Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43827.194ON31131116670.0
ADL120C7.194ON31131115340.0
KLLA0D16170g7.194ON30731613560.0
SAKL0F07458g7.194ON31531813390.0
KLTH0E04598g7.194ON32827413020.0
Kwal_55.203807.194ON32332313010.0
TDEL0H025307.194ON31130912461e-173
CAGL0J02420g7.194ON31231312331e-171
KAFR0A026507.194ON31231212331e-171
Suva_9.1787.194ON31932212341e-171
Skud_9.1487.194ON31832212311e-171
YIL021W (RPB3)7.194ON31832212281e-171
TBLA0J015207.194ON33530112281e-170
NDAI0G020007.194ON31130912211e-170
Smik_9.1697.194ON31832212211e-170
ZYRO0D15796g7.194ON30831212171e-169
NCAS0E018307.194ON31831812151e-169
Kpol_1063.117.194ON31631612081e-168
TPHA0C045107.194ON31031111831e-164
KNAG0H027007.194ON32627311601e-160
Kpol_1018.1393.428ON3352952736e-27
TPHA0D039203.428ON3352912533e-24
Kpol_473.33.428ON3202972524e-24
ZYRO0C12364g3.428ON3352942525e-24
KNAG0A076003.428ON3342932472e-23
ADR031C3.428ON3642932473e-23
KAFR0A055203.428ON3342972446e-23
TDEL0F031003.428ON3352952439e-23
NCAS0A115203.428ON3352982402e-22
Smik_16.3533.428ON3352952384e-22
YPR110C (RPC40)3.428ON3352912375e-22
NDAI0A047703.428ON3352962375e-22
Suva_16.4383.428ON3352912376e-22
TBLA0F017003.428ON3332922366e-22
Skud_16.3973.428ON3352922367e-22
Ecym_44503.428ON3342952351e-21
KLTH0F12056g3.428ON3502832341e-21
SAKL0F06028g3.428ON3342932332e-21
KLLA0D14861g3.428ON3342882323e-21
Kwal_23.39983.428ON3342932288e-21
CAGL0B04125g3.428ON3342932131e-18
KNAG0I018802.246ON451147685.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4382
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   646   0.0  
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   595   0.0  
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   526   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   520   0.0  
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   506   0.0  
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   505   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   484   e-173
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   479   e-171
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   479   e-171
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   479   e-171
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   478   e-171
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   477   e-171
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   477   e-170
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   474   e-170
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   474   e-170
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   473   e-169
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   472   e-169
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   469   e-168
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   460   e-164
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   451   e-160
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...   109   6e-27
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...   102   3e-24
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...   101   4e-24
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...   101   5e-24
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...   100   2e-23
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...   100   3e-23
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    99   6e-23
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    98   9e-23
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    97   2e-22
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    96   4e-22
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    96   5e-22
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    96   5e-22
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    96   6e-22
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    96   6e-22
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    96   7e-22
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    95   1e-21
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    95   1e-21
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    94   2e-21
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    94   3e-21
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    92   8e-21
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    87   1e-18
KNAG0I01880 Chr9 (368947..370302) [1356 bp, 451 aa] {ON} Anc_2.2...    31   5.4  

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300
           DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300

Query: 301 DNTNTAYDDAW 311
           DNTNTAYDDAW
Sbjct: 301 DNTNTAYDDAW 311

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/311 (90%), Positives = 297/311 (95%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIE+NTSVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFISHRLGL+PLQSKDIDQLVYCRDC+CEDHCDRCSV+LTL AVGESESTTNVYAKDLQI
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VSDLGGKNIGHPIIQDKEANG+L+CKLRKGQELRLKCVAKKGI+KEHAKWSPAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKL+HTDYW EQD  +EWPHSKNCEFEDP N+DD FDYSAKPN FY+NVESVGSI S
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300
           DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPT + APMEVD DPYS T+G++NEYN
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYSATSGRFNEYN 300

Query: 301 DNTNTAYDDAW 311
           DN + AYDDAW
Sbjct: 301 DNAHAAYDDAW 311

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/316 (79%), Positives = 275/316 (87%), Gaps = 14/316 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDL+LANSLRR+MI+EIPTLAIDSVEIETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DIDQ+VYCRDCYCEDHCDRCSV L L A+GESESTTNVYAKDLQI
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
            SDL G+NIGHPIIQD+EANG+L+CKLRKGQE+R+KC+AKKGISKEHAKWSP+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQDA  EWP SKNCEFEDP N+D+ FDY AKPN FYINVESVGSITS
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGP-----TSENAPMEVDHDPYSGTNGQ 295
           +QVV+RGIKTLQDKVADILFSLKKMDQ+KV F         S+  PME D DPY G  G 
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGAVSTHVSQQVPMEEDMDPYGGPVG- 299

Query: 296 YNEYNDNTNTAYDDAW 311
                    + YDDAW
Sbjct: 300 --------GSGYDDAW 307

