Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43807.196ON41841822280.0
ADL118C7.196ON41841817960.0
KLLA0D16214g7.196ON41841817420.0
SAKL0F07502g7.196ON41239717160.0
Kwal_55.203687.196ON41240516620.0
Kpol_1063.97.196ON41739516570.0
TDEL0H025107.196ON41841416470.0
TPHA0C045307.196ON41639616340.0
KLTH0E04554g7.196ON47938416380.0
Smik_9.1687.196ON43139716180.0
Suva_9.1777.196ON43540616140.0
Skud_9.1477.196ON43139716000.0
CAGL0J02442g7.196ON41240015930.0
YIL022W (TIM44)7.196ON43141015890.0
ZYRO0D15840g7.196ON40740515620.0
NDAI0B017807.196ON43439815480.0
NCAS0A125207.196ON43239815380.0
KNAG0H026907.196ON41942115050.0
KAFR0A026407.196ON42138714550.0
TBLA0J015007.196ON42139412971e-178
TPHA0G015108.696ON385164741.4
Kpol_1060.136.304ON95762722.7
KNAG0E01130singletonON13266648.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4380
         (418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   862   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   696   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   675   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   665   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   644   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   642   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   639   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   634   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   635   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   627   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   626   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   620   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   618   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   616   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   606   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   600   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   597   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   584   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   565   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   504   e-178
TPHA0G01510 Chr7 (307410..308567) [1158 bp, 385 aa] {ON} Anc_8.6...    33   1.4  
Kpol_1060.13 s1060 (35582..38455) [2874 bp, 957 aa] {ON} (35582....    32   2.7  
KNAG0E01130 Chr5 complement(220233..220631) [399 bp, 132 aa] {ON}      29   8.9  

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/418 (100%), Positives = 418/418 (100%)

Query: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIK 60
           MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIK
Sbjct: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIK 60

Query: 61  ALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTR 120
           ALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTR
Sbjct: 61  ALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTR 120

Query: 121 EVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRR 180
           EVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRR
Sbjct: 121 EVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRR 180

Query: 181 THAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISM 240
           THAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISM
Sbjct: 181 THAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISM 240

Query: 241 LRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVL 300
           LRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVL
Sbjct: 241 LRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVL 300

Query: 301 KQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQE 360
           KQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQE
Sbjct: 301 KQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQE 360

Query: 361 IHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           IHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT
Sbjct: 361 IHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/418 (80%), Positives = 380/418 (90%)

Query: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIK 60
           M +Y+A+KQ++ S   + + AR FS T  + NG KSPLQ+FRETFK+EWKKSQELQDNIK
Sbjct: 1   MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIK 60

Query: 61  ALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTR 120
           ALQDA GRLGESDAYKKAREAYLKAQ+GST+VGKTLK+TGET+E++TV+AW+S+IGK TR
Sbjct: 61  ALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTR 120

Query: 121 EVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRR 180
           + VSKTAQKLDESFEPVR T+VYKDMSE+IDDGESSRYGGF+ KE RR+KRE DLA+G+R
Sbjct: 121 KTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLATGKR 180

Query: 181 THAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISM 240
              VRSN+EAG+A+VAT+KE  ES GKKIQDFKEKT +GRKLHE KV+LWDENENPLI +
Sbjct: 181 ATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGL 240

Query: 241 LRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVL 300
           LRTISNK+GGLFAETESARVFAQFKLLDPTFN+EEFTKHLREYIIPEVLEAYVKGDE VL
Sbjct: 241 LRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVL 300

Query: 301 KQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQE 360
           KQW SEAPYNVY+AQQKQ R+QELF DGR+LDIRGVEI+SAKLLPPQDVPA+VVGCR QE
Sbjct: 301 KQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQE 360

Query: 361 IHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           IHL+RKA TGEIAAGHESNIM+SSYAMVLTRDPE V DKETEGWK+LEF+RGGSR FT
Sbjct: 361 IHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/418 (75%), Positives = 367/418 (87%)

Query: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIK 60
           ML+    +      +A+A   R F+ +  + +  +SPLQIFRETFK EW+KS+ELQDNIK
Sbjct: 1   MLRINGQQAMMHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIK 60

Query: 61  ALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTR 120
           ALQDASG+LGES+AYKKAREAY+KAQ+GST+VGKTLKKTGET+E +  KAWDS+I K+TR
Sbjct: 61  ALQDASGKLGESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTR 120

