Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_45115.440ON46146119840.0
ACL167C5.440ON43939710981e-146
SAKL0G02662g5.440ON4792509521e-124
Kwal_55.214085.440ON4362658871e-115
KLLA0E02311g5.440ON4172688751e-113
CAGL0K10230g5.440ON4462628681e-112
KLTH0F15928g5.440ON4232488611e-111
NDAI0C015905.440ON4702448291e-106
Smik_15.3005.440ON4634038101e-103
KAFR0D050505.440ON4192678061e-103
Skud_15.2855.440ON4874067941e-100
YOR123C (LEO1)5.440ON4642747911e-100
Suva_8.1755.440ON4532827881e-100
TDEL0D026105.440ON4402707842e-99
NCAS0H020805.440ON4352687807e-99
KNAG0B042105.440ON4632807732e-97
Kpol_1062.265.440ON4572817635e-96
ZYRO0F10164g5.440ON4232417597e-96
TPHA0E017305.440ON4692527574e-95
TBLA0A064905.440ON4282656702e-82
SAKL0H00858g5.4ON43230741.5
KLTH0B09570g5.4ON42830722.7
ZYRO0C01210g5.4ON43331704.5
Kwal_26.94955.4ON42830704.5
TDEL0D031404.138ON75454704.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4511
         (461 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   768   0.0  
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   427   e-146
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   371   e-124
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   346   e-115
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   341   e-113
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   338   e-112
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   336   e-111
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   323   e-106
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   316   e-103
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   315   e-103
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   310   e-100
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   309   e-100
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   308   e-100
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   306   2e-99
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   305   7e-99
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   302   2e-97
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   298   5e-96
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   296   7e-96
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   296   4e-95
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   262   2e-82
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    33   1.5  
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    32   2.7  
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    32   4.5  
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    32   4.5  
TDEL0D03140 Chr4 complement(583221..585485) [2265 bp, 754 aa] {O...    32   4.9  

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/461 (83%), Positives = 384/461 (83%)

Query: 1   MSQGTEDLVQEQSVELKGSTSDVERSDHVDIDKXXXXXXXXXXXXXXXXXXXXXXXVIER 60
           MSQGTEDLVQEQSVELKGSTSDVERSDHVDIDK                       VIER
Sbjct: 1   MSQGTEDLVQEQSVELKGSTSDVERSDHVDIDKGQSSERGSSDGGDDLFGDDSDQSVIER 60

Query: 61  GETDDENSGGTSVKPTGLGLSDEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQ 120
           GETDDENSGGTSVKPTGLGLSDEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQ
Sbjct: 61  GETDDENSGGTSVKPTGLGLSDEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQ 120

Query: 121 IMKHVVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLG 180
           IMKHVVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLG
Sbjct: 121 IMKHVVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLG 180

Query: 181 DRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTV 240
           DRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTV
Sbjct: 181 DRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTV 240

Query: 241 SHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPX 300
           SHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDP 
Sbjct: 241 SHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPE 300

Query: 301 XXXXXXXXXHDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMAEMYGKHH 360
                    HDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMAEMYGKHH
Sbjct: 301 LEKKELEKKHDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMAEMYGKHH 360

Query: 361 QXXXXXXXXXXXXXXXXXXXXXXXXNAAGSLMXXXXXXXXXXXXLNAERLKQLKIEGAAR 420
           Q                        NAAGSLM            LNAERLKQLKIEGAAR
Sbjct: 361 QDEYDDEDGFIDDSEEEESGSYDEENAAGSLMDEESDGEDDEDDLNAERLKQLKIEGAAR 420

Query: 421 YQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           YQHG        DLDTKQDPENNDGSAPKRRKVAVLDSDDE
Sbjct: 421 YQHGSTTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  427 bits (1098), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 230/397 (57%), Positives = 270/397 (68%), Gaps = 18/397 (4%)

Query: 66  ENSGGTSVKPTGLGLSDEEDE-QEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKH 124
           E+SG    + TG GL  E++E QEMYNRKFYGDDL++ S  SD +E REIKEA+++++KH
Sbjct: 60  EDSGSRRSRGTGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKH 119

Query: 125 VVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLI 184
           VVP       E    LYY KVPQFLTIDP+PFDPP FQ QIE+R+ RFSSKEDQLGD LI
Sbjct: 120 VVPLLYNKPLEGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLI 179

