Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43168.255ON62362332590.0
AGR096C8.255ON62362223320.0
KLLA0F18953g8.255ON64764114800.0
Kwal_56.235838.255ON70069414130.0
TDEL0F038208.255ON68767013581e-180
SAKL0H17226g8.255ON71971713481e-178
ZYRO0C01826g8.255ON69968913391e-177
Smik_4.3548.255ON69867013341e-176
Suva_2.2688.255ON69567213321e-176
Kpol_392.118.255ON67566913241e-175
YDR108W (TRS85)8.255ON69867313201e-174
Skud_4.3698.255ON69867413171e-173
NDAI0J014108.255ON71670313091e-172
NCAS0B038808.255ON70668313081e-172
CAGL0B01705g8.255ON67266712911e-170
KAFR0B055708.255ON66967012461e-163
KLTH0G13860g8.255ON70845911811e-153
KNAG0H032708.255ON64866211291e-146
TPHA0B032608.255ON71458610941e-140
TBLA0E043808.255ON88963310151e-126
NDAI0D035904.105ON1008151800.51
TPHA0C013307.210ON38367790.59
NDAI0F001605.717ON134980752.0
ZYRO0G10032g4.105ON997134752.2
Suva_14.2022.130ON42439733.1
Kpol_1058.328.69ON2126119716.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4316
         (623 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...  1259   0.0  
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   902   0.0  
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   574   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   548   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   527   e-180
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   523   e-178
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   520   e-177
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   518   e-176
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   517   e-176
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   514   e-175
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   513   e-174
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   511   e-173
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   508   e-172
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   508   e-172
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   501   e-170
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   484   e-163
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   459   e-153
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   439   e-146
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   426   e-140
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   395   e-126
NDAI0D03590 Chr4 complement(853792..856818) [3027 bp, 1008 aa] {...    35   0.51 
TPHA0C01330 Chr3 (303967..303999,304095..305213) [1152 bp, 383 a...    35   0.59 
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717      33   2.0  
ZYRO0G10032g Chr7 (799068..802061) [2994 bp, 997 aa] {ON} simila...    33   2.2  
Suva_14.202 Chr14 (366776..368050) [1275 bp, 424 aa] {ON} YNL136...    33   3.1  
Kpol_1058.32 s1058 (88551..94931) [6381 bp, 2126 aa] {ON} (88551...    32   6.3  

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score = 1259 bits (3259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/623 (98%), Positives = 612/623 (98%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY
Sbjct: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60

Query: 61  KLLRYFGDYIQDRDQLDDKISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVGDN 120
           KLLRYFGDYIQDRDQLDDKISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVGDN
Sbjct: 61  KLLRYFGDYIQDRDQLDDKISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVGDN 120

Query: 121 HQVEFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTTLSPYHSFNHPIL 180
           HQVEFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTTLSPYHSFNHPIL
Sbjct: 121 HQVEFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTTLSPYHSFNHPIL 180

Query: 181 ALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWET 240
           ALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWET
Sbjct: 181 ALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWET 240

Query: 241 VQSLMKVIKKQLFVESVPLPIFTNFRDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLV 300
           VQSLMKVIKKQLFVESVPLPIFTNFRDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLV
Sbjct: 241 VQSLMKVIKKQLFVESVPLPIFTNFRDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLV 300

Query: 301 KLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTASMP 360
           KLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTASMP
Sbjct: 301 KLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTASMP 360

Query: 361 TSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALS 420
           TSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALS
Sbjct: 361 TSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALS 420

Query: 421 LLMGAHSIVTAKMIKNDIDPLIMKYLDYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAP 480
           LLMGAHSIVTAKMIKNDIDPLIMKYLDYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAP
Sbjct: 421 LLMGAHSIVTAKMIKNDIDPLIMKYLDYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAP 480

Query: 481 FAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLEEELY 540
           FAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHA           LEEELY
Sbjct: 481 FAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHADDDSTSDCDHDLEEELY 540

Query: 541 LNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFAN 600
           LNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFAN
Sbjct: 541 LNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFAN 600

Query: 601 AEGTLLSRLADAVVDSENSQRAN 623
           AEGTLLSRLADAVVDSENSQRAN
Sbjct: 601 AEGTLLSRLADAVVDSENSQRAN 623

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/622 (69%), Positives = 506/622 (81%), Gaps = 9/622 (1%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           MLSYE YMNL+HYP+ WSQPVP EISR+VICNALSPC+SVQST AL  HL E F  GSLY
Sbjct: 1   MLSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLY 60

Query: 61  KLLRYFGDYIQDRDQLDDKISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVGDN 120
            LLRYF DY+++R +    +S + +P        S++QR +SRY+RFQ PL ++I   + 
Sbjct: 61  MLLRYFADYVRERGEEVGSVSGQRRPG-------SVYQRQTSRYVRFQRPLEEVIETVEQ 113

Query: 121 HQVEFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTTLSPYHSFNHPIL 180
             V+F DLEE+L + L+DIE  T N+SP ELLKHSIFHKFITMLSST LSPYH+ NHPI+
Sbjct: 114 QAVDFEDLEEALGQHLRDIEARTTNESPSELLKHSIFHKFITMLSSTALSPYHTVNHPIM 173

