LSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFSETE------- 316

Query: 299 RRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTK-----DDDD 353
                        LN + A+  M++ F V+++K+ LGM AYGR F     K      +  
Sbjct: 317 -------------LNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQNTV 363

Query: 354 LLNK------KYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGY 407
           L+NK      K             IW Y  LP   T E++D ++VSAYCFD+    F+ Y
Sbjct: 364 LINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIFISY 423

Query: 408 DNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQEL--SEMRIPTIFKDP 465
           DN +S++ K++YV   +L GGF+WESCG+ + +  R+L+ AF++ L  +    P+IF+D 
Sbjct: 424 DNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIFQDV 483

Query: 466 RAIAYYLKHRQKGFLYSLFSQHL 488
           R   YYL     G   S + +HL
Sbjct: 484 RVKKYYLNKYGDGGFLSPYLKHL 506

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  339 bits (869), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/493 (38%), Positives = 281/493 (56%), Gaps = 61/493 (12%)

Query: 35  FKKPRSDIERTALSTITRPVDRNLQHGK-------YAVGVYYTSWSPYEPRLHFPHDIDF 87
           FK  RSD  R         V   +Q+ K       Y  GVYY++WSPY PR HFPHDI+ 
Sbjct: 38  FKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDGGKGYVSGVYYSNWSPYTPRFHFPHDINL 97

Query: 88  KRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVT----------------G 131
            +V++V YAFF ++ KTG ++ TDSWSDLEM  + P   +                   G
Sbjct: 98  MQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLNDSVQNILPLG 157

Query: 132 MIGELNYLK-LQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDG 190
            +GEL YLK       F++ M++GGWS+ E F  IV  ++ L+NFV+S+++ MF+ GFDG
Sbjct: 158 CVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDG 217

Query: 191 IDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFELSVATPAFSQTL 250
           ID+DWEFP+++  EP  YL++   LR K++ LE +I+G +  D+  F++S+A PAF   L
Sbjct: 218 IDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIEDH--FQISIAAPAFKDKL 275

Query: 251 KILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNE 310
             LPI E+++++  WNMMTYD++GSWS+ TGYHSNL+   +                   
Sbjct: 276 FFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETE------------------- 316

Query: 311 GLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTK-----DDDDLLNKKYXXXXX- 364
            L+ + A+  M++ F V + K+ LGM AYGR F    +K      +  L+N+ +      
Sbjct: 317 -LSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKP 375

Query: 365 -----XXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDY 419
                       IW Y  LP   T E++D ++VSAYCFD+    F+ YDN +S + K++Y
Sbjct: 376 GKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEY 435

Query: 420 VKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQEL--SEMRIPTIFKDPRAIAYYL-KHRQ 476
           V    L GGF+WESCG+ H +  R+L+ AF++ +  +    P++F+D R I +YL K+  
Sbjct: 436 VMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGD 495

Query: 477 KGFLYSLFSQHLQ 489
            GFL S + +HL+
Sbjct: 496 DGFL-SPYLKHLE 507

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/496 (37%), Positives = 284/496 (57%), Gaps = 64/496 (12%)

Query: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDR-------NLQHGKYAVGVYYTSWSPY 75
           EM    K+    FK  RS+  R + +     V         N+    +  GVYY++WSPY
Sbjct: 30  EMCLYKKI----FKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPY 85

Query: 76  EPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGV------ 129
           +PR HFPHDI+  +V++V YAFF ++P+TG ++ TD+WSDLEM  + P   +        
Sbjct: 86  KPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGN 145

Query: 130 ----------TGMIGELNYLKLQ-RNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNS 178
                      G IGEL YLK       F++ M++GGWS+ E F  I+++E  L+ FV+S
Sbjct: 146 SSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDS 205

Query: 179 TIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFE 238
           +++ MF+ GFDGIDLDWEFP+++  EP  YL++   LRSK++ LE +I+G    D+  F+
Sbjct: 206 SVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGVEDH--FQ 263

Query: 239 LSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKK 298
           LS+A PAF   L  LPI E+++++  WNMMTYD++GSWS+ TGYHSNL+   +       
Sbjct: 264 LSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETE------- 316

Query: 299 RRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGF----TNVQT-KDDDD 353
                        L+ + AI  M++ F ++++K+ LGM AYGR F    +  Q    +  
Sbjct: 317 -------------LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTI 363

Query: 354 LLNK------KYXXXXXXXXXXXXIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGY 407
           L+N+      K             IW Y  LP   T E++D ++VSAYCFD+    F+ Y
Sbjct: 364 LINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISY 423

Query: 408 DNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSE--MRIPTIFKDP 465
           DN +S++ K++YV    L GGF+WESCG+T+ +  R+L+ AF++ L       P++F++ 
Sbjct: 424 DNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFENE 483

Query: 466 RAIAYYL-KHRQKGFL 480
           R + +YL K+   GFL
Sbjct: 484 RVVNFYLNKYGNNGFL 499

>KNAG0B04350 Chr2 (828924..831824) [2901 bp, 966 aa] {ON} Anc_5.400
           YHR098C
          Length = 966

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 425 LSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRIPTIFKDPRAIAYY 471
           L+GG+  E CG + N+  RN+V+ +S   ++  IP I   P    YY
Sbjct: 856 LAGGYLPE-CGTSINEKARNIVKYWSHITAQPTIPLILLRPNIDQYY 901

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,803,393
Number of extensions: 2941266
Number of successful extensions: 7734
Number of sequences better than 10.0: 34
Number of HSP's gapped: 7854
Number of HSP's successfully gapped: 36
Length of query: 527
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 413
Effective length of database: 40,409,475
Effective search space: 16689113175
Effective search space used: 16689113175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)