Query: 185 DENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQ 244
           DENTIRWRYSRG++Q+VFKESNAQ+I+WSDGT SLKLGDE++DIL N+IENTY+TVSHEQ
Sbjct: 180 DENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQ 239

Query: 245 EELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXX 304
           +E+MQCVEGG I  SMLFIPTSTNSK H+RL+ AIARREAREHSGPSTYIVR DP     
Sbjct: 240 QEIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKR 299

Query: 305 XXXXXHDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMAEMYGKHHQXXX 364
                HDQV+RERRKRQLKEQ+DR+N EGG+ + G F FKK  GR   A  Y +  +   
Sbjct: 300 ELQKKHDQVLRERRKRQLKEQLDRDNLEGGLAQ-GSFEFKKAAGR---AAPYSRSME-DE 354

Query: 365 XXXXXXXXXXXXXXXXXXXXXNAAGSLMXXXXXXXXXXXXLNAERLKQLKIEGAARYQHG 424
                                +AA SL             LNA RL+QLK EGAA+Y   
Sbjct: 355 YDDEDGFIDDDDDLEALSDNDDAADSLPGSPTASQDEEDDLNAARLQQLKREGAAKYAAA 414

Query: 425 XXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
                   ++            A KRRKVAVLDSDDE
Sbjct: 415 PPAPRADEEV------------ALKRRKVAVLDSDDE 439

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  371 bits (952), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 174/250 (69%), Positives = 208/250 (83%), Gaps = 5/250 (2%)

Query: 82  DEEDEQEMYNRKFYGDDLKKTSYESDVEE-EREIKEANVQIMKHVVPYYTTNASEKDSSL 140
           +E++EQ MYNRKFYGDD+     +SD E+ +RE KEA+V+I KH+VPY TT+ S+ D  +
Sbjct: 127 EEDEEQAMYNRKFYGDDVDN---DSDAEDSQREFKEADVEIAKHIVPYKTTSNSQ-DKEV 182

Query: 141 YYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQ 200
           YYAKVPQFLTIDP+PFDPP F+  +E RL +FSSKEDQL DRLIDENTIRWRYSR + QQ
Sbjct: 183 YYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQ 242

Query: 201 VFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSM 260
           VFKESNAQIIQWSDGTFSL+LGDEFSD+LIND +NT++TVSHEQ+ELMQCVEGGEI K+M
Sbjct: 243 VFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTM 302

Query: 261 LFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRKR 320
           +FIPTST+SK HQRLS A+ RRE REH GP+TYIVR DP           DQ++RERRKR
Sbjct: 303 MFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKR 362

Query: 321 QLKEQMDREN 330
           QLKEQ+++EN
Sbjct: 363 QLKEQLEKEN 372

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 13/57 (22%)

Query: 405 LNAERLKQLKIEGAARYQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           LNAERL+QLK EGAA+Y+              K +   ++ S+ KRRK+AVLD ++E
Sbjct: 434 LNAERLRQLKREGAAQYEQ-------------KDEESGSEESSHKRRKIAVLDDEEE 477

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  346 bits (887), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 211/265 (79%), Gaps = 4/265 (1%)

Query: 65  DENSGGTSVKPTGLGLSDEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKH 124
           D+   GT  +  G G  DEEDEQ MYNRKFYGD+ + ++ E     +RE +EA+V ++KH
Sbjct: 59  DQEDDGTQAREDGEGEEDEEDEQAMYNRKFYGDNAEDSNDEG---SQREFREADVDVVKH 115

Query: 125 VVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLI 184
           VVPY T   SE D +++YAKVPQFLTIDPIPFDPP FQ++IEQR  + SS EDQ+ DRLI
Sbjct: 116 VVPYSTV-PSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLI 174

Query: 185 DENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQ 244
           +ENT+RWRYSR + QQVFKESNAQI+QWSDGTFSL+LGDEF+D+LIND E+TY+TVSH+Q
Sbjct: 175 EENTVRWRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQ 234

Query: 245 EELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXX 304
           +EL+Q V+GGE+ K+M+FIPTSTNSK+HQRLS A+AR+E REH GP+TYI+R+DP     
Sbjct: 235 QELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQK 294