Query: 121 EVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRR 180
           +VV+KTA KLDESFEPVR T+VYKD+SE+IDDG+SSRYGGFI KE RR  +E  +ASG+R
Sbjct: 121 KVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKR 180

Query: 181 THAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISM 240
           + AV+SND AGTA+VATN E KESFGKKI+DFKEKT +GRKLHE K+KLWDE+ENPL+ M
Sbjct: 181 SRAVKSNDAAGTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVM 240

Query: 241 LRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVL 300
           LRT+S KIGGLFAETESARV+ QFK++DPTFN+E+FTKHLREYIIPE+LEAYVKGDE VL
Sbjct: 241 LRTVSGKIGGLFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVL 300

Query: 301 KQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQE 360
           KQW SEAPYNVYAAQQKQFREQELF DG++LDIRGVEIVSAKLLPPQD+P LVVGCR QE
Sbjct: 301 KQWFSEAPYNVYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQE 360

Query: 361 IHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           IHLYRKAKTGEIAAG ES+I+MSSYAMV TRDPE V DKETEGWK+LEF+RGGSRQFT
Sbjct: 361 IHLYRKAKTGEIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/397 (78%), Positives = 355/397 (89%)

Query: 22  RQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREA 81
           R  S+T     GQ+SPLQIFRETFK EW+KS+ELQDNIK LQDASG+LGESDAYKKAREA
Sbjct: 16  RTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREA 75

Query: 82  YLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTR 141
           YL+AQ+GST+VGKTLKKTGET+E++ VKAW+S++GK TR+ ++ TAQK+DESFEPVR T+
Sbjct: 76  YLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTK 135

Query: 142 VYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEG 201
           VYKD+SE+IDDGESSRYGGFI KE RR K+E DLASG+R  AV+SNDEAGTA+VATN E 
Sbjct: 136 VYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEA 195

Query: 202 KESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVF 261
           KESF KKI+DFKEKT  GRK+HE KV+LWDE+ENPLI +LRTI NK+GG+FAETESARV 
Sbjct: 196 KESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVM 255

Query: 262 AQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFRE 321
            QFK+LDP FN+E FTKHLREYIIPE+LEAYVKGDE VLKQW SEAPYNVYAAQQK FR+
Sbjct: 256 GQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRD 315

Query: 322 QELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIM 381
           QELF DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEIHLYRKAKTGEIAAG ESNI+
Sbjct: 316 QELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNIL 375

Query: 382 MSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           +SSYAMV TRDPENV DKETEGW++LEF+RGGSRQFT
Sbjct: 376 LSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/405 (75%), Positives = 350/405 (86%), Gaps = 1/405 (0%)

Query: 15  IAKAVPARQFSTTGLSWNGQ-KSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESD 73
           +   V +R+ S T  +  G  +SPLQIFRETFK EWKKSQELQDNIKALQDASG+LGESD
Sbjct: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67

Query: 74  AYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDES 133
           AYKKAREAYLKAQ+GST+VGKT+KKTG+++E +  KAW+S+I K+TR+ V+KTA KLDES
Sbjct: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127

Query: 134 FEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTA 193
           FEPVRHTRVYKD+SE+++ G SSRYGGFI KE RR K E D+ASG+R  AVRSNDEAGTA
Sbjct: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187

Query: 194 MVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFA 253
           +VATN E KESFGKK+ DFKEKT +GRKLH+ KVKLWDE+ENPLI +LRTI NKIGGLFA
Sbjct: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247

Query: 254 ETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYA 313
           ETESARV  QFK++D  FNSE F  HLREYIIPEVLEAYVKGDE VLKQW SEAPYNVYA
Sbjct: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307

Query: 314 AQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIA 373
           AQQK FREQ LF DGR+LDIRGV+IVSAKLL PQD+P LVVGCR QEIHLYR  KTGE+A
Sbjct: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367

Query: 374 AGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           AG +SNI+MSSYAMV TRDPE++ +KETEGWK+LEF+RGGSRQFT
Sbjct: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/395 (75%), Positives = 348/395 (88%)

Query: 24  FSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREAYL 83
           FST+     G ++P+QIFR+TFK EW+KS++LQDNIKALQDASGRLGES+AYKKAREAYL
Sbjct: 23  FSTSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEAYKKAREAYL 82

Query: 84  KAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTRVY 143
           KAQ+GST+VGKTL+KTGET+E++  KAWDS+IGK+TR+  S TA+K+DESFEPVR T+VY
Sbjct: 83  KAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESFEPVRKTQVY 142

