Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_45095.438ON1031035381e-72
KLLA0E02267g5.438ON1031033967e-51
ACL169W5.438ON1031033716e-47
Kwal_55.214145.438ON1191033691e-46
SAKL0G02618g5.438ON1041043594e-45
KNAG0C048805.438ON1041063463e-43
NCAS0F034105.438ON1061043386e-42
CAGL0A02882g5.438ON1041033282e-40
TDEL0D026305.438ON1021063273e-40
KLTH0F15972g5.438ON1031033247e-40
Kpol_1016.35.438ON971023108e-38
ZYRO0F10120g5.438ON1051013055e-37
NDAI0B057005.438ON1041052934e-35
Kpol_1016.3asingletonON971022682e-31
TPHA0C00950singletonON991022031e-21
TBLA0C05870singletonON1001012005e-21
KAFR0D02490singletonON107941892e-19
KAFR0D02400singletonON114891651e-15
KAFR0D02500singletonON112891553e-14
KNAG0B027207.322ON120445710.23
Kpol_1043.212.343ON38333690.37
Kpol_2001.657.322ON120645670.66
NDAI0A020907.322ON120060660.88
CAGL0I03718g7.322ON120145661.1
KLTH0E14894g3.335ON73835641.5
Suva_6.2811.133ON61366632.4
Skud_4.1097.322ON120168623.2
Smik_10.301.133ON59866613.7
YJL201W (ECM25)1.133ON59966613.7
Suva_4.997.322ON120168614.0
KAFR0L013907.322ON120645614.5
TDEL0C022407.322ON120146606.0
YDL145C (COP1)7.322ON120168606.3
Skud_10.141.133ON59944596.7
ZYRO0F11110g7.322ON120145597.0
KNAG0C021501.133ON64666598.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4509
         (103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   211   1e-72
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   157   7e-51
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   147   6e-47
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   146   1e-46
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   142   4e-45
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   137   3e-43
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     134   6e-42
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   130   2e-40
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   130   3e-40
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   129   7e-40
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   124   8e-38
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   122   5e-37
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   117   4e-35
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   107   2e-31
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                 83   1e-21
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    82   5e-21
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      77   2e-19
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                68   1e-15
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      64   3e-14
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    32   0.23 
Kpol_1043.21 s1043 (41106..42257) [1152 bp, 383 aa] {ON} (41106....    31   0.37 
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    30   0.66 
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    30   0.88 
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    30   1.1  
KLTH0E14894g Chr5 (1320663..1320674,1320886..1323090) [2217 bp, ...    29   1.5  
Suva_6.281 Chr6 complement(493400..495241) [1842 bp, 613 aa] {ON...    29   2.4  
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    28   3.2  
Smik_10.30 Chr10 (52681..54477) [1797 bp, 598 aa] {ON} YJL201W (...    28   3.7  
YJL201W Chr10 (54379..56178) [1800 bp, 599 aa] {ON}  ECM25Non-es...    28   3.7  
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    28   4.0  
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    28   4.5  
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    28   6.0  
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    28   6.3  
Skud_10.14 Chr10 (28693..30492) [1800 bp, 599 aa] {ON} YJL201W (...    27   6.7  
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    27   7.0  
KNAG0C02150 Chr3 (421035..422975) [1941 bp, 646 aa] {ON} Anc_1.1...    27   8.8  

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  211 bits (538), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
           MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60

Query: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
           LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ
Sbjct: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  157 bits (396), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 85/103 (82%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
           MVEW V VYDKPGSDRS  R  HL  IP LV+ GKIV AGAIYKD+VDGKP  FAGSHL 
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60

Query: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
           +VAD+++EVVELLK D++AK  +WD+DN LI+PFGCAVRKEKQ
Sbjct: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  147 bits (371), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 85/103 (82%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
           MVEWC  +YDKPG DRS +R  HL  IP+LV++GK+V AGAIYK++VDG+P  FAGS L 
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60

Query: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
           LVAD+REE + +++ D +AK GVWD++N++++PFGCAVRKEKQ
Sbjct: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  146 bits (369), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 88/103 (85%), Gaps = 1/103 (0%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLV-DGKPGGFAGSHL 59
           MVEWCV VYDK GSDRS +R  HL+ IP+LV+EGK+V AGAIY+D+  +GK   FAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102
            +VADT+EE +E++KGD++AKEG+WD++NI+I+PFGCAVR+ K
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  142 bits (359), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 85/104 (81%), Gaps = 1/104 (0%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDL-VDGKPGGFAGSHL 59
           MVEWCV VYDKP +DRS +R  HL  IP LV++GK+V AGAI+ ++  +GKP  FAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
            +VAD++EE + ++K D++AKEG+WD++NILIFPFGCAVRKEK+
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 5/106 (4%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGG---FAGS 57
           MVEWC  VYDKPGSDRS +R  HL  IP+LVQ+GK+V AGAIY +     PGG   FAGS
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPT--TPGGDRTFAGS 58

