Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_45105.439ON1261266551e-89
ACL168C5.439ON1261266082e-82
NDAI0C015805.439ON1261265925e-80
CAGL0I01078g5.439ON1261265901e-79
SAKL0G02640g5.439ON1261265873e-79
TDEL0D026205.439ON1261265822e-78
Suva_8.1745.439ON1261265803e-78
Skud_15.2845.439ON1261265786e-78
Smik_15.2995.439ON1261265752e-77
YOR122C (PFY1)5.439ON1261265752e-77
KAFR0D050405.439ON1261265743e-77
KNAG0B042205.439ON1261265692e-76
KLLA0E02289g5.439ON1261265674e-76
Kpol_1062.275.439ON1261265648e-76
KLTH0F15950g5.439ON1261265613e-75
NCAS0H020705.439ON1261265596e-75
TPHA0E017405.439ON1261265449e-73
TBLA0A065005.439ON1191265292e-70
ZYRO0F10142g5.439ON1261265075e-67
Kwal_55.214135.439ON58582751e-32
KAFR0L012307.293ON10647690.28
Kpol_543.408.264ON41480690.58
YMR041C (ARA2)2.604ON33570652.2
Smik_13.2112.604ON35170616.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4510
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   256   1e-89
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   238   2e-82
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   232   5e-80
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   231   1e-79
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   230   3e-79
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   228   2e-78
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   228   3e-78
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   227   6e-78
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   226   2e-77
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   226   2e-77
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   225   3e-77
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   223   2e-76
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   223   4e-76
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   221   8e-76
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   220   3e-75
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   219   6e-75
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   214   9e-73
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   208   2e-70
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   199   5e-67
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   110   1e-32
KAFR0L01230 Chr12 complement(229891..230097,230300..230413) [321...    31   0.28 
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...    31   0.58 
YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON} ...    30   2.2  
Smik_13.211 Chr13 complement(344952..346007) [1056 bp, 351 aa] {...    28   6.5  

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  256 bits (655), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  238 bits (608), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 113/126 (89%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ATGKVDKA IYSRAGDTIWASSGG++LE +EI EISQGFDNA GLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRAD+RSIYGRHEAEG++AVRTKQTILIAHYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  232 bits (592), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ATGKVDKA+IYSRAGD++WA+SGG  L+ANEISEI QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQT+L+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  231 bits (590), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ATGKVDKA+IYS+AGD +WA+SGG+SL+ANEISEI QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQT+LIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  230 bits (587), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ TGKVDKAIIYSRAGD IWA+SGG++L+  EISEI+QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQSQKFML+RADDRSIYGRH+AEG++ VRTKQTILIAHYP GVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  228 bits (582), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ TGKVDKA+IYSRAGD+IWASSGG++L+ANEI EI+QGFD+  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQTILIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  228 bits (580), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNLI TGKVDKA+I+SRAGD IWA+SGG+SL+ NEI EI QGFDN GGLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG+I VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  227 bits (578), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNLI TGKVDKA+IYSRAGD IWA+SGG+SL+ NEISE+ QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG+I VRTKQT++I+HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNLI TGKVDKA+IYSRAGD +WA+SGG+SL+ NEI EI QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNLI TGKVDKA+IYSRAGD +WA+SGG+SL+ NEI EI QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  225 bits (574), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+AT KVD+A+IYSRAGD  WA+SGGM+L+ NEI+EI+QGFDNA GLQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  223 bits (569), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ TGKVDKA+IYSRAGD++WA+SGG++L+ NEIS I  GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFM LRADDRSIYGRH+AEG+I VRTKQTIL+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  223 bits (567), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ATGK+DK++IYSRAGD +WASSGG+ L+  EISEI++GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFML++ADDRSIYGRHEAEGI+ VRTKQTILI HYP GVQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  221 bits (564), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ATGK+DKA++YSRAGD +WASSGG++L A EIS I+QGFD+   LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFM+LRADDRSIYGRH+AEG++ VRTKQTIL+AHYPA VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  220 bits (561), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ TGK+DKA IYSRAGD++WA+SGG+SL  NEI EI+QGF+N  GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFML+RADDRSIYGRH+AEG+I VRTKQTIL+ HYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  219 bits (559), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQA TDNL+ATGKVD+A++YSRAGD++WA+SGG+ L+ NEI+EI++GFDN  GLQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFMLLRADD+SIYGRH+AEGI+ VRT QTILIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  214 bits (544), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 112/126 (88%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYTDNL+ATGKVDKA +YSRAGD  WA+SGG+SL A E +EI++GFD+  GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  208 bits (529), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQA       TGKVDKA+IYSRAGD++WASSGG+ L ANEI+EI++GFDN  GLQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+QSQKFMLLRADDRSIYGRH+AEGI+ VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  199 bits (507), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%)