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/318 (77%), Positives = 281/318 (88%), Gaps = 10/318 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           M+EEGPQVKIREATKD+VDFILSNVD++LANS RR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+ LVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+LKC+AKKGISKEHAKWSPA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQD  +EWP SKNCE+EDP N+DDVFDY+AKPN FY++VE+VGS+TS
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGP--TSENAPMEVD-----HDPYSGTN 293
           DQVVIRGIKTLQDKVADILFSLKKMDQ++V FGG    ++N  + +D      DPY+   
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300

Query: 294 GQYNEYNDNTNTAYDDAW 311
            Q   YN   +  +DDAW
Sbjct: 301 DQ---YNGGPSAGFDDAW 315

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/274 (86%), Positives = 259/274 (94%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+++ANSLRR+MIAEIPTLAIDSVE+ETNTSVLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFISHRLGLIPLQS DI+ L+YCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDK+ NG+L+CKLRKGQEL+LKCVAKKGISKEHAKWSPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW E DA +EWP SKNCE+EDP N+D+ FDY+AKP  FY+NVE+VGS+T 
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGG 274
           DQVVIRG+KTLQDKVADILFSLKKMDQDKV FGG
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGG 274

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/323 (75%), Positives = 275/323 (85%), Gaps = 12/323 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+++ANSLRR+MIAEIPT+AIDSVE+ETNTSVLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFISHRLGL+PLQS DI+ L+YCRDCYCED+CDRCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDK+ANG+L+CKLRKGQEL+LKCVAKKGI+KEHAKWSPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW E DA +EWP SKNCE+EDP N+DD FDY AKP  FY+NVESVGS+T 
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPT--SENAPMEVDHDPYSGTNGQYNE 298
           DQVVIRG+KTLQDKVADILFSLKKMDQDKV FGG    +E     +  +P SG       
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESGFGYGNGG 300

Query: 299 ----------YNDNTNTAYDDAW 311
                     +N   ++ +DDAW
Sbjct: 301 AGGGPGAGDFHNSGPSSGFDDAW 323

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  484 bits (1246), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 259/309 (83%), Gaps = 11/309 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSE GPQVKIREATKDNVDFILS VDL++ANSLRRIM+AEIPTLAIDSVEIETNT+VLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL YCRDC+CEDHCD+CSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL +KCVAKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQD + EWP SKN E+EDP N DD FDY AK N FY+NVE+VGSI +
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEV-----------DHDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQ++V FG   +  A  +            D +PY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300

Query: 290 SGTNGQYNE 298
           S   G Y+E
Sbjct: 301 SNGGGAYDE 309

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  479 bits (1233), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/313 (72%), Positives = 263/313 (84%), Gaps = 3/313 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREAT+DNVDFILSNVDL+LANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EF++HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKL+HTDYW+E+D   EWP SKNCE+EDP NDD+ FDY AK + FY+NVE+VGSI  
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300
           DQVV+RGI TLQ KVA I+ +L +MDQ+KV F    ++   +E D D     NG    Y 
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMM-MNGHDGPYG 299

Query: 301 DNTNTA--YDDAW 311
           DN  ++  Y  AW
Sbjct: 300 DNGRSSDTYGSAW 312

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  479 bits (1233), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/312 (73%), Positives = 264/312 (84%), Gaps = 1/312 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L C+AKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHT+YW+EQD   EWP+SKNCE+EDP N++D FDY AK + FY+NVE+VGSI+ 
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-GPTSENAPMEVDHDPYSGTNGQYNEY 299
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV +  G T++    ++            N  
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYSNMP 300

Query: 300 NDNTNTAYDDAW 311
           N N N  YD+AW
Sbjct: 301 NSNANGIYDNAW 312

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  479 bits (1234), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 266/322 (82%), Gaps = 14/322 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREA+KDNVDFIL++VDL++ANSLRRIMIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHP+IQDKE NG+L+CKLRKGQEL+L CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQD+  EWP SKNCE+EDP N+ D FDY A+ + FY+NVESVGSIT 
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGG----------PTSENAPME-VDHDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F             T+E+  M   + DPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300

Query: 290 SGTNGQYNEYNDNTNTAYDDAW 311
           +  +   N     ++  YD+AW
Sbjct: 301 ANASQMGNT---GSSGGYDNAW 319

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  478 bits (1231), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/322 (70%), Positives = 263/322 (81%), Gaps = 15/322 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREA+KD VDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQD+  EWP SKNCE+EDP N+ D FDY A+ + FY+NVESVGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAP-----------MEVDHDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F    +  AP              + DPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAEQDPY 300

Query: 290 SGTNGQYNEYNDNTNTAYDDAW 311
           S      ++  +  ++ YD+AW
Sbjct: 301 SNA----SQMGNTGSSGYDNAW 318

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  477 bits (1228), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/322 (70%), Positives = 262/322 (81%), Gaps = 15/322 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQD+  EWP SKNCE+EDP N+ D FDY A+ + FY+NVESVGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----------GPTSENAPMEVDHDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F            G   +      + DPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300