Query: 305 XXXXXHDQVIRERRKRQLKEQMDRE 329
                  Q+IRERRKRQL+EQ +RE
Sbjct: 295 ELEKKQGQIIRERRKRQLREQQERE 319

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 407 AERLKQLKIEGAARYQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           AERL+QLK  GA++Y+          D    ++P++   S  KRRKVAVLD +D+
Sbjct: 388 AERLRQLKRSGASQYRSEGSEDDHVAD----EEPQD---STLKRRKVAVLDDEDD 435

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  341 bits (875), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 163/268 (60%), Positives = 212/268 (79%), Gaps = 8/268 (2%)

Query: 65  DENSGGTSVKPTGLGLSDEEDE-QEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMK 123
           D++S GTS       + DEEDE Q MYNRKF G+D +  S E   ++ +E+   +V+I+K
Sbjct: 50  DDSSAGTSHHRV---IDDEEDEEQAMYNRKFLGEDYEGQSEEEYEKKYKEV---DVEIVK 103

Query: 124 HVVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRL 183
           HVVPY T N ++ D ++YYAKVPQFLTIDP+PFDPP FQ ++E R+ ++SSKEDQLGDRL
Sbjct: 104 HVVPYKTANGAD-DKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRL 162

Query: 184 IDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHE 243
           I+ENTIRWRYSR  +++VFKESNAQI++WSDGTFSLK+GDE++DIL+N+ ENTY+TVSHE
Sbjct: 163 IEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHE 222

Query: 244 QEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXX 303
           ++EL+QCVEGGEI KSM+F+PTSTNSK H+ LS A+ARR+ R   GP+TYI R DP    
Sbjct: 223 EQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEK 282

Query: 304 XXXXXXHDQVIRERRKRQLKEQMDRENA 331
                 HDQ++RERRK+QLKE+++ ENA
Sbjct: 283 RELEKKHDQILRERRKKQLKEKLELENA 310

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  338 bits (868), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/262 (59%), Positives = 202/262 (77%), Gaps = 5/262 (1%)

Query: 86  EQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLYYAKV 145
           EQEMY RKFYG+D    +Y SD +E    KE+NV +++H++PY T   + +   ++YAKV
Sbjct: 108 EQEMYTRKFYGEDA--VNY-SDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKV 164

Query: 146 PQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQVFKES 205
           P FLTIDP+PFDP  F++ +++RL + +SKEDQLGDRLIDENTIRWRYSR A Q VFKES
Sbjct: 165 PAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKES 224

Query: 206 NAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSMLFIPT 265
           NAQI+QWSDG+FSLKLGDE++DI++ND +NT++TVSH+Q+ELMQC +GGEI K+M+FIPT
Sbjct: 225 NAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPT 284

Query: 266 STNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRKRQLKEQ 325
           STNSK HQ+LS A++RR AR++ GP +YI++ DP            Q+IRERRKRQ KE 
Sbjct: 285 STNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEI 344

Query: 326 MDRENAEGGIVETGYFGFKKGN 347
             RENAE G  ETG   FK+GN
Sbjct: 345 ETRENAENGFAETG--EFKRGN 364

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  336 bits (861), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 200/248 (80%), Gaps = 5/248 (2%)

Query: 82  DEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLY 141
           +E+DEQ MYNRKFYGD       +S+ E  +E +EA++ IMKH+VPY +T  S+ D ++Y
Sbjct: 63  EEDDEQAMYNRKFYGD----KGEDSNDEGSQEFREADIDIMKHIVPY-STEPSQGDKTIY 117

Query: 142 YAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQV 201
           Y KVPQFLTIDPIPFDPP FQS+IE+R  + +S EDQ+ DRLI+ENT+RWRYSR  NQ+V
Sbjct: 118 YTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRV 177

Query: 202 FKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSML 261
           FKESNA I+QWSDGT+SL+LGDE++D+LIND E+TY+ VSH+Q+EL+Q V+GGE+ K+M+
Sbjct: 178 FKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMI 237

Query: 262 FIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRKRQ 321
           FIPTSTNSK+HQRLS A+AR+E +EH GP+TYI+R+DP            Q+IRERRKRQ
Sbjct: 238 FIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQ 297

Query: 322 LKEQMDRE 329
           L+EQ +RE
Sbjct: 298 LREQQERE 305

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 7/56 (12%)

Query: 406 NAERLKQLKIEGAARYQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           NAERL+QLK +GAA+Y             D   + ++ + SA KRRKVAVLD +D+
Sbjct: 374 NAERLRQLKRKGAAQYNTQEAS-------DNNVESDDAEDSAMKRRKVAVLDDEDD 422

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  323 bits (829), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 192/244 (78%), Gaps = 4/244 (1%)

Query: 82  DEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLY 141
           D +DE+ MY RKFYGD  K   Y  + E+  + KEANV+I++H+VPY T+ + + D+++Y
Sbjct: 114 DMDDEEAMYTRKFYGDTDK---YSDNEEDAHDFKEANVEIIRHMVPYKTS-SDQADTTIY 169

Query: 142 YAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQV 201
           YAKVP FLTIDPIPFDP  F+++++ RL  +SS+EDQLGDRLIDENTIRWRYSR  NQ+V
Sbjct: 170 YAKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRV 229

Query: 202 FKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSML 261
           FKESNAQI+QWSDG+FSLKLGDE++DIL+ND +NT++TVSH+Q+ELMQC  GGEI K+M+
Sbjct: 230 FKESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMM 289

Query: 262 FIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRKRQ 321
           FIPTSTNSK HQ+LS A+ RR  R++ GP T I+  DP            Q++RERRKRQ
Sbjct: 290 FIPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQ 349

Query: 322 LKEQ 325
           LKE+
Sbjct: 350 LKER 353

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  316 bits (810), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/403 (42%), Positives = 240/403 (59%), Gaps = 26/403 (6%)

Query: 61  GETDDENSGGTSVKPTGLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANV 119
           G++D+E+    S     LGL D+E +EQ MY RKFYG+DL   S +   E     KE NV
Sbjct: 83  GDSDEESVNHRSRHRESLGLDDDEAEEQAMYTRKFYGEDLNDFSDQD--EATHTFKEENV 140

Query: 120 QIMKHVVPYY-TTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQ 178
           ++++H++P     N +   + ++YA++P FLTIDP+PFDPP F++++ +R    +SKEDQ
Sbjct: 141 ELVRHIIPSKGIVNETASHNEIFYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQ 200

Query: 179 LGDRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYM 238
           L DRLIDENT+RWRYSR  +Q VFKESN QI+QWSDGT+SLK+G+E +DIL+ND  NT++
Sbjct: 201 LDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFL 260

Query: 239 TVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMD 298
           TVSH+Q+EL+QC EGGEIKK+++FIPTSTNSK HQ+LS A+ RR  R++ GP TYIV MD
Sbjct: 261 TVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMD 320

Query: 299 PXXXXXXXXXXHDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMAEMYGK 358
           P            Q++R+RR+RQLKE+  +E+ +    ETG   F+K +  S  A    +
Sbjct: 321 PEVEKRELEKKQSQILRDRRRRQLKEKEKQESPDAAF-ETG---FRKQS--SPTAYGTSR 374

Query: 359 HHQXXXXXXXXXXXXXXXXXXXXXXXXNAAGSLMXXXXXXXXXXXXLNAERLKQLKIEGA 418
            ++                                            NA RL+ LK EGA
Sbjct: 375 RNEYEEDDFLVDDDEEEEAEFDDDDDNEEEEEEEEEEEEEEEDADEANAARLRSLKKEGA 434

Query: 419 ARYQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           A Y+                  EN D +  KRR+VAV++ D+E
Sbjct: 435 AMYRQ----------------EENEDNNETKRRRVAVIEDDEE 461

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  315 bits (806), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 157/267 (58%), Positives = 201/267 (75%), Gaps = 10/267 (3%)

Query: 84  EDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLYYA 143
           ++E+ MYNRKFYG++    S  SD EEE   KEA+V++++HVVPY T   +E D ++YY 
Sbjct: 66  DEEEAMYNRKFYGEE---GSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYT 122

Query: 144 KVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQVFK 203
           KVP FL+IDP+PFDPP F++++++R   FSS EDQLGDRLIDENTIRWRYSR A Q+VFK
Sbjct: 123 KVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFK 182

Query: 204 ESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSMLFI 263
           ESNAQI+QWSDG++SLKLG E++DIL+N  +NT++TVSH+Q+ELMQCV+GG+I K+++FI
Sbjct: 183 ESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFI 242