Query: 181 ALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWET 240
           ALLALD+TQGEEY LARELL++FKNLP+  SKFP++INTNDVLPVFILCFD+SS +QWET
Sbjct: 174 ALLALDVTQGEEYTLARELLVQFKNLPSKSSKFPSYINTNDVLPVFILCFDESSSEQWET 233

Query: 241 VQSLMKVIKKQLFVESVPLPIFTNFRDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLV 300
           VQ+L K IKKQLFVESVPLPIFTN+    +VLHPPITNSLQEQ+YD SHP  L+LCP+LV
Sbjct: 234 VQALQKAIKKQLFVESVPLPIFTNYESDPVVLHPPITNSLQEQVYDGSHPPLLRLCPQLV 293

Query: 301 KLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTASMP 360
            +IY+TIN+MVEDLMIPFMNRKISFWDETILQPRKSIFH NK LKRF++K++ S   ++ 
Sbjct: 294 DVIYETINAMVEDLMIPFMNRKISFWDETILQPRKSIFHGNKFLKRFMNKTNSSAAGTLS 353

Query: 361 TSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALS 420
           TS DG+FLASSNEFLLRKLADW FMLSDYKTAYSIY IL+RDFE YP Y+SSCQEFSALS
Sbjct: 354 TSSDGYFLASSNEFLLRKLADWSFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALS 413

Query: 421 LLMGAHSIVTAKMIKNDIDPLIMKYLDYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAP 480
           LLMGAHSIVT KMIKNDIDPLIMKY+D  V ++  L + RC++YM ELFLSLSDTWTSAP
Sbjct: 414 LLMGAHSIVTTKMIKNDIDPLIMKYMDSTVASLNYLGKFRCLVYMAELFLSLSDTWTSAP 473

Query: 481 FAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXL--EEE 538
           FAIKYLE+ILQ E LKLGP+ R ++WERIS+AY+LRIDPRIH            L  E++
Sbjct: 474 FAIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYLSDNFMELTTEDD 533

Query: 539 LYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPF 598
             +NP+KLH  +I + G TR+RKEAVF+LLAAKKWL+ G  RQGAWSLK CN+VYR+L F
Sbjct: 534 FCMNPNKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGF 593

Query: 599 ANAEGTLLSRLADAVVDSENSQ 620
           ANA+GTLLSRL D VV  E  Q
Sbjct: 594 ANADGTLLSRLVDMVVHEETVQ 615

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/641 (47%), Positives = 420/641 (65%), Gaps = 34/641 (5%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
            SYEKYMNL+ YP+ WS P+P EIS+KVI N LSPCI VQS   L+ HL++++ I S+  
Sbjct: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64

Query: 62  LLRYFGDYIQDRDQLDDKISAK--LQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISV-G 118
           L RYFGDYIQDRDQ+      K     ++ R R +SLFQR +S  +RF   L D+IS+  
Sbjct: 65  LFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLISIDS 124

Query: 119 DNHQVEFNDLEESLSEFLKDIEE-HTVNDSPCELLKHSIFHKFITMLSSTTLSPYHSFNH 177
           ++H ++  D++  LS++L+++E     N +P +LLKHSI+H+F   LSS  LS YHSF+H
Sbjct: 125 EDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITLSSINLSRYHSFHH 184

Query: 178 PILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQ 237
           P++ALL LDIT+G+ YE ARE+L+ FKNL NTL  FP FIN ND+LPVF+LC+D++S +Q
Sbjct: 185 PVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQ 244

Query: 238 WETVQSLMKVIKKQLFVESVPLPIFTNFRD-RSIVLHPPITNSLQEQLYDSSHPVSLKLC 296
           WE+VQ+L K +KKQLFVESV + +FT   + +S  LH PIT SL EQ+++ SHP S+ + 
Sbjct: 245 WESVQALTKSLKKQLFVESVSISLFTPHDNQKSTTLHSPITVSLHEQVFNMSHPTSINIP 304

Query: 297 PRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPT 356
            RL+  IYDTI+ +VE++MIPFM+RK+ FWDET+LQPRKSIF SNK  +RFIS  S  P 
Sbjct: 305 SRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPI 364

Query: 357 ASM------PTSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYM 410
           A        P   D  F ASS EFLLRKLADW FMLSD+K AYSIY++L +DFE+YP Y+
Sbjct: 365 AHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYL 424

Query: 411 SSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDY--AVNNIISLDQIRCMIYMTEL 468
           + C E+  +SLLMGA +I+TAK IK ++DPL+ + ++     +   SL  I C++  ++L
Sbjct: 425 APCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCILTFSDL 484

Query: 469 FLSLSDTWTSAPFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIH------ 522
            LSLSDTW S+P A+ YL  I QK +L LGP    +I ERI++AY + ID R++      
Sbjct: 485 LLSLSDTWVSSPLAVNYLTYI-QKSHL-LGPYATVIILERIAYAYEICIDLRVNDHFLPK 542