Query: 58  HLILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
           HL +VADT+EE +E++ GD++AKEG+WD+ NI+++ FGCAVR+ K+
Sbjct: 59  HLQIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  134 bits (338), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 80/104 (76%), Gaps = 1/104 (0%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKD-LVDGKPGGFAGSHL 59
           MVEWCV VYDKPGSDRS +R  HL  IP LV++GK+V AGAIY +   +G+   FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
            ++ADT+EE + ++  DI+AKEG+WD DNI+I+ FGCAVR+ K 
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  130 bits (328), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 77/103 (74%), Gaps = 1/103 (0%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVD-GKPGGFAGSHL 59
           MVEWCV VYDKPGSDRS  R  HL  IP LV+ GK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102
            +VADT+EE +EL+  D++AK G+WD++NI+I+ FGCAVR+ K
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  130 bits (327), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 7/106 (6%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGG---FAGS 57
           MVEW V VYDK   DRS +R  HL  IP LV++GK+V AGAIY +     PGG   FAGS
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPT--TPGGERTFAGS 56

Query: 58  HLILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
           HL +VADT+EE +E++KGDI+AKEGVWD+DNI+I+ FGCAVRKEK+
Sbjct: 57  HLQIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  129 bits (324), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDL-VDGKPGGFAGSHL 59
           MVEWCV V+DK GSDRS  R  HLE + +  ++G +V AGAIY ++  DGKP  FAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102
            + A+T+E+ ++++K DI+AKEG+WD++NI+I+PFGCAVR+ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  124 bits (310), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 76/102 (74%), Gaps = 5/102 (4%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
           MVEWCV + DK GSDRS  R  HL  IP LV++GK+  AGAIY D      G FAGSHL 
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND-----DGSFAGSHLQ 55

Query: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102
           +VADT+E+ +E++KGD++A  G+WD+D+I+I+ FGCAVR+ K
Sbjct: 56  IVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  122 bits (305), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%), Gaps = 3/101 (2%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKD-LVDGKPGGFAGSHL 59
           MVEW V  +DK  +DRS YRS HL  IP  V+ GK+V AGAIY +    G+P  FAGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRK 100
            +VADT+EE +E++K DI+AKEGVWD+DN++++ FGCA+R+
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  117 bits (293), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 76/105 (72%), Gaps = 3/105 (2%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVD--GKPGGFAGSH 58
           MVEWCV + DK GSDRS + S H   IP LV++GK+V  GAIY +  +  G P   AGSH
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPT-VAGSH 59

Query: 59  LILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103
           L +VADT+EEV+EL+K DI+AKEG+WD+DN +I+ F  A+R  K+
Sbjct: 60  LQVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  107 bits (268), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (67%), Gaps = 5/102 (4%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
           M EWC+ + DK GS+RS   S H   I  LV++G +   GAIY D      G  AGSHL 
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND-----DGSVAGSHLQ 55

Query: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102
           +VADT+E+ +E++KGD++A  G+WD+D+I+I+ F CAVR+ K
Sbjct: 56  IVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score = 82.8 bits (203), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (64%), Gaps = 7/102 (6%)

Query: 1   MVEWCVTVYDKPGSD--RSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSH 58
           M E+ V + D  G++  R  +   H   IP LV  G +V  GA++ +  +G P    GSH
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNE--EGSP---VGSH 55

Query: 59  LILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRK 100
           + +VAD+RE+V+E+LK D++A+E VWD+++ +I+ F CAVRK
Sbjct: 56  IQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRK 97

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 81.6 bits (200), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%), Gaps = 5/101 (4%)

Query: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
           M EW VT+ D P SDR+P    H++R+P L+  G +   GA+  D      G   GSH  
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDD-----NGNMIGSHFE 55

Query: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKE 101
           L  +T+EE ++L+  D + K GVWDM++I I  F C  R+E
Sbjct: 56  LKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHREE 96

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 77.4 bits (189), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 59/94 (62%), Gaps = 5/94 (5%)

Query: 1  MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
          M EW V V DKP +DR+PY   HL  +P L ++  +V AGA+      G  G   GS   
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALI-----GDNGKEVGSSFQ 55