Query: 290 SGTNGQYNEYNDNTNTAYDDAW 311
           S      ++  +  +  YD+AW
Sbjct: 301 SNA----SQMGNTGSGGYDNAW 318

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  477 bits (1228), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 256/301 (85%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQ+KIREATKDNVDFILSN+D++LANSLRR+MIAEIPTLAIDSVE+E NT+VLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFISHRLGLIPLQS DIDQL YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL++ CVAKKGI+KEHAKW   AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+E D   EWPHSKNC++EDP  + ++FDY AK N FY+NVE+VGSIT+
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300
           DQV+IRGI TLQ K A IL +L +M+Q+KV FG  T +N  +    D    +NG    Y 
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTGTQDNNDLHQQDDHMGMSNGNDASYG 300

Query: 301 D 301
           +
Sbjct: 301 N 301

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  474 bits (1221), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 227/309 (73%), Positives = 260/309 (84%), Gaps = 8/309 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSN+DL+LANS RR+MIAEIPTLAIDSV+IETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQD   EWP+SKNCE+EDP N+ + FDY AK   FY+NVE+VGSI+ 
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-------GPTSENAPMEVDHDPYS-GT 292
           DQVV+RGI TLQ KVA IL +L +MDQ+K+ +        G    N  +++D D Y+ G 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMMNQDVDMDGDAYANGA 300

Query: 293 NGQYNEYND 301
           N Q   YND
Sbjct: 301 NNQPGAYND 309

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  474 bits (1221), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/322 (71%), Positives = 264/322 (81%), Gaps = 15/322 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQD+  EWP SKNCE+ED  N+ D FDY A+ + FY+NVESVGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGG----------PTSENAPME-VDHDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F             T+E+  M   + DPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAEQDPY 300

Query: 290 SGTNGQYNEYNDNTNTAYDDAW 311
           S      ++  ++ +  YD AW
Sbjct: 301 SNA----SQMGNSGSGGYDSAW 318

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  473 bits (1217), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 261/312 (83%), Gaps = 5/312 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREAT++NVDFILS+V+L++ANSLRR+MIAEIPTLAIDSVE+ETNTSVLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL YCRDC+CEDHCD+CSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+N+GHPIIQDKE NG+L+CKLRKGQEL LKCVAKKGI+KEHAKW P+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHT+YW EQD   EWP SKN E+EDP N+ + FDY A  N FY+NVESVGS+++
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300
           DQVV+RGI TLQ KVA IL +L +MDQDKV F    +  APM    D  +  NG    Y 
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNF----ASGAPMGAVGDGDTMMNGDDYPYG 296

Query: 301 DNTNTA-YDDAW 311
               +  YDD+W
Sbjct: 297 ATGGSGVYDDSW 308

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  472 bits (1215), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/318 (71%), Positives = 262/318 (82%), Gaps = 7/318 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSE GPQVKIREATKDNVDFILSNVDL+LANS RR+MIAEIPTLAIDSV+IETNT+VLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQD+E NG+L+CKLRKGQEL++ C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTDYW+EQDAT EWP+SKNCE+EDP N+ ++FDY AK   FY+NVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAF-----GGPTSENAPMEVDHDPYSGTNGQ 295
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV F     G    E      D+D       +
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREGMMNGGDNDVNMDGGME 300

Query: 296 YNEYND--NTNTAYDDAW 311
            N Y +  N   AYD+AW
Sbjct: 301 QNSYANVANPGGAYDNAW 318

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  469 bits (1208), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 228/316 (72%), Positives = 262/316 (82%), Gaps = 5/316 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILS+VD++LANSLRR+MIAEIPTLAIDSVE+ TNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L C+AKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHTD+WFEQD   EWP SKNCE+EDP ++ +VFDY A+ + F    E+VG+I+S
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENA-PMEVDHDPYSGTNG----Q 295
           DQVV+RGI TLQ KVA IL +L +MDQDKV + G T+  A  ME + D   G  G     
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEGNGDINMGGTGNDPYS 300

Query: 296 YNEYNDNTNTAYDDAW 311
            N      N  YDDAW
Sbjct: 301 NNGGEMGGNGVYDDAW 316

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  460 bits (1183), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 214/311 (68%), Positives = 259/311 (83%), Gaps = 1/311 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           MS+EGPQVKIREATKDNVDFI+SNVDL++AN+ RR+MIAEIPTLAIDSVE+ +NT+VLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA+GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VSDL G+NIGHPIIQDKE NG+L+CKLRKGQEL+  C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHT+YW+EQDA  EWP SKNCE+EDP N+   FDY AK + FY+NVE++G++TS
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300
           DQV++RGI  LQ KVA IL +L ++DQDKV +    +     E+D +  +    + + Y 
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDKVNY-AGNNNVNNGEMDGEDITMNGTENDPYA 299