Query: 523 ------AXXXXXXXXXXXLEEEL-------YLNPHKLHCGKIQNQGFTRYRKEAVFQLLA 569
                 A            E  L       + N +KL    ++++G TR+RK +++QL+A
Sbjct: 543 PDEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVA 602

Query: 570 AKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLA 610
           AKKW++  +  Q  W +      Y  L  +     L  RL+
Sbjct: 603 AKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLS 643

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/694 (43%), Positives = 422/694 (60%), Gaps = 83/694 (11%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
           LSYE+YMNL+ + D  S+PVP EISRK++ NA+SP ++V S+ AL++H++E + + SLY 
Sbjct: 3   LSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSLYM 62

Query: 62  LLRYFGDYIQDRDQLDDKISAKLQPNNRR--QRQNSLFQRNSSRYIRFQTPLTDIISVGD 119
           LLRYFGD I DRDQ D +  + ++PN  R   R  SLFQR +S+++RF  PL+DII   +
Sbjct: 63  LLRYFGDCISDRDQADSEQESGVEPNKSRARSRSGSLFQRQASQFLRFTRPLSDIIGTRE 122

Query: 120 NHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTT--LSPYHSF 175
              +  +++ LE  L ++L+ ++  T  D+P  LL+HSI+HKF T   S+T  LSPY  F
Sbjct: 123 TRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQHSIYHKFFTTAISSTAHLSPYECF 182

Query: 176 NHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSP 235
           NHP+ +LLALDI+Q E YE AR+LL+ FKN+ N    FP+FIN ND+LPVF+LC+++ S 
Sbjct: 183 NHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTPHFPSFINVNDILPVFLLCYEEGSR 242

Query: 236 QQWETVQSLMKVIKKQLFVESVPLPIFT-NFRDRSI---VLHPPITNSLQEQLYDSSHPV 291
           +Q+ET QSL K++KKQLFVES+ LP ++ NF  +     VLH PI +SL+E ++      
Sbjct: 243 EQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDTPTRVLHQPIMSSLEETMFSMLKDS 302

Query: 292 SLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISK- 350
           +  L    ++ IYD +  +V++LMIPFM RKISFW+E+ILQPR+SIF ++K  ++ ISK 
Sbjct: 303 AFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWEESILQPRRSIFPNSKFFRKLISKA 362

Query: 351 ---SSGSPTASMPTSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYP 407
              S+ + +A+       +F A+SNE LLRKLADW FMLSD+KTAYS YE+L +DFE +P
Sbjct: 363 PTPSTNNDSATHSEQGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYELLSKDFEQHP 422

Query: 408 LYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYL--------------------- 446
            Y++ C E+ ALS+LMGA SIVT KMIKNDIDPLI + L                     
Sbjct: 423 EYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAKERNGLLKSKL 482

Query: 447 -----DYAVNNIISLD--------------------------QIRCMIYMTELFLSLSDT 475
                D ++N   ++                           + RCM+   ELFLSLSDT
Sbjct: 483 QNRDHDKSLNGFETISNSHDDRVSGTTDFEISSTPSQSAQSYETRCMLLAAELFLSLSDT 542

Query: 476 WTSAPFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXL 535
           WT+ P+AIKYLE IL  +   +G +   +IWER+++ Y LR+DPR+ +            
Sbjct: 543 WTATPYAIKYLETIL--DQCTVGALSEIVIWERLAYCYALRVDPRVKSRLTASEIQSSDQ 600

Query: 536 EEEL---------------YLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTR 580
            E+L                +  HK+    I + G TR RK  +F+L+A KKW +  Q R
Sbjct: 601 NEKLDEESEGSDNDSGDESQVCQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWR 660

Query: 581 QGAWSLKRCNRVYRDLPFANAEGTLLSRLADAVV 614
           Q  WS +    +Y  L FAN E  +L +L   + 
Sbjct: 661 QACWSFQDLEVMYSHLVFANREDLILKKLEKRIA 694

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  527 bits (1358), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 293/670 (43%), Positives = 411/670 (61%), Gaps = 52/670 (7%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
           LSYE YMNLL + D     VP +I+++++ NA+SP I V ST  L++H++E   + SLY 
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 62  LLRYFGDYIQDRDQLDDKISA-----------------KLQPNNRRQRQNSLFQRNS--S 102
           LLR+FGD + DRDQ  +  SA                  +     R+R NSLFQR++  S
Sbjct: 64  LLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDATQS 123

Query: 103 RYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKF 160
           +YIRF  PL D++   D + +  +++ LE  L   L  IE+ T + +P +LLK S++H+F
Sbjct: 124 QYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYHRF 183

Query: 161 ITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFIN 218
            ++  S+T  LSPY +FNHP+++L+ALDI  G+ YE AR+LL +FKNL +T   FP F+N
Sbjct: 184 FSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVFLN 243

Query: 219 TNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFT-NFRDRS-IVLHPPI 276
           TNDVLPVF+LC++  S +Q+E  QSL K +KKQLFVE + LP++  N++  + ++LH PI
Sbjct: 244 TNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILHQPI 303