Query: 61 LVADTREEVVELLKGDIYAKEGVWDMDNILIFPF 94
          +VA+++E+ + ++K DI+AKEGV+++D+ + + F
Sbjct: 56 VVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 68.2 bits (165), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (59%), Gaps = 5/89 (5%)

Query: 1  MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
          M EW V V D    DR+PY   H+  +P LV  G IVVAGA+         G   G   I
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGALTT-----PEGKEIGGMFI 55

Query: 61 LVADTREEVVELLKGDIYAKEGVWDMDNI 89
          + A T+EE +E++K D++A++G+++MD++
Sbjct: 56 VTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 64.3 bits (155), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 5/89 (5%)

Query: 1  MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60
          M EW V + D  G+DR+PY   H++ +  L  E  +V AGA+         G   G  LI
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGALTTP-----EGKETGGILI 55

Query: 61 LVADTREEVVELLKGDIYAKEGVWDMDNI 89
          + A T+EE +E++K D++A++G++ MD I
Sbjct: 56 IAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 32.0 bits (71), Expect = 0.23,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 21/45 (46%)

Query: 48  DGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVWDMDNILIF 92
           DG+       H I +A  R E+V  +   I  K   WD  N+LI+
Sbjct: 502 DGQYVALMSKHTITIATRRLEMVNSMHETIRIKSAAWDESNVLIY 546

>Kpol_1043.21 s1043 (41106..42257) [1152 bp, 383 aa] {ON}
          (41106..42257) [1152 nt, 384 aa]
          Length = 383

 Score = 31.2 bits (69), Expect = 0.37,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 5  CVTVYDKPGSDRSPYRSMHLERIPELVQEGKIV 37
          CV V D+P + ++P   +HL+   + VQ+G I+
Sbjct: 33 CVAVLDRPSTTKAPELLVHLKESLDTVQDGGII 65

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 30.4 bits (67), Expect = 0.66,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 20/45 (44%)

Query: 48  DGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVWDMDNILIF 92
           DG+       H I + + R E+V      I  K   WD  N+LI+
Sbjct: 507 DGQYVALISKHTITITNKRLELVSTRHETIRVKSAAWDESNVLIY 551

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 30.0 bits (66), Expect = 0.88,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 34  GKIVVAGAIYKDL-VDGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVWDMDNILIF 92
           GKI      Y    +DG+       H I +A+ + E+V  +   I  K   WD   +LI+
Sbjct: 488 GKIAAKNVKYVSWSLDGQHVALMSKHTITIANKKLELVNSMHETIRIKSAAWDESGVLIY 547

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 30.0 bits (66), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 21/45 (46%)

Query: 48  DGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVWDMDNILIF 92
           DG+       H I + + R E++  +   I  K   WD  N+L++
Sbjct: 503 DGQYLAMMSKHTITIVNKRLELINSMHETIRIKSAAWDESNVLVY 547

>KLTH0E14894g Chr5 (1320663..1320674,1320886..1323090) [2217 bp, 738
           aa] {ON} similar to uniprot|P38254 Saccharomyces
           cerevisiae YBR094W Hypothetical ORF
          Length = 738

 Score = 29.3 bits (64), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 18  PYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPG 52
           P RSMH  ++P +  EG  +   AI   LVDG P 
Sbjct: 81  PQRSMHGSKLPSVTNEG--IPKDAIEYCLVDGTPA 113

>Suva_6.281 Chr6 complement(493400..495241) [1842 bp, 613 aa] {ON}
           YJL201W (REAL)
          Length = 613

 Score = 28.9 bits (63), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 19  YRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLILVADTREEVVELLKGDIY 78
           YR +  ++I + +Q      + A+  +L+  KPG +   ++ L    R   ++L + DIY
Sbjct: 206 YRQLIFDKIFKKLQ------SDALMCELIFQKPGNYKKVNIFLDIIKRNNYIDLSQWDIY 259

Query: 79  AKEGVW 84
           +   VW
Sbjct: 260 SLASVW 265

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 28.5 bits (62), Expect = 3.2,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 7/68 (10%)

Query: 31  VQEGKIVVAGAIYKDL------VDGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVW 84
           VQ+GK V   A+ K++       DG+       H I +A  R E++  +   I  K   W
Sbjct: 481 VQQGKRVTQLAV-KNVKYVSWSQDGQYVALMSKHTITLATKRLELINSMHETIRIKSAAW 539

Query: 85  DMDNILIF 92
           D   +LI+
Sbjct: 540 DETGVLIY 547

>Smik_10.30 Chr10 (52681..54477) [1797 bp, 598 aa] {ON} YJL201W
           (REAL)
          Length = 598