Query: 144 KDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEGKE 203
           KD+S++IDDG+SSRYGGFI KE RR KRE DL SG+R  AV+SNDEAGT++VATN E KE
Sbjct: 143 KDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSIVATNIEAKE 202

Query: 204 SFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVFAQ 263
           S GKK++DFKE T  GR +H  KVKLWDENENPLI  LR +S KIGG FAETES+RV +Q
Sbjct: 203 SLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAETESSRVLSQ 262

Query: 264 FKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFREQE 323
           FKL+DPTF+++ FTKHLREYIIPEVLEAYVKGDE VLK+W SEAPYNVYAAQQK+FR+Q+
Sbjct: 263 FKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAAQQKEFRKQQ 322

Query: 324 LFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIMMS 383
           LFPDGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEIHLYRK KTGEIAAG ESNI+MS
Sbjct: 323 LFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAAGDESNILMS 382

Query: 384 SYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           SYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 383 SYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/414 (71%), Positives = 352/414 (85%), Gaps = 6/414 (1%)

Query: 5   AAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQD 64
           + I + R++G A       FST+  S    +SP+QIFR+TFK EWKKSQELQDNIK LQD
Sbjct: 11  SVIAEGRLAGRA------LFSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQD 64

Query: 65  ASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVS 124
           ASGRLGES+AYK+AREAY++AQ+GST+VGKTLKKTGET+EN+  KAWDS+I +NTRE  S
Sbjct: 65  ASGRLGESEAYKRAREAYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREAAS 124

Query: 125 KTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAV 184
           KTA+K+DE FEPVR T++YKD+SE++DDG SSRYGGFI KE RR KRE D+ SG+R  AV
Sbjct: 125 KTAKKIDEGFEPVRQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAV 184

Query: 185 RSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTI 244
           + N++AGTA+VAT+ E K+SFGKK++DFKEKT +GR LH  K  LWDE+ NPLI  LR I
Sbjct: 185 KGNEDAGTALVATDIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKI 244

Query: 245 SNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWL 304
           + KIGG FAETE+ARV  QFK++DPTF +E FT+HLREY+IPE+LEAYVKGDE VLK+W 
Sbjct: 245 TRKIGGFFAETEAARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWF 304

Query: 305 SEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLY 364
           SEAPYNVYAAQQK FREQ+LF DG++LDIRGVEIVSAK+LPPQD+P LVVGCR QEIHLY
Sbjct: 305 SEAPYNVYAAQQKAFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLY 364

Query: 365 RKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           RKAKTGE+AAGHESNIMMSSYAMV TRDPE + D+ETEGW++LEF+RGGSRQFT
Sbjct: 365 RKAKTGEVAAGHESNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/396 (74%), Positives = 352/396 (88%), Gaps = 1/396 (0%)

Query: 24  FSTTGLSWNGQ-KSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREAY 82
           FST+ +  NG  K+P+QIFRETFK EW+KSQELQDNIK LQDASGRLG+S+AYKKA+EAY
Sbjct: 21  FSTSTVLRNGGGKTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAY 80

Query: 83  LKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTRV 142
           +KAQ+ ST+V KTLKKTGET+E+L  K WDS+IGK+TR+VVS+ A+K+DESFEPVR T+V
Sbjct: 81  VKAQQSSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQV 140

Query: 143 YKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEGK 202
           YK++SE+IDDGESSRYGGFI+KE RR+KRE DLASG+R  A +SN+EAGTA+VATN E K
Sbjct: 141 YKEVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESK 200

Query: 203 ESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVFA 262
           ESFGKKI DFKEKT +G+ +   KV++WDENENPLI +LRTISNKI G FAETES+RV++
Sbjct: 201 ESFGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYS 260

Query: 263 QFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFREQ 322
           QFKL+DPTF++  FTKHLR+YIIPEVLEAYVKGDEVVLK+W SEAP+NVYAAQQK+ R+Q
Sbjct: 261 QFKLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQ 320

Query: 323 ELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIMM 382
           +LF DGR+LDIRGV+IVSAKLL PQD+P LVVGCR QE+HLYRK KTGE+ AG ESNIMM
Sbjct: 321 QLFTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMM 380

Query: 383 SSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           SSYAMV TRDP+N+ D ETEGWK+LEF+RGGSRQFT
Sbjct: 381 SSYAMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/384 (77%), Positives = 339/384 (88%)