Query: 277 TNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKS 336
             SL E LY    P  ++L   L+  IYD +  ++  LMIPFM RKISFW+ETILQPR+S
Sbjct: 304 MTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQPRRS 363

Query: 337 IFHSNKLLKRFISKSSGSPT----ASMPTSPDG--HFLASSNEFLLRKLADWCFMLSDYK 390
           +FH +K LKRF+SK++        AS+    +G  +F++SS EFL+RKLADW  MLSDYK
Sbjct: 364 LFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYK 423

Query: 391 TAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDYAV 450
           TAYS Y+ L  D E+YP Y++SC E+ ++S+LMGA +IVTAKM+K DIDPLI + ++   
Sbjct: 424 TAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYE 483

Query: 451 NNIISLDQI-----------------RCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKE 493
           N  +   Q+                 RCM   +ELFLSLSDTWTS P+A++ LE IL + 
Sbjct: 484 NCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAE- 542

Query: 494 NLKLGPVCRNLIWERISFAYRLRIDPRI-HAXXXXXXXXXXXLEEELYLNPHKLHCGKIQ 552
             +LGP  + +IWER+S  Y+ RID RI H            +E E        H   I 
Sbjct: 543 -CRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTH-ADIV 600

Query: 553 NQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLADA 612
            +G TR RK A FQL+AA KW +  Q RQ +W LK     Y  + F N +   L++L + 
Sbjct: 601 TRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKET 660

Query: 613 VVDSENSQRA 622
           + + E   R 
Sbjct: 661 LKNVEIDSRT 670

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  523 bits (1348), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 305/717 (42%), Positives = 427/717 (59%), Gaps = 111/717 (15%)

Query: 2   LSYEKYMNLLHYPDQWSQPVP--REISRKVICNALSPCISVQSTDALNQHLEEVFKIGSL 59
           LSYE YMNLL++ D   + V    E+++K++ NA+SP ++V ST  L+ HL+E + + S+
Sbjct: 3   LSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLHSM 62

Query: 60  YKLLRYFGDYIQDRDQLDDKISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVG- 118
           Y LLR+FGD + DRDQ +++     +    R R NSLFQR SS ++RF  PL D++ V  
Sbjct: 63  YMLLRFFGDCVTDRDQ-ENETETNFKG---RPRSNSLFQRESSTFVRFTRPLIDLVDVRV 118

Query: 119 DNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTT--LSPYHS 174
            +H +  +++ LE  L ++L+ ++     ++P  LLKHSI+HKF T   S+T  LSPY S
Sbjct: 119 SDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYES 178

Query: 175 FNHPILALLALDITQGEEYELARELLMEFKNL---PNTLSKFPAFINTNDVLPVFILCFD 231
           FNHP+++LLALDI++G+ YE AR+LL+ FKN+     + + FP FIN ND+LPVF+LC++
Sbjct: 179 FNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYN 238

Query: 232 QSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFRDRSI-----VLHPPITNSLQEQLY- 285
            SS +Q+E  QSL K++KKQLFVES+ LP++ +  D        +LHPPI +SL+E LY 
Sbjct: 239 DSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYF 298

Query: 286 --------------DSSHPVS-LKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETI 330
                          SS+P+S  +L   LV+ IYD +N ++ +LMIPFM RKISFW+ETI
Sbjct: 299 LDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETI 358

Query: 331 LQPRKSIFHSNKLLKRFISKSS-GSPTASMPTSPDGH------FLASSNEFLLRKLADWC 383
           LQPRKSIF + K L+RF+SKS+  +P A + +  DG       F ASSNEFLLRKLADW 
Sbjct: 359 LQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWS 418

Query: 384 FMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIM 443
           FMLSDY+TAY+ Y+ L +D E++  Y++ C E+ A+S+LMGA SIVT KMIKNDIDPLI 
Sbjct: 419 FMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLIS 478

Query: 444 KYL------------------DYAVNNIISLD-QIRCMIYMTELFLSLSDTWTSAPFAIK 484
           K L                  D  V++  +   + RCM+   ELFLSLSDTWT+ P+AIK
Sbjct: 479 KSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPYAIK 538

Query: 485 YLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLEE------- 537
           YLE ILQ  N  LGP  + L+WE++++ Y LR+DPR+              EE       
Sbjct: 539 YLETILQ--NCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNE 596

Query: 538 -------ELYLNPHKLHCGKIQNQ----------------------------------GF 556
                  E + +  K   G  + Q                                  G 
Sbjct: 597 RAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGL 656

Query: 557 TRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLADAV 613
           TR RK A F+L+AA KW +  Q +Q +W L+  + VY  L F+  +G +L RL   +
Sbjct: 657 TRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLVGEI 713

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  520 bits (1339), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 291/689 (42%), Positives = 417/689 (60%), Gaps = 77/689 (11%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
           LSYE YMNLL + D   + VP +I+R+++ NA+SP I+V ST  L++H+ + + + SLY 
Sbjct: 3   LSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSLYM 62

Query: 62  LLRYFGDYIQDRDQLDD--KISAKLQP---------------NNR--------------- 89
            LR+FGD + DRDQ ++   + +K +P               N+R               
Sbjct: 63  FLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDTKN 122