Query: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60
           MSWQAYT+NL+ TGK+DKA IYSRAGD++WASSGG++    EI +I+ GFD   GLQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           L +Q QKFMLLRADDRSIY RH+AEG+  VRTKQTI++AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  110 bits (275), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (94%)

Query: 69  MLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADYLISVQY 126
           ML+RADDRSIYGRH+AEG++ VRTKQTIL+ HYPAGVQAGEATKIVEQLADYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>KAFR0L01230 Chr12 complement(229891..230097,230300..230413) [321
          bp, 106 aa] {ON} Anc_7.293 YDL130W
          Length = 106

 Score = 31.2 bits (69), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 8  DNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAG 54
          DNL+A  K   A +     D +WA     +LE  ++ EI  GF NAG
Sbjct: 23 DNLLAVTKAAGASV-----DNVWADVYAKALEGKDLKEILSGFHNAG 64

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score = 31.2 bits (69), Expect = 0.58,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 16/80 (20%)

Query: 8   DNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNGLHIQ--- 64
           DN+I  G+ D+ +    AGD I+        E NEI + +   +  G    N  HI    
Sbjct: 234 DNIILKGEADEELGKKNAGDLIF--------EINEIIDSNNDLERYGNHLINHTHISLAE 285

Query: 65  -----SQKFMLLRADDRSIY 79
                  KF++   DDR +Y
Sbjct: 286 AITGFENKFIVKTFDDRDLY 305

>YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON}
           ARA2NAD-dependent arabinose dehydrogenase, involved in
           biosynthesis of dehydro-D-arabinono-1,4-lactone; similar
           to plant L-galactose dehydrogenase
          Length = 335

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%)

Query: 16  VDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNGLHIQSQKFMLLRADD 75
           VD A + +R   + W   G + L  + + E+    DN   ++SNG  + S+   L+    
Sbjct: 254 VDLADLATRYAISEWVGKGPVVLGVSSMEELKLALDNYEIVKSNGNRLSSKDGQLVEYIQ 313

Query: 76  RSIYGRHEAE 85
           ++I+  H  E
Sbjct: 314 KNIFKEHFNE 323

>Smik_13.211 Chr13 complement(344952..346007) [1056 bp, 351 aa] {ON}
           YMR041C (REAL)
          Length = 351

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 32/70 (45%)

Query: 16  VDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNGLHIQSQKFMLLRADD 75
           VD A + +R   + W   G + L  + + E+    DN   ++SNG  +  +   L+    
Sbjct: 267 VDLADLATRYAVSEWMGKGPVVLGVSSMKELKLALDNYKNVESNGNKLSPRDKKLVDFIQ 326

Query: 76  RSIYGRHEAE 85
           ++I+  H  E
Sbjct: 327 KNIFKGHFNE 336

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,652,063
Number of extensions: 378843
Number of successful extensions: 838
Number of sequences better than 10.0: 40
Number of HSP's gapped: 838
Number of HSP's successfully gapped: 40
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)