Query: 35  KSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREAYLKAQRGSTVVGK 94
           +SPLQIFRETFK EWKKSQELQDNIKALQDASG++GES+AYKKAREAYL AQ+GST+VGK
Sbjct: 96  RSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTIVGK 155

Query: 95  TLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGE 154
           TLKKTG+++E +  KAW+S+IGK+TR+ V+KTA KLDESFEPVRHTRVYKD+SE++D   
Sbjct: 156 TLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSN 215

Query: 155 SSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEGKESFGKKIQDFKE 214
           SSRYGGFI+KE RR K E D+ASG+R  AV+SN+EAGTA+VAT  E KESFGKK+ DFKE
Sbjct: 216 SSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDDFKE 275

Query: 215 KTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVFAQFKLLDPTFNSE 274
           KT +GRKL + K KLWDE+ENPLI ++RTI NK+GGLFAETESARV  QFK++D  FNSE
Sbjct: 276 KTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNFNSE 335

Query: 275 EFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIR 334
            F  HLREYIIPEVLEAYVKG+E VLKQW SEAPYNVYAAQQK FREQ LF DGR+LDIR
Sbjct: 336 SFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRILDIR 395

Query: 335 GVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPE 394
           GV+IVSAKLLPPQD+P LVVGCR QEIHLYR  KTGE+AAG +SNI+MSSYAMV TRDPE
Sbjct: 396 GVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPE 455

Query: 395 NVTDKETEGWKVLEFIRGGSRQFT 418
           N+ DKETEGWK+LEF+RGGSRQFT
Sbjct: 456 NIDDKETEGWKILEFVRGGSRQFT 479

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/397 (73%), Positives = 349/397 (87%), Gaps = 2/397 (0%)

Query: 24  FSTTGLSWNG--QKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREA 81
           FST+     G   +SPLQIFR+TFK EW+KSQELQ+NIK LQDASG+LGES+AYKKAREA
Sbjct: 35  FSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREA 94

Query: 82  YLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTR 141
           YLKAQRGST+VGKTLKKTGET+E++  KAW+S++GKNTR+  S TA+KLDESFEPVR T+
Sbjct: 95  YLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTK 154

Query: 142 VYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEG 201
           +YK++SE+IDDGESSRYGGFI KE RR KRE DLASG+R  AV+SNDEAGTA+VATN E 
Sbjct: 155 IYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIES 214

Query: 202 KESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVF 261
           KESFGKK++DFKEKT +GR +   K KLWDE+ENPLI ++R I+NK+GG FAETES+RV+
Sbjct: 215 KESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVY 274

Query: 262 AQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFRE 321
           +QFK++DPTF++E FT+HLREYI+PE+LEAYVKGD  VLK+W SEAP+NVYAAQQK F+E
Sbjct: 275 SQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKE 334

Query: 322 QELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIM 381
           Q+++ DGR+LDIRGVE+VSAKLL PQD+P LVVGCR QEI+LYRK KTGEIAAG E+NI+
Sbjct: 335 QDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANIL 394

Query: 382 MSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           MSSYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 395 MSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/406 (72%), Positives = 353/406 (86%), Gaps = 6/406 (1%)

Query: 15  IAKAVPARQFSTTGLSWNG--QKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGES 72
           IA+A+    FST+     G   +SPLQIFR+TFK EW KSQELQ+NIK LQDASG+LGES
Sbjct: 34  IARAL----FSTSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGKLGES 89

Query: 73  DAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDE 132
           +AYKKAREAYL+AQRGST+VGKTLKKTGET+E++  +AWDS++GKNTR+  S TA+KLDE
Sbjct: 90  EAYKKAREAYLRAQRGSTIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASATAKKLDE 149

Query: 133 SFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGT 192
           SFEPVR T++YK++SE+IDDGESSRYGGFI KE RR KRE DLASG+R  AV+SNDEAGT
Sbjct: 150 SFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGT 209

Query: 193 AMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLF 252
           A+VATN E KESFGKK++DFKEKT +GR +   K +LWDE+ENPLI ++R ++NK+GG F
Sbjct: 210 AVVATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFF 269

Query: 253 AETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVY 312
           AETES+RV++QFK++DPTF++E FT+HLREYI+PE+LEAYVKGD  VLK+W SEAP+NVY
Sbjct: 270 AETESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVY 329

Query: 313 AAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEI 372
           AAQQK F+EQ++F DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEI+LYRK KTGEI
Sbjct: 330 AAQQKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEI 389