Query: 90  ------------RQRQNSLFQRNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLS 133
                       R+R NSLFQR+   S+Y+RF  P+ D+I   D++ +  +++ LE  L 
Sbjct: 123 TTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLE 182

Query: 134 EFLKDIEEHTVNDSPCELLKHSIFHKFITM-LSSTT-LSPYHSFNHPILALLALDITQGE 191
             L+ +EE+T +++P ELLK S++HKF ++ +SSTT LSPY +FNHP+++L+A+DI+ G+
Sbjct: 183 NTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISAGQ 242

Query: 192 EYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQ 251
            YE AR+LL++FKNL +T+  FP F++T D+LPVF+LC++  S  +    Q L   +KKQ
Sbjct: 243 GYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLKKQ 302

Query: 252 LFVESVPLPIFT-NFRDRSIV-LHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINS 309
           LFVES+ LP++  ++ D   V LH PI +SL+E LY    P   +L  +L+ + Y+ +  
Sbjct: 303 LFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNILEK 362

Query: 310 MVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTASMPTS------P 363
           +V+DLM+PFM RKISFW+ETILQPRKS+FH     K+ +SK+S       P S       
Sbjct: 363 LVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDKNG 422

Query: 364 DGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLM 423
           + +F+ASS EFL+RKLADW  MLSD+KTAYS YE L+ D EN+P Y++SC E+ A+S+LM
Sbjct: 423 NEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSVLM 482

Query: 424 GAHSIVTAKMIKNDIDPLIMKYLDYAVNNIISLD-------------QIRCMIYMTELFL 470
           GA +IVT KMIKNDIDPLI + L+   N     D             + RCM   +ELFL
Sbjct: 483 GAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASELFL 542

Query: 471 SLSDTWTSAPFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXX 530
           SLSDTWTS P+A+  LE IL +   +LGP    +IWER+S  Y  RIDPRI         
Sbjct: 543 SLSDTWTSTPYALNSLETILTE--CRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGA 600

Query: 531 XXXXLEEELYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCN 590
                E    L P +    +I  +G TR RK A F+L+AA KW++  Q +Q  W LK   
Sbjct: 601 KAMTDE----LAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIE 656

Query: 591 RVYRDLPFANAEGTLLSRLADAVVDSENS 619
             Y  L F N E  +L+RL   + +++N+
Sbjct: 657 EAYAGLDFVNREDLILARLKRQMNEAQNN 685

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  518 bits (1334), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 296/670 (44%), Positives = 412/670 (61%), Gaps = 63/670 (9%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST   ++H++E +K+ SLY
Sbjct: 2   VFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLY 61

Query: 61  KLLRYFGDYIQDRDQLDD-----------KISAKLQ----------PN----NRRQRQNS 95
            LLR+FG  + DRDQ ++             +A ++          PN      R R NS
Sbjct: 62  MLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNS 121

Query: 96  LFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCEL 151
           LFQR+S  S+YIRF  PL D+I   D + + FN   LE  L  +LK + ++T    P +L
Sbjct: 122 LFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDL 181

Query: 152 LKHSIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNT 209
           LK SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL + 
Sbjct: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241

Query: 210 LSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPI----FTNF 265
              FP F+NTN++LPVF+LC++  S +++E  Q+L K +KKQLFVESV L +    F   
Sbjct: 242 TENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIEA 301

Query: 266 RDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISF 325
            + +I LH P+ +SL+E L+    P    L   L+  IYD ++ +V DLMIPFM RK+SF
Sbjct: 302 NNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSF 361

Query: 326 WDETILQPRKSIFHSNKLLKRFISK--SSGSPTASMPTS---PDGHFLASSNEFLLRKLA 380
           W+ETILQPRKS+F+  K  K+F++K  S+G+   +  TS    + +F +SS+EFL+RKLA
Sbjct: 362 WEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLA 421

Query: 381 DWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDP 440
           DW  MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA  IVT KMIKNDI+P
Sbjct: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINP 481

Query: 441 LIMKYLDYAVN------------------NIISLDQIRCMIYMTELFLSLSDTWTSAPFA 482
           LI K L    N                    +   + RCMI  +ELFLSLSD WTS P+A
Sbjct: 482 LIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPYA 541

Query: 483 IKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLEEELYLN 542
           I+YLE IL  +  KLGP C+ +IWER+S  Y LR+DPRI              E+    +
Sbjct: 542 IQYLETIL--DECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGD 599

Query: 543 PHK---LHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFA 599
            +         I ++G TR RK A F+L+AA+KW +  Q RQ +W LK    +Y D+ F 
Sbjct: 600 GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFL 659

Query: 600 NAEGTLLSRL 609
           N +G +LS+L
Sbjct: 660 NGDGLILSKL 669

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  517 bits (1332), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 294/672 (43%), Positives = 409/672 (60%), Gaps = 62/672 (9%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST   ++H++E + + SLY
Sbjct: 2   VFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLY 61