Query: 301 DNTNTAYDDAW 311
              N +YD AW
Sbjct: 300 SGNNNSYDGAW 310

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  451 bits (1160), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 204/273 (74%), Positives = 243/273 (89%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           M+EEGPQVKIREA +DNVDFILSNV+L++ANSLRR+M+AEIPTLAIDSV++ETNT+VLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120
           EFI+HRLGLIPLQS DI++L YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL++ C+AKKGI+KEHAKW P +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240
           DPWNKLKHT YW+E DA  EWP+S+NCE+EDP  + + FDY +K   FY+NVE++GSI+ 
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG 273
           DQVV+RGI TLQ KVA IL SL +M+Q+K  F 
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFA 273

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score =  109 bits (273), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 142/295 (48%), Gaps = 59/295 (20%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHR 66
           ++ I        +F L N+D S+AN+ RRIMI+E+P++A++ V    NTSVL DE ++HR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------ST 110
           +GL+PL+  D D L +      E+    D  ++VL+L                       
Sbjct: 101 IGLVPLKV-DPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLQIVSDLGGKNI----GHPIIQDKEANG-ILVCKLRKGQELRLKCVAKKGISK 165
           +NVYA+DL+   +  GK +     +P++    AN  IL+CKLR GQE+ LK     GI  
Sbjct: 160 SNVYARDLKF--EPQGKQVESFANYPVVP---ANPDILLCKLRPGQEISLKAHCILGIGS 214

Query: 166 EHAKWSPAAAIEFEYDPWNKL----------KHTDYW-------------FEQDA---TS 199
           +HAK+SP A   +   P   +          K   Y+             + +DA   T 
Sbjct: 215 DHAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTV 274

Query: 200 EWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
                ++ EFE  +    V ++      F +NVES G++T +++  + ++ L++K
Sbjct: 275 SREVFRHPEFEGKVKLGRVRNH------FIVNVESTGAMTPEEIFFKSVRILRNK 323

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score =  102 bits (253), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 140/291 (48%), Gaps = 53/291 (18%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           + I   T+   +F L ++D S+AN+ RRIMIAE+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  IHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYC--EDHCDRCSVVLTLQAV------GESEST--------T 111
           GLIPL+  D D+L +        E   D  ++V+TL A          ++T         
Sbjct: 102 GLIPLRV-DPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVLYRNA 160

Query: 112 NVYAKDLQIVSDLGGKNIGHPIIQDKEA--NGILVCKLRKGQELRLKCVAKKGISKEHAK 169
           +VYA+DL+   +  GK       Q  EA    IL+ KLR GQE+ L+     GI  +HAK
Sbjct: 161 HVYARDLKF--EPQGKQAELFADQPVEAIDPDILIAKLRPGQEISLRAHCILGIGGDHAK 218

Query: 170 WSPAAAIEFEYDP---------------WNK--------LKHTDYWFEQDA---TSEWPH 203
           +SP A   +   P               + K        +   D  F +DA   T     
Sbjct: 219 FSPVATASYRLLPHINITSPISGESAKRFQKCFPSGVIGINDKDEAFVKDARKDTVSREV 278

Query: 204 SKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
            ++ EF++ +    V D+      F  NVES G++T +++  + ++ L++K
Sbjct: 279 LRHEEFQNKVKLGRVRDH------FVFNVESTGAMTPEEIFFKSVRILKNK 323

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score =  101 bits (252), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 143/297 (48%), Gaps = 57/297 (19%)

Query: 4   EGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFI 63
           E  ++ I +  +   +  L NVD S+AN+LRRIMI+E+P++A + + I  NTSV+ DE I
Sbjct: 24  ENLEINISKVGERETNLDLINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVI 83

Query: 64  SHRLGLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE------------- 108
           + R+GLIPL+  D D+L +  +   ED    D  ++VL+L                    
Sbjct: 84  AQRIGLIPLKV-DPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSIL 142

Query: 109 -STTNVYAKDLQIVSDLGGKN----IGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGI 163
               ++YA+DL+   +  GK        P++       IL+ KLR GQE+ L+     GI
Sbjct: 143 YHNAHIYARDLKF--EPQGKQEETFADSPVVSADP--DILIAKLRPGQEISLRAHCILGI 198

Query: 164 SKEHAKWSPAAAIEFEYDP----WNKLK-------------------HTDYWFEQDA--- 197
             +HAK+SP     +   P      K+K                     D  + +DA   
Sbjct: 199 GADHAKFSPVCTASYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARKD 258

Query: 198 TSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
           T      ++ EF+D +  D V ++      F  N+E+VG+++++++ ++ +K L++K
Sbjct: 259 TMTREVLRHEEFQDKVKLDRVRNH------FIFNIETVGAMSAEEIFLKSVKILKNK 309

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score =  101 bits (252), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 137/294 (46%), Gaps = 58/294 (19%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           V+I   T+   +F L +VD S+AN+ RRIMI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D D L +      E+    D  ++V+TL                       +
Sbjct: 102 GLVPLKV-DPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           ++YA+DL+   +  G  +      P+I       IL+ KLR GQE+ L+     G+  +H
Sbjct: 161 HIYARDLKF--EPQGSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWSPAAAIEFEYDPWNKLKH------------------------TDYWFEQDA---TSE 200
           AK+SP A   +   P   ++                         TD  + QDA   T  
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 201 WPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
               ++ EF + +    V D+      F  NVES G++T +++  + ++ L++K
Sbjct: 277 REVLRHEEFSNKVKLGRVRDH------FVFNVESTGAMTPEEIFFKSVRVLKNK 324