Query: 373 AAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           AAG E+NI+MSSYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 390 AAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/397 (72%), Positives = 348/397 (87%), Gaps = 2/397 (0%)

Query: 24  FSTTGLSWNG--QKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREA 81
           FST+     G   +SPLQIFR+TFK EW+KSQELQ+NIK LQDASG+LGES+AYKKAREA
Sbjct: 35  FSTSATRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREA 94

Query: 82  YLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTR 141
           YL+AQRGST+VGKTLKKTGET+E++  KAW+S++GKNTR+  S TA++LDESFEPVR T+
Sbjct: 95  YLRAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLDESFEPVRQTK 154

Query: 142 VYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEG 201
           +YK++SE+IDDGESSRYGGFI KE RR KRE DLASG+R  AV+SNDEAGTA+VATN E 
Sbjct: 155 IYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIES 214

Query: 202 KESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVF 261
           KESFGKK++DF+EKT +GR +   K +LWDE+ENPLI ++R ++NK+GG FAETES+RV 
Sbjct: 215 KESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAETESSRVH 274

Query: 262 AQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFRE 321
           +QFKL+DPTF++E FT+HLR+YI+PE+LEAYVK D  VLK+W SEAPYNVYAAQQK FRE
Sbjct: 275 SQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNVYAAQQKIFRE 334

Query: 322 QELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIM 381
           Q+++ DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEI+LYRK KTGEIAAG+E+NI+
Sbjct: 335 QDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGNEANIL 394

Query: 382 MSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           MSSYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 395 MSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/400 (74%), Positives = 338/400 (84%), Gaps = 1/400 (0%)

Query: 19  VPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKA 78
           V  R F T  +  +  +SPLQIFRETFK EW+KSQELQDNIK LQDASGRLGES+AYKKA
Sbjct: 12  VARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKA 71

Query: 79  REAYLKAQRGS-TVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPV 137
           REAYLKA +GS T+VGKTL+KTGET+E L  KAWDSDI K TR V SKTA+KLDESFEPV
Sbjct: 72  REAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPV 131

Query: 138 RHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVAT 197
           R T++YKD+SE+IDDG+SS YGGFI KE RR KRE DLASG+R  AV+SNDEAG+A+VAT
Sbjct: 132 RQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVAT 191

Query: 198 NKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETES 257
           + E KES GKKI+DFKEKT +GR L   KV LWDE+ENPLI  LR I+ KIGG FAETES
Sbjct: 192 DIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETES 251

Query: 258 ARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQK 317
           ARV+ QFK++DPTF +  FTKHLR+YI+PEVLEAYVKGDE VLK+W SEAP+NVY AQQK
Sbjct: 252 ARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQK 311

Query: 318 QFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHE 377
            F++QELF DG++LDIRGVE+VSAKLL PQD+P LVVGCR QEIHLYRKAKTGEIAAG E
Sbjct: 312 IFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDE 371

Query: 378 SNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQF 417
           SNI+MSSYAMV TRDPE + D ETEGWK+LEFIRG SR F
Sbjct: 372 SNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/410 (71%), Positives = 354/410 (86%)

Query: 9   QSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGR 68
           +S+ +G+  A      STT       +SPLQIFR+TFK EW+KSQELQ+NIK LQDASG+
Sbjct: 22  RSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGK 81

Query: 69  LGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQ 128
           LGES+AYKKAREAYLKAQRGST+VGKTLKKTGET+E++  KAW+S++GKNTR+  + TA+
Sbjct: 82  LGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAK 141

Query: 129 KLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSND 188
           KLDESFEPVR T++YK++SE+IDDGESSRYGGFI KE RR KRE DLASG+R  AV+SN+
Sbjct: 142 KLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNE 201

Query: 189 EAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKI 248
           +AGTA+VATN E KESFGKK++DFKEKT +GR +   K KLWDE+ENPLI ++R I+NK+
Sbjct: 202 DAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKV 261

Query: 249 GGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAP 308
           GG FAETES+RV++QFKL+DPTF++E FT+HLREYI+PE+LEAYVKGD  VLK+W SEAP
Sbjct: 262 GGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAP 321

Query: 309 YNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAK 368
           +NVYAAQQK F+EQ+++ DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEI+LYRK K
Sbjct: 322 FNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKK 381

Query: 369 TGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           TGEIAAG E+NI+MSSYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 382 TGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/405 (68%), Positives = 345/405 (85%), Gaps = 1/405 (0%)