Query: 61  KLLRYFGDYIQDRDQLDD--------------KISAKLQ--------PNNRRQRQNSLFQ 98
            LLR+FG  + DRDQ ++              + S+K Q            R R NSLFQ
Sbjct: 62  MLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQ 121

Query: 99  RNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCELLKH 154
           R+S  S+Y+RF  PL D+I   D + + FN   LE  L  +LK +  +T    P +LLK 
Sbjct: 122 RDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKK 181

Query: 155 SIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSK 212
           SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL +    
Sbjct: 182 SIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTES 241

Query: 213 FPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPI----FTNFRDR 268
           FP F+NTN++LPVF+LC++  S +++E  Q+L K +KKQLFVES+ LP+    F +  + 
Sbjct: 242 FPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVENS 301

Query: 269 SIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDE 328
           +I LH P+ +SL+E L+    P   KL   L+  IYD ++ +V DLMIPFM RKISFW+E
Sbjct: 302 NIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEE 361

Query: 329 TILQPRKSIFHSNKLLKRFISKS---SGSPTASMPTSPDG--HFLASSNEFLLRKLADWC 383
           TILQPRKS+F+  K  K+F++K+         S+     G  +F +SS+EFL+RKLADW 
Sbjct: 362 TILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWS 421

Query: 384 FMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIM 443
            MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA SIVT KMIKNDI+PLI 
Sbjct: 422 MMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIE 481

Query: 444 KYL------------------DYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAPFAIKY 485
           + L                     V   +   + RCMI  +ELFLSLSDTWTS P+AI+Y
Sbjct: 482 RALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQY 541

Query: 486 LEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLE----EELYL 541
           LE IL  +  KLGP  + ++WER+S  Y LR+DPR+              E    ++ Y 
Sbjct: 542 LETIL--DECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYD 599

Query: 542 NPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANA 601
             H      I ++G TR RK A F+L+AAKKW +  Q RQ +W LK     Y D+ F + 
Sbjct: 600 TDH-FTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHG 658

Query: 602 EGTLLSRLADAV 613
            G +LS L + +
Sbjct: 659 NGLILSNLKNQL 670

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  514 bits (1324), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 291/669 (43%), Positives = 422/669 (63%), Gaps = 66/669 (9%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
            SYE YMNL+++ D+ ++PVP++IS++++ NA++P I+V ST  L+QH+++ + I SLY 
Sbjct: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65

Query: 62  LLRYFGDYIQDRDQ-----------------LDDKISAKLQPNN----------RRQRQN 94
           L+RYFG  I DRDQ                 ++D+I  + + +N           R R N
Sbjct: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSRSN 125

Query: 95  SLFQRNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCE 150
           SLFQR+S  S YIRF  P+ D+I+  D+H +  +++ LE  L + L  I+++T +++  +
Sbjct: 126 SLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHK 185

Query: 151 LLKHSIFHKFIT-MLSSTT-LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPN 208
            LK S+FH+F +  +SSTT LSPY SFNHP+++L+ALDI++G+ YE AR+LL++FKN  N
Sbjct: 186 ALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNN 245

Query: 209 TLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIF--TNFR 266
            + +FP F++TND+L VF+LC+D  S +Q E  Q ++K +KKQLF ES+ LP++  ++  
Sbjct: 246 AVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSE 305

Query: 267 DRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFW 326
           D  + LH P  +SL E LY    P   +L   L+  IYD +  +V DLMIPFM RKISFW
Sbjct: 306 DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFW 365

Query: 327 DETILQPRKSIFHSNKLLKRFISKSSGSPTASM------PTSPDGHFLASSNEFLLRKLA 380
           +ETILQPRKS+FH NKL ++F+++SS S TA+        +  + +F +SS EFLLRKLA
Sbjct: 366 EETILQPRKSLFHGNKLFRKFMNRSS-SQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLA 424

Query: 381 DWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDP 440
           DW  M+SD+KTAYS YE LI D E +P Y++SC E+ A+S+LMGA +IVTAKMIKND++P
Sbjct: 425 DWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNP 484

Query: 441 LIMKYLD-YAVNNIISLD---------------QIRCMIYMTELFLSLSDTWTSAPFAIK 484
           LI + LD Y   +I++ +               + RCM+  +ELFLSL+DTWTS P+A+ 
Sbjct: 485 LIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYALS 544

Query: 485 YLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLEEELYLNPH 544
            LE IL +   KLG   + +IWER+S  Y +R DPRI                E      
Sbjct: 545 NLETILAE--CKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKI------ENNEGGQ 596

Query: 545 KLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGT 604
           +L    I ++G  R RK A F+LLAAKKW +  Q RQ +W L+    +Y DL F+     
Sbjct: 597 QLQTDDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPEL 656

Query: 605 LLSRLADAV 613
           +  +L D +
Sbjct: 657 IYQKLKDEL 665

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  513 bits (1320), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 294/673 (43%), Positives = 414/673 (61%), Gaps = 65/673 (9%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           + SYE YMNLL + D   + VP EI++++I NA++P I+V ST   ++H++E +K+ SLY
Sbjct: 2   VFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLY 61