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 99.8 bits (247), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 133/293 (45%), Gaps = 57/293 (19%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           +KI   ++   +F L ++D S+AN+ RRIMI+E+P++A + V +  NTSV+ DE ++HR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D D L +      E+    D  +VVLTL                       +
Sbjct: 102 GMIPLKV-DPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           +VYA+DL+   +  GK +      P++       IL+ KLR  QE+ L+     GI  +H
Sbjct: 161 SVYARDLRF--EPQGKQLETFADCPVVPSDP--DILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDPWNKL---------KHTDYWFEQDATSEWPHSKNC----------- 207
           AK+SP A   +   P   +         K     F Q         K             
Sbjct: 217 AKFSPVATASYRLLPHINILEPITGESAKRFQACFPQGVIGIDSEGKAVVENARKDTVSR 276

Query: 208 ------EFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
                 EF+D +    V D+      F  NVES G++T +++  + ++ L++K
Sbjct: 277 EVLRYEEFKDKVKLGRVRDH------FIFNVESTGAMTPEEIFFKSVRILKNK 323

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 99.8 bits (247), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 133/293 (45%), Gaps = 57/293 (19%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           V+I+   +   +F L  VD S+AN+ RRIMI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSKDIDQLVYCRDCY--CEDHCDRCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D D L +        E   D  +VVL+L                  E     
Sbjct: 132 GLVPLKV-DPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           ++YA+DL+   +  GK +      P++       IL+ KLR GQE+ L+     GI  +H
Sbjct: 191 HIYARDLKF--EPQGKQLETFAKCPVVPADP--DILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWSPAAAIEFEYDPW-----------------------NKLKHTDYWFEQDA---TSEW 201
           AK+SP A   +   P+                         +      F QDA   T   
Sbjct: 247 AKFSPVATASYRLMPYINIVEPITGPDAEKFVKCFPPGVAAINEKGEAFVQDARKDTVSR 306

Query: 202 PHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
              ++ E E  +    V D+      F  NVES G++T +++  + ++ L++K
Sbjct: 307 EVLRHPELEQKVKLGRVRDH------FIFNVESAGAMTPEEIFFKSVRILKNK 353

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 98.6 bits (244), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 135/297 (45%), Gaps = 65/297 (21%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           VKI    +   +F L ++D S+AN+ RRIMI+E+P +A++ V    NTSV+ DE ++HR+
Sbjct: 42  VKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D D L +      +D    D  ++VLTL                       +
Sbjct: 102 GLVPLKV-DPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNILYRNS 160

Query: 112 NVYAKDLQIVSDLGGKNIGHPIIQDKEANG--------ILVCKLRKGQELRLKCVAKKGI 163
           NVYA DL+   +  GK +      +  AN         IL+ KLR GQE+ L+     GI
Sbjct: 161 NVYASDLKF--EPQGKQV------ETFANNAVVPCDPKILLAKLRPGQEISLRAHCILGI 212

Query: 164 SKEHAKWSPAAAIEFEYDP---------------WNK--------LKHTDYWFEQDA--- 197
             +HAK+SP A   +   P               + K        +K     + QD+   
Sbjct: 213 GSDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQDSRKD 272

Query: 198 TSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
           T      ++ EF   +    + D+      F  NVES G++T +++  + ++ L++K
Sbjct: 273 TVSREVYRHEEFNGKVKLGRIRDH------FVFNVESTGAMTPEEIFFKSVRILKNK 323

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 98.2 bits (243), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 134/295 (45%), Gaps = 60/295 (20%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           V+I   T+   +F L ++D S+AN+ RRIMI+E+P+LA + V    NTSV+ DE ++HR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D D L +      E+    D  ++VLTL                       +
Sbjct: 102 GLVPLKV-DPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLQI-----VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKE 166
           +VYA DL+       ++L  K    P   D     IL+ KLR GQE+ L+     G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWSPAAAIEFEYDPWNKL------------------------KHTDYWFEQDA---TS 199
           HAK+SP A   +   P   +                        + T     +DA   T 
Sbjct: 216 HAKFSPVATASYRLLPHINITKPITGESAKKFQKCFSPGVIDIDESTGEAVVKDARRDTV 275

Query: 200 EWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
                ++ EF D +    V D+      F  NVES G++T +++  + ++ L++K
Sbjct: 276 SREVLRHEEFADSVKLGRVRDH------FIFNVESTGAMTPEEIFFKSVRILKNK 324