Query: 14  GIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESD 73
           GI        FST+  S  G +SPLQIFR+TFK EW+KSQELQ+NIK LQDASGRLG+S+
Sbjct: 4   GIVTQRSVALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSE 62

Query: 74  AYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDES 133
             K+AREAYL+AQ+GST+VGKTL+KTGET+E +  KAW+S+I K+TR   S TA+KLD+S
Sbjct: 63  GVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDKS 122

Query: 134 FEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTA 193
           FEPVR+T++YKD+SE+++D ++SRYGGF+ KE R+ KRE ++ASG+R  A+RSN+EAGTA
Sbjct: 123 FEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTA 182

Query: 194 MVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFA 253
           +VATN E KES GKK++DF+EKTFIGR + + KV+LW+ENENPLI +LR I+NK+GG FA
Sbjct: 183 LVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFA 242

Query: 254 ETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYA 313
           ETE+A+V  QFKLLDP+F SE FT+ LR+Y+IPEVLEAY KGDE  LK+W SEAP+NVYA
Sbjct: 243 ETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYA 302

Query: 314 AQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIA 373
           AQQK FR+Q+LF D R+LDIRGV+IVSAKLLPPQD+P L+VGCR QEI LYR  K+GE+A
Sbjct: 303 AQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVA 362

Query: 374 AGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           AGHESNI+MSSYAMV TRDPENV D+ETEGW+++EF+RGGSRQFT
Sbjct: 363 AGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/398 (70%), Positives = 337/398 (84%), Gaps = 4/398 (1%)

Query: 24  FSTTGLSWN----GQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAR 79
           FSTT  + N    G ++P+QIFR+TFK EW+KSQELQDNIKAL DASG+L ES+ +K A+
Sbjct: 36  FSTTRTTLNNNGGGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMAK 95

Query: 80  EAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRH 139
           +AYLKA +GST+V KTLKKTGET+E +  KAWDS+IGKNTR    KTA+ +D+SFEPVR 
Sbjct: 96  DAYLKAHKGSTIVSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRK 155

Query: 140 TRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNK 199
           T++YKD+SE+IDDG+SSRYGGFI KE R+ KRE DLASG+R  AV+SNDEAGTA+VATN 
Sbjct: 156 TQIYKDVSEVIDDGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATNI 215

Query: 200 EGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESAR 259
           E KESFGKK++DFKEKT +G+ +   K+KLWDE+ENPLI  LR ISNKI G F ETESA+
Sbjct: 216 EAKESFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESAK 275

Query: 260 VFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQF 319
           V+ QFKL+D TF ++ FT+HLR+YI+PE+LEAY+KGDE VLK+W SEAP+NVYAAQQK F
Sbjct: 276 VYTQFKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVF 335

Query: 320 REQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESN 379
           REQ LF DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEI+LY+KAK+GEIAAG ESN
Sbjct: 336 REQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESN 395

Query: 380 IMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQF 417
           I+MSSYAMV TRDPE + D ETEGWK+LEF+RGGSR F
Sbjct: 396 IVMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPF 433

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/398 (70%), Positives = 337/398 (84%), Gaps = 3/398 (0%)

Query: 24  FSTTGLSWNGQ--KSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREA 81
           FSTT    NG   ++P+QIFR+TFK EW KSQELQ+NIKAL DASG+L ES+ +K A++A
Sbjct: 35  FSTTTARSNGGGGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAKDA 94

Query: 82  YLKAQRGS-TVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHT 140
           YLKA +GS T++ KT++KTGET+EN+  KAWDS+I K+TRE   KTA  LD+SFEPVR T
Sbjct: 95  YLKAHKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKT 154

Query: 141 RVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKE 200
           +VYKD+SE+IDDG+SSRYGGFI KE RR KRE DLASG+R  A++SN+EAGTA+VAT+ E
Sbjct: 155 QVYKDISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATDIE 214

Query: 201 GKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARV 260
            K+SFGKK++DFKEKT +G+ +   KVKLWDE+ENPLI  LR I+NKIGG F ETESARV
Sbjct: 215 AKQSFGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESARV 274

Query: 261 FAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFR 320
           + QFK++D TF +E FT+HLREYI+PE+LEAY+KGDE VLK+W SEAP+NVY+AQQK FR
Sbjct: 275 YTQFKMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFR 334

Query: 321 EQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNI 380
           EQ LF DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEI+LYRK KTGEIAAG +SNI
Sbjct: 335 EQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNI 394