Query: 61  KLLRYFGDYIQDRDQLDDKISAKLQ-------------PNNR------------RQRQNS 95
            LLR+FG  + DRDQ ++    + +             P N+            R R NS
Sbjct: 62  MLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNS 121

Query: 96  LFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCEL 151
           LFQR+S  S+YIRF  PL D+I   D + + FN   LE  L  +LK +  +T    P  L
Sbjct: 122 LFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNL 181

Query: 152 LKHSIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNT 209
           LK SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL + 
Sbjct: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241

Query: 210 LSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTN---FR 266
              FP F+NTN++LPVF+LC++  S +++E  Q+L K +KKQLFVES+ L ++ +   + 
Sbjct: 242 TENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIYD 301

Query: 267 DRSIV-LHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISF 325
           + S++ LH P+ +SL+E L+    P    L   L+  IYD ++ +V DLMIPFM RK+SF
Sbjct: 302 ENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSF 361

Query: 326 WDETILQPRKSIFHSNKLLKRFISKS--SGS---PTASMPTSPDGHFLASSNEFLLRKLA 380
           W+ETILQPRKS+F+  K  K+F++K+  +G+    + +  +  + +F +SS+EFL+RKLA
Sbjct: 362 WEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLA 421

Query: 381 DWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDP 440
           DW  MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA SIVT KMIKNDI+P
Sbjct: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINP 481

Query: 441 LIMKYLDYAVN----------NIISLD--------QIRCMIYMTELFLSLSDTWTSAPFA 482
           LI + L    N             SLD        + RCMI  +ELFLSLS+TWTS P+A
Sbjct: 482 LIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYA 541

Query: 483 IKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLE----EE 538
           I+YLE IL  +  KLGP  + ++WER+S  Y LR+DPRI              E    E 
Sbjct: 542 IQYLETIL--DECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEH 599

Query: 539 LYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPF 598
            Y   H      I ++G TR RK A F+L+AAKKW +  Q RQ +W LK     Y ++ F
Sbjct: 600 KYSTDH-FTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKF 658

Query: 599 ANAEGTLLSRLAD 611
            +  G +LS+L +
Sbjct: 659 LHGNGLILSKLKN 671

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  511 bits (1317), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 292/674 (43%), Positives = 411/674 (60%), Gaps = 71/674 (10%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST   ++H++E + + SLY
Sbjct: 2   VFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLY 61

Query: 61  KLLRYFGDYIQDRDQLDDKISAKLQPN----------------------------NRRQR 92
            LLR+FG  + DRDQ ++    K+ PN                              R R
Sbjct: 62  MLLRFFGGCVSDRDQANE---GKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSR 118

Query: 93  QNSLFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSP 148
            NSLFQR+S  S+YIRF  PL D+I   D + + FN   LE  L  +LK + E+T   +P
Sbjct: 119 SNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAP 178

Query: 149 CELLKHSIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNL 206
            +LLK SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL
Sbjct: 179 HDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNL 238

Query: 207 PNTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPI----F 262
            +    FP F+NTN++LPVF++C++  S +++E  Q+L K +KKQLFVES+ LP+    F
Sbjct: 239 NHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESF 298

Query: 263 TNFRDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRK 322
            +  + SI LH P+ +SL+E L+    P    L   L+  IYD ++ +V DLMIPFM RK
Sbjct: 299 IDDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRK 358

Query: 323 ISFWDETILQPRKSIFHSNKLLKRFISKSSGSPT---ASMPTSPDG--HFLASSNEFLLR 377
           +SFW+ETILQPRKS+F+  K  K+F++K+  + +    S+     G  +F +SS+EFL+R
Sbjct: 359 VSFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMR 418

Query: 378 KLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKND 437
           KLADW  MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA SIVT KMIKND
Sbjct: 419 KLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKND 478

Query: 438 IDPLIMKYL------------------DYAVNNIISLDQIRCMIYMTELFLSLSDTWTSA 479
           I+PLI + L                    +V   +   + RCMI  +ELFLSLSDTWTS 
Sbjct: 479 INPLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTST 538

Query: 480 PFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLEE-- 537
           P+AI+YLE IL  +  KLGP  + +IWER+S  Y LR+DPRI              E+  
Sbjct: 539 PYAIQYLETIL--DECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLR 596

Query: 538 --ELYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRD 595
             + +   H +    I ++G TR RK A F+L+AAKKW +    RQ +W LK     Y +
Sbjct: 597 NGDEHYTDHFIE-EDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSE 655

Query: 596 LPFANAEGTLLSRL 609
           + F +   ++LS+L
Sbjct: 656 IKFLHCNDSILSKL 669

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  508 bits (1309), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 302/703 (42%), Positives = 424/703 (60%), Gaps = 85/703 (12%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST  L+ H++E + I SLY
Sbjct: 2   VFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLY 61

Query: 61  KLLRYFGDYIQDRDQLDDKI-----------------------SAKLQP----NNRRQRQ 93
            LLRYFG  + DRDQ ++ +                       S + QP       R R 
Sbjct: 62  MLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRS 121