Query: 264 PTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRKRQLK 323
           PTSTNSK HQRLS AIARR+ R HSGP T IV +DP            Q+IRERR+RQ+K
Sbjct: 243 PTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMK 302

Query: 324 EQMDRENAEGGIVETGYFGFKKGNGRS 350
           EQ   E+ E G        F   N RS
Sbjct: 303 EQERLESPELG-------AFSHSNRRS 322

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  310 bits (794), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/406 (41%), Positives = 239/406 (58%), Gaps = 30/406 (7%)

Query: 58  IERGETDDENSGGTSVKPTGLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKE 116
           I   ++DDE     S     LGL D+E +EQ MY RKFYG+D     Y    E     KE
Sbjct: 108 INSEDSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDA--NDYSDQDEAAHTFKE 165

Query: 117 ANVQIMKHVVPY-YTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSK 175
            N++I++H++P     N +   + ++YA++P FLTID +PFDPP F++++ +R    +SK
Sbjct: 166 ENIEIVRHIIPNKANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSK 225

Query: 176 EDQLGDRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIEN 235
           EDQL DRLIDENT+RWRYSR  +Q VFKESN QI+QWSDG++SLK+G+E +DIL+ND  N
Sbjct: 226 EDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSN 285

Query: 236 TYMTVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIV 295
           T++TVSH+Q+EL+QC EGGEIKK+++FIPTSTNSK HQ+LS A+ RR  R++ GP TYIV
Sbjct: 286 TFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIV 345

Query: 296 RMDPXXXXXXXXXXHDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMAEM 355
            MDP            QV+R+RR+RQLKE+  +E+ +    ETG   F+K +  +     
Sbjct: 346 NMDPEVEKKELEKKQSQVLRDRRRRQLKEREKQESPDAAF-ETG---FRKQSSPTS---- 397

Query: 356 YGKHHQXXXXXXXXXXXXXXXXXXXXXXXXNAAGSLMXXXXXXXXXXXXLNAERLKQLKI 415
           YG   +                        +                   NA RL+ LK 
Sbjct: 398 YGISRRNEYEEDDFLVDDDEEEEAGFDDGDDEEEEEEEEEEEEADQE---NAARLRNLKR 454

Query: 416 EGAARYQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           EGAA Y               K++ +++D +  KRR+VAV++ D++
Sbjct: 455 EGAAMY---------------KEEEKDDDSNETKRRRVAVIEDDED 485

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  309 bits (791), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/274 (52%), Positives = 196/274 (71%), Gaps = 8/274 (2%)

Query: 77  GLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPY-YTTNAS 134
            LGL D+E +EQ MY RKFYG+D    ++    E     KE NV++++H++P     N +
Sbjct: 105 SLGLDDDEAEEQAMYTRKFYGEDA--NNFSDQDETTHTFKEENVELVRHIIPSKANVNET 162

Query: 135 EKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYS 194
              + ++YA++P FLTIDPIPFDPP F++++ +R    +S+EDQL DRLIDENT+RWRYS
Sbjct: 163 ASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYS 222

Query: 195 RGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGG 254
           R  +Q VFKESN QI+QWSDGT+SLK+G+E +DIL+ND  NT++TVSH+Q+EL+QC EGG
Sbjct: 223 RDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 282

Query: 255 EIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVI 314
           EIKK+++FIPTSTNSK HQ+LS A+ RR  R+  GP TYIV MDP            Q++
Sbjct: 283 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQIL 342

Query: 315 RERRKRQLKEQMDRENAEGGIVETGYFGFKKGNG 348
           R+RR+RQLKE+  +E+ +    ET   GF+K N 
Sbjct: 343 RDRRRRQLKEKEKQESPDAAF-ET---GFRKQNS 372

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  308 bits (788), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 201/282 (71%), Gaps = 5/282 (1%)

Query: 61  GETDDENSGGTSVKPTGLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANV 119
           G +D+E++         LGL D+E +EQ MY RKFYG+D    S +   E     KE NV
Sbjct: 81  GNSDEESANHRDHHRESLGLDDDEAEEQAMYTRKFYGEDANDFSDQD--EATHTFKEENV 138

Query: 120 QIMKHVVPY-YTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQ 178
           ++++H++P     N +   + ++YA++P FLTIDPIPFDPP F++++ +R     SKEDQ
Sbjct: 139 ELVRHIIPSKANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQ 198