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 97.1 bits (240), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 86/298 (28%), Positives = 139/298 (46%), Gaps = 64/298 (21%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHR 66
           +V+I    +   +F L N+D S+AN+ RRIMI+E+P +A + V    NTSV+ DE ++HR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSKDIDQLVYCRDCYC--EDHCDRCSVVLTLQAV------GESEST-------- 110
           +GLIPL+  D D L +  +     E   D  ++VLTL            ++T        
Sbjct: 101 IGLIPLKV-DPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 111 TNVYAKDLQIVSDLGGKNI----GHPII---QDKEANGILVCKLRKGQELRLKCVAKKGI 163
           ++VYA DL+   +  GK I    G P++   QD     IL+ KLR GQE+ L+     G 
Sbjct: 160 SSVYASDLKF--EPQGKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGT 212

Query: 164 SKEHAKWSPAAAIEFEYDPWNKLKH------------------------TDYWFEQDA-- 197
             +HAK+SP +   +   P   +                          +   F +DA  
Sbjct: 213 GGDHAKFSPVSTASYRLLPHINITKPIKGELAEKFQKCFLPGVIGIDNASGEAFVKDARK 272

Query: 198 -TSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
            T      ++ EF D +    + D+      F  NVES G++T +++  + ++ L++K
Sbjct: 273 DTVSREVLRHEEFNDKVKLGRIRDH------FIFNVESTGAMTPEEIFFKSVRILKNK 324

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 96.3 bits (238), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 139/295 (47%), Gaps = 58/295 (19%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHR 66
           +V I        +F L N+D S+AN+ RRIMI+E+P++A + V    NTSV+ DE ++HR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D D L +      +D    D  ++VL+L                  E  + 
Sbjct: 101 IGLVPLKV-DPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLQIVSDLGGKN----IGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKE 166
            +VYA+DL+   +  GK        P++       IL+ KLR GQE+ LK     GI  +
Sbjct: 160 AHVYARDLKF--EPQGKQSTTFADFPVVPADP--DILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWSPAAAIEFEYDPW-NKLK----HTDYWFEQ---------DATSEWPHSKNC----- 207
           HAK+SP +   +   P  N L+     +   F++         D +S+  + K+      
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 208 --------EFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
                   EF D +    V ++      F  NVES G++T +++  + ++ L++K
Sbjct: 276 SREVLRYDEFADKVKLGRVRNH------FIFNVESAGAMTPEEIFFKSVRILKNK 324

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 95.9 bits (237), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 133/291 (45%), Gaps = 50/291 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHR 66
           +V I        +F L N+D S+AN+ RRIMI+E+P++A + V    NTSV+ DE ++HR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D D L +      +D    D  ++VL+L                  E  + 
Sbjct: 101 IGLVPLKV-DPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLQIVSDLGGKNIGH---PIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
            +VYA+DL+     G ++      P++       IL+ KLR GQE+ LK     GI  +H
Sbjct: 160 AHVYARDLKF-EPQGRQSTTFADCPVVPADP--DILLAKLRPGQEISLKAHCILGIGGDH 216

Query: 168 AKWSPAAAIEFEYDPWNKL------------------------KHTDYWFEQDATSEWPH 203
           AK+SP +   +   P   +                        + +D  + +DA  +   
Sbjct: 217 AKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVS 276

Query: 204 SKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
            +   +E+     D        N F  NVES G++T +++  + ++ L++K
Sbjct: 277 REVLRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 95.9 bits (237), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 139/296 (46%), Gaps = 58/296 (19%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           V+I   ++   +F L N+D S+AN+ RRIMI+E+P++A + V   TNTSV+ DE ++HR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D D L +      E+    D  +VV++L                       +
Sbjct: 102 GMIPLKV-DPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           +VYAKDL+   +  GK +      P++       IL+ KLR  QE+ L+     G+  +H
Sbjct: 161 SVYAKDLKF--EPQGKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWSPAAAIEFEYDPW-NKLK-----------------------HTDYWFEQDA---TSE 200
           AK+SP +   +   P  N LK                        T   + +DA   T  
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 201 WPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDKVA 256
               ++ EF D +    + D+      F  NVES G++T +++  + ++ L++K +
Sbjct: 277 REVLRHEEFNDKVKLGRIRDH------FIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 95.9 bits (237), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 50/291 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHR 66
           +V I      + +F L N+D S+AN+ RRIMI+E+P +A + V    NTSV+ DE ++HR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAV------GESEST-------- 110
           +GL+PL+  D D L +      +D    D  +VVL+L            +ST        
Sbjct: 101 IGLVPLKV-DPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLQIVSDLGGKNIGH---PIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
            +VYA+DL+     G ++      P++       IL+ KLR GQE+ LK     G+  +H
Sbjct: 160 AHVYARDLKFEPQ-GRQSTTFANCPVLPADP--DILLAKLRPGQEISLKAHCILGVGGDH 216

Query: 168 AKWSPAAAIEFEYDPWNKL------------------------KHTDYWFEQDATSEWPH 203
           AK+SP +   +   P   +                        + +D  + +DA  +   
Sbjct: 217 AKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTVS 276