 Score = 28.1 bits (61), Expect = 3.7,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 19  YRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLILVADTREEVVELLKGDIY 78
           YR +  ++I + +Q        A+  +L+  KPG +   ++ L    R   ++L + DIY
Sbjct: 191 YRQLVFDKIFKKLQND------ALLCELIFQKPGNYKKVNIFLDIIKRNNYIDLSQWDIY 244

Query: 79  AKEGVW 84
           +   VW
Sbjct: 245 SLASVW 250

>YJL201W Chr10 (54379..56178) [1800 bp, 599 aa] {ON}
           ECM25Non-essential protein of unknown function; promoter
           contains a consensus binding sequence for factor Abf1p
          Length = 599

 Score = 28.1 bits (61), Expect = 3.7,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 19  YRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLILVADTREEVVELLKGDIY 78
           YR +  ++I + +Q        A+  +L+  KPG +   ++ L    R   ++L + DIY
Sbjct: 191 YRQLVFDKIFKKLQND------ALLCELIFQKPGNYKKVNIFLDIIKRNNYIDLSQWDIY 244

Query: 79  AKEGVW 84
           +   VW
Sbjct: 245 SLASVW 250

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 28.1 bits (61), Expect = 4.0,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 31  VQEGKIVVAGAIYKDL------VDGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVW 84
           VQ+GK +   A+ K++      +DG+       H I +A  + E++  +   I  K   W
Sbjct: 481 VQQGKKIAQLAV-KNVKYVSWSLDGQYVALMSKHTITLATKKLELINSMHETIRIKSAAW 539

Query: 85  DMDNILIF 92
           D   +LI+
Sbjct: 540 DESGVLIY 547

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 28.1 bits (61), Expect = 4.5,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 19/45 (42%)

Query: 48  DGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVWDMDNILIF 92
           DG+       H I +   R E+V  +   I  K   WD   ILI+
Sbjct: 503 DGQYIALMSKHTITIVTKRLELVNSMHETIRIKSAAWDESGILIY 547

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 27.7 bits (60), Expect = 6.0,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 19/46 (41%)

Query: 47  VDGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVWDMDNILIF 92
           +DG+       H I     R E++  +   I  K   WD   +LI+
Sbjct: 502 LDGQYAALMSKHTITTVTKRLELINSMHDTIRIKSACWDETGVLIY 547

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 27.7 bits (60), Expect = 6.3,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 31  VQEGKIVVAGAIYKDL------VDGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVW 84
           VQ+GK V   A+ K++      +DG+       H I +A  + E++  +   I  K   W
Sbjct: 481 VQQGKKVSQLAV-KNVKYVSWSLDGQYVALMSKHTITLATKKLELINSMHETIRIKSAAW 539

Query: 85  DMDNILIF 92
           D   +LI+
Sbjct: 540 DETGVLIY 547

>Skud_10.14 Chr10 (28693..30492) [1800 bp, 599 aa] {ON} YJL201W
           (REAL)
          Length = 599

 Score = 27.3 bits (59), Expect = 6.7,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 41  AIYKDLVDGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVW 84
           A+  +L+  KPG +   ++ L    R   ++L + DIY+   VW
Sbjct: 207 AVICELIFQKPGNYKKVNIFLDIIKRNNYIDLSQWDIYSLASVW 250

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 27.3 bits (59), Expect = 7.0,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 19/45 (42%)

Query: 48  DGKPGGFAGSHLILVADTREEVVELLKGDIYAKEGVWDMDNILIF 92
           DG+       H I +   R E++  +   I  K   WD   +L++
Sbjct: 503 DGQYAALMSKHTITITTKRLELINSMHETIRIKSACWDETGVLVY 547

>KNAG0C02150 Chr3 (421035..422975) [1941 bp, 646 aa] {ON} Anc_1.133
           YJL201W
          Length = 646

 Score = 27.3 bits (59), Expect = 8.8,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 19  YRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLILVADTREEVVELLKGDIY 78
           YR +  ++I + +Q   I ++      L+  KPG +   ++ L A  R   ++L + DIY
Sbjct: 205 YRQLIFDKIFKKLQNQAIEIS------LIFQKPGSYKKVNIFLEAMERNNYIDLSQWDIY 258

Query: 79  AKEGVW 84
           +   V+
Sbjct: 259 SLASVF 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.141    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,074,256
Number of extensions: 408093
Number of successful extensions: 895
Number of sequences better than 10.0: 37
Number of HSP's gapped: 877
Number of HSP's successfully gapped: 37
Length of query: 103
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 29
Effective length of database: 44,996,115
Effective search space: 1304887335
Effective search space used: 1304887335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)