Query: 179 LGDRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYM 238
           L DRLIDENT+RWRYSR  +Q VFKESN QI+QWSDG++SLK+G+E++DIL+ND  NT++
Sbjct: 199 LDDRLIDENTVRWRYSRDNDQHVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFL 258

Query: 239 TVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMD 298
           TVSH+Q+ELMQC EGGEIKK+++FIPTST+SK HQ+LS A+ R+  R++ GP TYI+ MD
Sbjct: 259 TVSHDQQELMQCYEGGEIKKTLMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMD 318

Query: 299 PXXXXXXXXXXHDQVIRERRKRQLKEQMDRENAEGGIVETGY 340
           P            Q++R+RRKRQLKE+  +E+ + G  ET +
Sbjct: 319 PEVEKRELEKKQSQILRDRRKRQLKEKEKQESPDVGF-ETAF 359

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  306 bits (784), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 194/270 (71%), Gaps = 8/270 (2%)

Query: 78  LGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTN-ASE 135
           + + DEE  E  MY RKFYG+D    S +   E      E NV++++H+VPY T    ++
Sbjct: 76  MQMDDEEAQEHAMYTRKFYGEDADNMSDQE--ESANHFTEENVELVRHIVPYKTVGEGAD 133

Query: 136 KDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSR 195
           + S++YYAKVP+FLTIDP+PFDPP F+S++++RL   SS+EDQLGDRLIDENTIRWRYSR
Sbjct: 134 EKSTIYYAKVPEFLTIDPVPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSR 192

Query: 196 GANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGE 255
             NQQV+KESNAQI+QWSDG  SLKLG E++DIL+ND +NT+  VSH+++ELMQC +GGE
Sbjct: 193 DENQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGE 252

Query: 256 IKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIR 315
           + KS++FIPTSTNSK HQ+L+ A+ RR+ R+  GP  Y V  DP            QV+R
Sbjct: 253 VTKSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVR 312

Query: 316 ERRKRQLKEQMDRENAEGGIVETGYFGFKK 345
           ERRKRQLKE   R + +   + TG  G++K
Sbjct: 313 ERRKRQLKEIESRNSPD---ISTGLNGYRK 339

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 16/55 (29%)

Query: 407 AERLKQLKIEGAARYQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           AERL+QLK +G  RY              T+ +PE++   + KRRKVA++D +D+
Sbjct: 401 AERLRQLKRQGTERY--------------TEPEPESD--PSTKRRKVAIIDDEDD 439

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  305 bits (780), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 197/268 (73%), Gaps = 2/268 (0%)

Query: 81  SDEEDEQEMYNRKFYGDDLKKTSYESDVEEE-REIKEANVQIMKHVVPYYTTNASEKDSS 139
           +D ++E+ MY RKFYGDD     Y SD +      KE NV++++H+VPY T++    +++
Sbjct: 77  TDIDEEEAMYTRKFYGDD-DYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETT 135

Query: 140 LYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQ 199
           +YYAKVP FLTI+P+PFDP  F+S +  RL  +SSKEDQLGDRLIDENT+RWRYSR ANQ
Sbjct: 136 VYYAKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQ 195

Query: 200 QVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKS 259
           +VFKESNAQI+QWSDG+FSLKLGDE++DIL+N+  NT++ VSH+Q+ELMQC  GGEI K+
Sbjct: 196 RVFKESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKT 255

Query: 260 MLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRK 319
           ++FIPTSTNSK HQ+LS A+ RR  REH GP T I+  DP            Q+IR+RR+
Sbjct: 256 LMFIPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRR 315

Query: 320 RQLKEQMDRENAEGGIVETGYFGFKKGN 347
           RQLKE+   E+ +  +  +G +  +K N
Sbjct: 316 RQLKEKELLESPDTTMDVSGGYETRKRN 343

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  302 bits (773), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 147/280 (52%), Positives = 198/280 (70%), Gaps = 8/280 (2%)

Query: 82  DEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPY-YTTNASEKDSSL 140
           D ++E+EMYNRKFYG+D+  +  E   + E E KEANV+++KH+VPY    + +   + +
Sbjct: 95  DMDEEEEMYNRKFYGEDVDMSDTE---QAEHEFKEANVELVKHIVPYKLVPDDAIGTNDI 151