Query: 204 SKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
            +   +E+     D        N F  NVES G++T +++  + ++ L++K
Sbjct: 277 REVLRYEE---FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 95.5 bits (236), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 135/292 (46%), Gaps = 56/292 (19%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           +KI    + +  F L N+D S+AN+ RRIM+AE+P +A + V    NTSV+ DE ++HR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D D L +      E+    D  ++VL+L                     +  
Sbjct: 102 GLVPLKV-DPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           +VYA+DL+   +  GK +      P++       IL+ KLR GQE+ L+     GI  +H
Sbjct: 161 HVYARDLKF--EPQGKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDPWNKL------KHTDYW----------------FEQDA---TSEWP 202
           AK+SP A   +   P   +      K  + +                + +DA   T    
Sbjct: 217 AKFSPVATASYRLLPHINITEPIRGKDAEKFQKCFTPGVIGIKDGEAYVKDARMDTVSRE 276

Query: 203 HSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
             ++ EF D +    V D+      F  NVES G++  +++  + ++ L++K
Sbjct: 277 VFRHQEFADKVKLGRVRDH------FVFNVESTGAMPPEEIFFKSVRILKNK 322

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 95.5 bits (236), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 137/292 (46%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHR 66
           +V I    +   +F L N+D S+AN+ RRIMI+E+P +A + V    NTSV+ DE ++HR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D D L +      +D    D  ++VL+L                  E  + 
Sbjct: 101 IGLVPLKV-DPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLQIVSDLGGKNIGHPIIQDKEANG-ILVCKLRKGQELRLKCVAKKGISKEHAK 169
            +VYA+DL+     G ++          A+  IL+ KLR GQE+ LK     GI  +HAK
Sbjct: 160 AHVYARDLKF-EPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAK 218

Query: 170 WSPAAAIEFEYDPW-NKLK----HTDYWFEQ---------DATSEWPHSKNC-------- 207
           +SP +   +   P  N L+     +   F++         D TS   + K+         
Sbjct: 219 FSPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSRE 278

Query: 208 -----EFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
                EF D +    V ++      F  NVES G++T +++  + ++ L++K
Sbjct: 279 VLRYEEFADKVKLGRVRNH------FIFNVESAGAMTPEEIFFKSVRILKNK 324

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 95.1 bits (235), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 135/295 (45%), Gaps = 61/295 (20%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           V+I        +F L ++D S+AN+ RRIMI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCY--CEDHCDRCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D D L +        E   D  +VV++L                  E  +  
Sbjct: 102 GLVPLKV-DPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           ++Y++DL+   +  GK +     HP++       IL+ KLR GQE+ L+     G+  +H
Sbjct: 161 HIYSRDLKF--EPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDH 216

Query: 168 AKWSPAAAIEFEYDPWNKLKHTDYWFEQDATSE---WPHS-------------------- 204
           AK+SP     +   P   +  T     +DAT     +P                      
Sbjct: 217 AKFSPVCTASYRLMPHIDILETIQG--EDATKFVKCFPPGVAAIDEKGEAYIKDARKDTV 274

Query: 205 -----KNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
                ++ EFE  +    V D+      F  NVES G++T +++  + ++ L++K
Sbjct: 275 SREVLRHPEFEGKVKLGRVKDH------FIFNVESTGAMTPEEIFFKSVRILKNK 323

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 94.7 bits (234), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 124/283 (43%), Gaps = 59/283 (20%)

Query: 19  DFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRLGLIPLQSKDID 78
           +F L NVD S+AN+ RRIMIAE+P++A + V    NTSV+ DE ++HR+GL PL+  D D
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLKV-DPD 127

Query: 79  QLVYCRDCY--CEDHCDRCSVVLTLQAVGESE--------------STTNVYAKDLQI-- 120
            L +        E   D  ++VLTL                        ++YA+DL+   
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 121 ---VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIE 177
                +   KN   P   D     IL+ KLR GQE+ L+     GI  +HAK+SP +   
Sbjct: 188 QGKQRETFAKNPVVPADPD-----ILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTAS 242

Query: 178 FEYDPWNKLKH-----------------------TDYWFEQDA---TSEWPHSKNCEFED 211
           +   P   +                             F +DA   T      ++ EFE 
Sbjct: 243 YRLMPHINITQPITGESAQRFAKCFSPGVIGINDNGEAFVKDARHDTVSREVLRHEEFEG 302

Query: 212 PLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
            +    V       N F  NVES G++T +++  + ++ L++K
Sbjct: 303 KVKLGRV------KNHFIFNVESAGAMTPEEIFFKSVRILKNK 339

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 133/293 (45%), Gaps = 57/293 (19%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           VKI    +   +F L ++D S+AN+ RRIMI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D D L +  +   E+    D  ++VLTL                       +
Sbjct: 102 GLVPLKV-DPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           N+YA+ L+   +  GK +      P++       IL+ KLR GQE+ L+     GI  +H
Sbjct: 161 NIYARHLKF--EPQGKQLETFAKSPVVPADP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDPWNK-----------------------LKHTDYWFEQDA---TSEW 201
           AK+SP     +   P                          +      + +DA   T   
Sbjct: 217 AKFSPVCTASYRLMPQINITEPITGESAKNLVRCFPPGVIGINEQGEAYVEDARKDTVSR 276