Query: 381 MMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           +MSSYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 395 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/421 (66%), Positives = 343/421 (81%), Gaps = 5/421 (1%)

Query: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNG---QKSPLQIFRETFKDEWKKSQELQD 57
           ML Y  ++ +  S   + V      T  +  NG    +SPL IFR+TFK EW+KSQELQ+
Sbjct: 1   MLAYKTVRPA--SAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQE 58

Query: 58  NIKALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGK 117
           NI+ LQDASG++GE++AY+KAREA+L+AQ+GST+VGKTLKKTGET+E +  KAWDS+I K
Sbjct: 59  NIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAK 118

Query: 118 NTREVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLAS 177
            +R+   KTAQKLDE FEPVR T++YKD+SE+IDDG+S+ YGGF  +E R+++RE  LAS
Sbjct: 119 ASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALAS 178

Query: 178 GRRTHAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPL 237
           G R  AV+SNDEAGTA+VAT  E KES GKK++DFKEKT +GR LH  K +LWDE+ENPL
Sbjct: 179 GERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPL 238

Query: 238 ISMLRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDE 297
           I  +R +S K+G  FAETES RV+ QFKL+DP FNS  FTKHLREY++PE+LEAYV+GDE
Sbjct: 239 IVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDE 298

Query: 298 VVLKQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCR 357
            VLK+W SEAPYNVYAAQQK F+E+ LF DGR+LDIRGVEIVSAKLL PQD+P LVVGCR
Sbjct: 299 KVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCR 358

Query: 358 VQEIHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQF 417
            QEI+LY+K KTGEIAAG ESNI+MSSYAMV TRDPE VTD+ETEGWK+LEF+RGGSRQF
Sbjct: 359 AQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQF 418

Query: 418 T 418
           T
Sbjct: 419 T 419

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/387 (67%), Positives = 329/387 (85%), Gaps = 2/387 (0%)

Query: 34  QKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREAYLKAQRGS-TVV 92
           Q++PLQIFRETFK EW+KS ELQ +IK LQDASG++ ES+AYKKAR+AYLKA RGS T++
Sbjct: 35  QRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHRGSSTIL 94

Query: 93  GKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTRVYKDMSELI-D 151
            KTLKKTG+T+E++  KAW+S+I KNTR++ S+TA+KLDESFEPVR+T++YKD+SE++ D
Sbjct: 95  DKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDVSEVLND 154

Query: 152 DGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEGKESFGKKIQD 211
           DG+S RYGGFI K+ RR KRE+ L SG+R  AV+SNDEAGTA+VATN +  ES G+K ++
Sbjct: 155 DGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESIGQKYEN 214

Query: 212 FKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVFAQFKLLDPTF 271
           FKE+T +G+ LH  KV  WDE+ENPLI +LR I+ KI G F ETES+RV++QFKL+D TF
Sbjct: 215 FKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLIDQTF 274

Query: 272 NSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFREQELFPDGRVL 331
           N+E FT+HLREYI+PE+LEAY+KGDE VLK W SEAP+NVY+AQQK FR+Q LFPDG +L
Sbjct: 275 NAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNIL 334

Query: 332 DIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIMMSSYAMVLTR 391
           DIR VEIVSAKLL PQD+P LVV CR QEI++YRK KTGE+AAG+ S+I+MS+YAMV TR
Sbjct: 335 DIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTYAMVFTR 394

Query: 392 DPENVTDKETEGWKVLEFIRGGSRQFT 418
           DPE + + ETEGW++LEF+RG SRQFT
Sbjct: 395 DPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  504 bits (1297), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 230/394 (58%), Positives = 307/394 (77%), Gaps = 9/394 (2%)

Query: 30  SWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREAYLKAQRGS 89
           S +  K+P+QIFRETFK EW+KS  LQD IK L DAS R+ +SDA+KKA++AY      +
Sbjct: 32  SNDSNKTPIQIFRETFKQEWEKSATLQDQIKTLTDASDRINQSDAFKKAKDAYKNVSNQT 91

Query: 90  TVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTRVYKDMSEL 149
           T++ KT+ KTG  + +  +KAWDSD+ + T+      A+KLD+SFEPVR+T++YKD+SE+
Sbjct: 92  TILSKTISKTGTKLNDAALKAWDSDLAQKTK----LAAKKLDDSFEPVRNTKIYKDVSEV 147