Query: 141 YYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQ 200
           Y AKVP FL IDP PFDP  F+ ++  RL    SKED+LGDRLIDENT+RWRYSR  NQ 
Sbjct: 152 YVAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQS 211

Query: 201 VFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSM 260
           VFKESN QI+QWSDG++SLKLG+E++DILIND +NT++TVSH+Q+ELMQCVEGG + K++
Sbjct: 212 VFKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTL 271

Query: 261 LFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRKR 320
           +FIPTST+SK HQ+LS A+ARR   + +GP TYIV +DP            Q+ +ERR+R
Sbjct: 272 MFIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQIFKERRRR 331

Query: 321 QLKEQMDRENAEGGI--VETGYFGFKKGNGRSMMAEMYGK 358
           QL+E+   E+ +  I    +G  G   G  R+  A M G+
Sbjct: 332 QLREKELAESPDTTIGGPRSGSAGSWHGTPRT--ARMVGR 369

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  298 bits (763), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 195/281 (69%), Gaps = 13/281 (4%)

Query: 82  DEEDEQEMYNRKFYG-DDLKKTSYESDVEEEREIKEANVQIMKHVVPY-YTTNASEKDSS 139
           DE++EQ MY RKFYG DD  K+  E   E++ E +E +V + +HVVP   T+  ++ D++
Sbjct: 88  DEDEEQAMYTRKFYGEDDYDKSDQE---EDKHEFREEDVVLTRHVVPTKITSEENDADTT 144

Query: 140 LYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQ 199
           +YYAKVP FLTIDPIPFDPP F++ + +RL    SKE+QL DRLID+NTIRWRYSR  NQ
Sbjct: 145 IYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQ 204

Query: 200 QVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKS 259
           +VFKESNA I+QWSDG++SLKLGDE++DIL+ND +NT++TVSH+Q+ELMQCV GGEI KS
Sbjct: 205 RVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKS 264

Query: 260 MLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIRERRK 319
           +LF+P ST SK HQRLS AI RR A E  GP + IV +DP            QV RERRK
Sbjct: 265 LLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRK 324

Query: 320 RQLKEQMDRENAEGGIVETGYFG---FKKGNGRSMMAEMYG 357
           ++ KE    E+     +ET  FG   +     RS     YG
Sbjct: 325 KKQKEIEALES-----LETTGFGNNSYSASRKRSTTPMSYG 360

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 16/55 (29%)

Query: 407 AERLKQLKIEGAARYQHGXXXXXXXXDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461
           AERL++LK +G A Y                 D E +   +PKRRKVAV++ D++
Sbjct: 418 AERLRELKRQGTAAYN----------------DDEKSGSESPKRRKVAVIEDDED 456

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  296 bits (759), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 188/241 (78%), Gaps = 5/241 (2%)

Query: 60  RGETDDENSGGTSVKPTGLGLSDEE-DEQEMYNRKFYGDDLKKTSYESDVEEEREIKEAN 118
           R  ++DEN  G         + DEE +E  MY RKFYG+D+ + S   D EE +E +E +
Sbjct: 61  RKGSEDENDEGEVTLRHRQEMDDEEAEEHAMYTRKFYGEDVDRVS---DEEEAQEFREED 117

Query: 119 VQIMKHVVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQ 178
           V++++H+VPY  T  ++K   LYYAK+P+FLTIDP+PFDPP F++ +++RL   +SKEDQ
Sbjct: 118 VELVRHIVPYRATQGTDK-PVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQ 176

Query: 179 LGDRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYM 238
           LGDRLIDENT+RWRYSR ANQQVFKESNAQI+QWSDGTFSLKLGDE++DIL ND +NT+ 
Sbjct: 177 LGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFF 236

Query: 239 TVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMD 298
            VSH+Q+ELMQC EGGE+ K+++FIPTST+S+ HQ+L+ A+ RR+ ++ +GP TYIV+ D
Sbjct: 237 AVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKD 296

Query: 299 P 299
           P
Sbjct: 297 P 297

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  296 bits (757), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 140/252 (55%), Positives = 189/252 (75%), Gaps = 12/252 (4%)