Query: 202 PHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
              ++ EFE  +    V D+      F  NVES G++T +++  + ++ L++K
Sbjct: 277 EVLRHEEFEGKVKLGRVRDH------FVFNVESAGAMTPEEIFFKSVRILKNK 323

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 136/288 (47%), Gaps = 47/288 (16%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           V+I    +  V+F L +VD S+AN+ RRIMI+E+P++A + V    NTSVL DE ++HR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCY--CEDHCDRCSVVLTLQ--------AVGESE------STT 111
           GL+PL+  D D L +        E   D  ++V++L         A  + E         
Sbjct: 102 GLVPLKV-DPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           ++YA+DL+   +  GK +      P++       IL+ KLR GQE+ L+     GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQVEQFAKCPVVAADP--DILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWSPAAAIEFEYDPWNKL---------KHTDYWFEQDATSEWPHSKNCEFEDPLND--- 215
           AK+SP +   +   P  ++         K     F +   ++         +DP  D   
Sbjct: 217 AKFSPVSTASYRLLPHIQITQPITGDDAKKFVKCFPK-GVADVNEKGEAYIKDPRKDTVS 275

Query: 216 -----DDVFDYSAK----PNIFYINVESVGSITSDQVVIRGIKTLQDK 254
                 D F    K     + F  NVES G++T +++  + ++ L++K
Sbjct: 276 REVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 92.4 bits (228), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 131/293 (44%), Gaps = 57/293 (19%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHRL 67
           V+I    +   +F L NVD S+AN+ RRIMI+E+P++A + V    NTSV+ DE ++HR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSKDIDQLVYCRDCY--CEDHCDRCSVVLTLQAVGESE--------------STT 111
           GL PL+  D D L +        E   D  ++VLTL                        
Sbjct: 102 GLTPLKV-DPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
           ++YA+DL+   +  GK +     +P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQLETFAKNPVVPADP--DVLLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDPWNKLKHT-----------------------DYWFEQDA---TSEW 201
           AK+SP     +   P   +                             + +DA   T   
Sbjct: 217 AKFSPVCTASYRLMPHINITSPITGESAQKFAKCFSPGVIGINDEGEAYVKDARHDTVSR 276

Query: 202 PHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
              ++ EFE  +    + D+      F  NVES G++T +++  + ++ L++K
Sbjct: 277 EVLRHEEFEGKVKLGRIRDH------FIFNVESAGAMTPEEIFFKSVRILKNK 323

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 132/293 (45%), Gaps = 57/293 (19%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLADEFISHR 66
           QV   E  + N D I   +D SLAN+ RRIMIAE+P +A + V I+ NTSV+ DE ++HR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQ--SKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESE--------------ST 110
           +GL+PL+   + +++L        E H D+ ++V+TL                     + 
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFH-DKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYAKDLQIV--SDLGGKNIGHPIIQ-DKEANGILVCKLRKGQELRLKCVAKKGISKEH 167
            +VYA+DL+    S         P++  D +   IL+ KLR GQE+ L      G  K+H
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCILGEGKDH 216

Query: 168 AKWSPAAAIEFEYDPWNKL---------KHTDYWFEQDA-----------------TSEW 201
           AK+SP A   +   P  ++         K     F +                   T   
Sbjct: 217 AKFSPVATASYRLLPHIEILEPITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDTVSR 276

Query: 202 PHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITSDQVVIRGIKTLQDK 254
              ++ EFE  +    V D+      F  NVES G++  + +V++ I  L+ K
Sbjct: 277 EVLRHEEFEGKVKLGRVRDH------FVFNVESTGAMQPEDIVLKSIDILKKK 323

>KNAG0I01880 Chr9 (368947..370302) [1356 bp, 451 aa] {ON} Anc_2.246
           YNL062C
          Length = 451

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 66/147 (44%), Gaps = 7/147 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60
           ++   P V  RE T DNV+  L+NV  S  N     + +EI  ++   +E     S+ ++
Sbjct: 94  LASSAPNVSTREGTADNVE--LANVKSSENNRDLINLGSEIQKMSASEIEELKKQSMSSN 151

Query: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAK-DLQ 119
           E IS    +I        + V+ ++ Y +    + +   T+  +  S     +  K D+Q
Sbjct: 152 EIISR---IIESHGSFDKKTVHSQEKYLKRKKQKFNKEFTIDYLSSSALLDFLIEKGDIQ 208

Query: 120 IVSDLGGKNIGHPI-IQDKEANGILVC 145
            V DL  + +G  + + +  ANG  +C
Sbjct: 209 RVLDLSEETMGMLLNLANVRANGTYLC 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,431,651
Number of extensions: 1588853
Number of successful extensions: 5034
Number of sequences better than 10.0: 51
Number of HSP's gapped: 5151
Number of HSP's successfully gapped: 52
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 65 (29.6 bits)