Query: 150 IDDGESS-RYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEGKESFGKK 208
           IDD ++S +YGGFI+KE RR KR  DL +G+R   ++SNDEAGTA++AT+ + KES  +K
Sbjct: 148 IDDKDNSYKYGGFISKEERRSKRISDLQTGKRMKPIKSNDEAGTALIATDLKSKESINEK 207

Query: 209 IQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVFAQFKLLD 268
           + DFKEKT +G+ +   K K+WDEN+NPLI  +R ++      FAETES+RV  QFKL+D
Sbjct: 208 LNDFKEKTVVGQTMTSIKTKVWDENDNPLIVGMRKVTGVFNRFFAETESSRVLTQFKLID 267

Query: 269 PTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFREQELFPDG 328
           P FN+E F + LREYIIPEVLEAY+KGDE +LK W SEAPYNVY+AQQK+ R+Q++F DG
Sbjct: 268 PNFNNESFLRSLREYIIPEVLEAYIKGDEKILKNWFSEAPYNVYSAQQKELRKQKIFSDG 327

Query: 329 RVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRK----AKTGEIAAGHESNIMMSS 384
           RVLDIRGV+IV+AK+LPPQD+P +VV CR QEI++Y+K     +T +I AGH+SNI+MS+
Sbjct: 328 RVLDIRGVDIVTAKMLPPQDIPVIVVSCRAQEINIYKKFNVEKQTNDIVAGHDSNILMST 387

Query: 385 YAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418
           YAMV TRDPE + + ETEGWK+LEF+RGGSR+FT
Sbjct: 388 YAMVFTRDPEQLDNDETEGWKILEFVRGGSRKFT 421

>TPHA0G01510 Chr7 (307410..308567) [1158 bp, 385 aa] {ON} Anc_8.696
           YPL168W
          Length = 385

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 66/164 (40%), Gaps = 35/164 (21%)

Query: 40  IFRETFKDEWKKS-------QELQDNIKALQDASGRLGESDAYKKAREAYLKAQRGSTVV 92
           + RE F+  +KK        Q+L+   K L D   ++  +D       AY K +  +  V
Sbjct: 84  LLREIFQTVYKKPMKRRLKLQQLKYMYKGLLD--NKINRTDLSNLLDYAY-KLEIINVSV 140

Query: 93  GKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFE-----------PVRHTR 141
            K +K       NL +K+    I  N  ++  K    LD   +           P RH +
Sbjct: 141 PKIIKDNALK-SNLQIKS----IINNALKMEPKNKNSLDNVIDGLQADSKINKIPARHIK 195

Query: 142 VY-------KD--MSELIDDGESSRYGGFIAKETRRQKREHDLA 176
           +Y       KD  M+  IDD +    GG++ KE  +QK    LA
Sbjct: 196 LYLSKEKQKKDIGMNNAIDDADIQSIGGYLEKEGIKQKEIKKLA 239

>Kpol_1060.13 s1060 (35582..38455) [2874 bp, 957 aa] {ON}
           (35582..38455) [2874 nt, 958 aa]
          Length = 957

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 278 KHLREYIIPEVLEAYVKGDEVVLKQ--------WLSEAPYNVYAAQQKQFREQELFPDGR 329
           KH R ++I E     VKG    +K+        WL+E   N+  A+ K+F+E+     GR
Sbjct: 221 KHCRAFVIMEGFAGLVKGGPDYIKEFFWEDVRGWLAEGGTNIGTARCKEFQERA----GR 276

Query: 330 VL 331
           +L
Sbjct: 277 LL 278

>KNAG0E01130 Chr5 complement(220233..220631) [399 bp, 132 aa] {ON} 
          Length = 132

 Score = 29.3 bits (64), Expect = 8.9,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 32/66 (48%)

Query: 81  AYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHT 140
           A   AQ  S     TL    E ++ + +  + +DI KN  E  +  A+  ++++  +  T
Sbjct: 13  ALTAAQLVSAAPATTLPANAEEVKEVELGVYVNDITKNLMEYYAFRAEHPEQAYPGIIET 72

Query: 141 RVYKDM 146
            V++DM
Sbjct: 73  AVFEDM 78

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,463,063
Number of extensions: 1832866
Number of successful extensions: 5299
Number of sequences better than 10.0: 74
Number of HSP's gapped: 5519
Number of HSP's successfully gapped: 75
Length of query: 418
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 306
Effective length of database: 40,638,807
Effective search space: 12435474942
Effective search space used: 12435474942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)