Query: 82  DEEDEQEMYNRKFYGD-DLKKTSYESDVEEEREIKEANVQIMKHVVPYYT---TNASEKD 137
           DE++E  MY RKFYGD D+ K  Y+ D E   E KEA+V++++H+VPY      N + KD
Sbjct: 107 DEDEEHAMYTRKFYGDEDVNK--YDED-ENMHEFKEADVELVRHIVPYKILEQKNDNSKD 163

Query: 138 -----SSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWR 192
                +S YYA++P FLTIDP+PFDPP F+S++++RL+  ++ +D++GDRLIDENTIRWR
Sbjct: 164 DATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWR 223

Query: 193 YSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVE 252
           YSR ANQ VFKESNAQIIQWSDG++SLKLGD+++D+L+NDI NT++TVSH+Q+ELMQCV+
Sbjct: 224 YSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVD 283

Query: 253 GGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQ 312
           GGEI KS +F+P STNS+ HQRLS AIARR+      P + I+ +DP            Q
Sbjct: 284 GGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQ 343

Query: 313 VIRERRKRQLKE 324
           + R+RRKR+ +E
Sbjct: 344 IFRDRRKRKQRE 355

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  262 bits (670), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 188/265 (70%), Gaps = 10/265 (3%)

Query: 81  SDEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNAS---EKD 137
           SD+E ++ MY +KFYG+D    S   D + E E KE+++++++H+VPY T  ++   +K 
Sbjct: 50  SDDEQDKAMYEKKFYGEDGFNRS--DDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKH 107

Query: 138 SSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGA 197
             LYYAKVP FL +DP+PFD   F+S +++R+K   +++ Q+ DRL DENTIRWRYSR +
Sbjct: 108 RELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDS 167

Query: 198 NQ--QVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGE 255
           N   +VFK+SNAQIIQWSDG++SLKLG++++DIL N+ +N ++TVSH+Q+ELMQC  GGE
Sbjct: 168 NDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGE 227

Query: 256 IKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPXXXXXXXXXXHDQVIR 315
           I K+++FIP+ST SK HQRL+AA+  R+ +  SGP   ++  DP            Q++R
Sbjct: 228 ITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMMR 287

Query: 316 ERRKRQLKEQMDRENAEGGIVETGY 340
           +RR++QL+E   REN E   + +G+
Sbjct: 288 DRRRKQLQE---RENNEVDGITSGF 309

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 312 QVIRERRKRQLKEQMDRENAEGGIVETGYF 341
           Q+I+  RK+ LK   D+++A GG+ E G+F
Sbjct: 115 QIIKAHRKQVLKHHPDKKSASGGLEEDGFF 144

>KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 428

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 312 QVIRERRKRQLKEQMDRENAEGGIVETGYF 341
           QVI+  RK+ LK   D+++A GG+ + G+F
Sbjct: 114 QVIKAHRKQVLKHHPDKKSASGGLEQDGFF 143

>ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 433

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 311 DQVIRERRKRQLKEQMDRENAEGGIVETGYF 341
           +Q+I+  RK+ LK   D+++A GG+ + G+F
Sbjct: 114 EQIIKSHRKQVLKHHPDKKSAHGGLDQDGFF 144

>Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR285C
           (ZUO1) - Zuotin, putative Z-DNA binding protein [contig
           73] FULL
          Length = 428

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 312 QVIRERRKRQLKEQMDRENAEGGIVETGYF 341
           Q+I+  RK+ LK   D+++A GG+ + G+F
Sbjct: 114 QIIKAHRKQVLKHHPDKKSASGGLEQDGFF 143

>TDEL0D03140 Chr4 complement(583221..585485) [2265 bp, 754 aa] {ON}
           Anc_4.138 YGR003W
          Length = 754

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 146 PQFLTIDPIPFDPPG---FQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRG 196
           PQ LT+   PF PP    F+ Q+   L++     +    R   E T++W ++ G
Sbjct: 509 PQILTMTSWPFQPPTNSDFELQLPTELEQLKLDFESFYTRKYTERTLQWAHNLG 562

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,635,197
Number of extensions: 1771021
Number of successful extensions: 6485
Number of sequences better than 10.0: 63
Number of HSP's gapped: 6661
Number of HSP's successfully gapped: 76
Length of query: 461
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 348
Effective length of database: 40,524,141
Effective search space: 14102401068
Effective search space used: 14102401068
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)