Query: 94  NSLFQRNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPC 149
           NSLFQR+S  S+YIRF  P+ DI+++  ++ +  +++ LE  L ++L+ I  +T N +P 
Sbjct: 122 NSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPY 181

Query: 150 ELLKHSIFHKFITM-LSSTT-LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLP 207
           ELLK+SI+H F ++ +SSTT LSPY +FNHPI++L+A+DI+ G+ Y+  R+LL+EFKNL 
Sbjct: 182 ELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLN 241

Query: 208 NTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFR- 266
            T   FP F+NTND+LP+F+LC+D +  +Q+E  QSL K +KKQLFVES+ LP++     
Sbjct: 242 TTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYE 301

Query: 267 -DRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISF 325
            D  + LH PI +SL+E +Y    P S KL   L+  IY+ ++S++ DLM+PFM RK+ F
Sbjct: 302 IDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKLLF 361

Query: 326 WDETILQPRKSIFHSNKLLKRFISKSSGSPTASMPT---SPDGHFLASSNEFLLRKLADW 382
           W+ETILQPR+S+FH  K LK+F++K++  P  ++ T     + +F  SS E L+RKLADW
Sbjct: 362 WEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLADW 421

Query: 383 CFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLI 442
             M+SD+KTAYS YE L RD + +P Y++SC E+ A SLLMGA SIVT KMIKNDI+PLI
Sbjct: 422 SMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPLI 481

Query: 443 MKYLDYAVNNIISLDQ-------------------IRCMIYMTELFLSLSDTWTSAPFAI 483
            + L    N  I+L Q                    RCMI ++ELFLSLSDTWTS P+AI
Sbjct: 482 ERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAI 541

Query: 484 KYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIH--------------------- 522
            YLE IL +   KLGP  +  IWER+S  Y+LRIDPRI                      
Sbjct: 542 TYLETILTE--CKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKV 599

Query: 523 -AXXXXXXXXXXXLEEELYLNPHKLHCGK-IQNQGFTRYRKEAVFQLLAAKKWLQCGQTR 580
            A            E +L     KL  GK I ++GFTR RK A F+L+AAKKW +  Q R
Sbjct: 600 VATPSTDKPKTIQWESDL---ESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWR 656

Query: 581 QGAWSLKRCNRVYRDLPFANAEGTLLSRLADAVVDSENSQRAN 623
           Q AW LK    +Y        +  ++++L + + ++      N
Sbjct: 657 QVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDGN 699

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  508 bits (1308), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 288/683 (42%), Positives = 418/683 (61%), Gaps = 69/683 (10%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
            SYE YMNLL + D   + VP EI+++++ NA+SP I+V ST  L+ H+ E + I SLY 
Sbjct: 3   FSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSLYM 62

Query: 62  LLRYFGDYIQDRDQ---LDDKISAKLQPNNR----------------RQRQNSLFQRNS- 101
           LLR+F   + DRDQ   L+     K+  NN                 R R NSLFQR+S 
Sbjct: 63  LLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPLPKVRTRGRSRSNSLFQRDST 122

Query: 102 -SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFH 158
            S+YIRF  PL D+I+  + + +  +++ LE  L  +L  I+++T +++P ELLK SI+H
Sbjct: 123 QSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSIYH 182

Query: 159 KFITM-LSSTT-LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAF 216
            F ++ +SSTT LSPY  FNHP+++L+A+DI+ G+ Y+  R+LL++FKNL ++   FP F
Sbjct: 183 SFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFPIF 242

Query: 217 INTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNF--RDRSIVLHP 274
           +NTND+LPV +LC+D    +Q+ET Q+L K IKKQLFVE + LP++ +    D  + LH 
Sbjct: 243 MNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHLHQ 302

Query: 275 PITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPR 334
           P+ +SL+E +Y  + P  + L   L++ IY+ ++S+V +LMIPFM RKI+FWDETILQPR
Sbjct: 303 PVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQPR 362

Query: 335 KSIFHSNKLLKRFISKSSGSPTASMPTS---PDGHFLASSNEFLLRKLADWCFMLSDYKT 391
           KS+FH  K LK+F++K++ +   ++ T     + +F ++S+EFL+RKLADW  MLSD+KT
Sbjct: 363 KSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKT 422

Query: 392 AYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDYAVN 451
           AY+ YE L  D E++P Y +SC E+ A+SLLMGA +IVT KM+KNDI+PLI K L    N
Sbjct: 423 AYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYEN 482

Query: 452 NIISLD------------------QIRCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKE 493
               L                   + RCMI  +ELFLSLSDTWTS P+AI YLE IL + 
Sbjct: 483 CATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILVE- 541

Query: 494 NLKLGPVCRNLIWERISFAYRLRIDPRIH----AXXXXXXXXXXXLEEEL---YLNPHKL 546
             KLG   + +IWER+S  Y LR+DPRI                  E ++    + P  L
Sbjct: 542 -CKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPL 600

Query: 547 HCGKIQN------------QGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYR 594
               + N            +GFTR RK A F+L+AAKKW +  + RQ +W L+  +  Y 
Sbjct: 601 TKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYS 660

Query: 595 DLPFANAEGTLLSRLADAVVDSE 617
            +  A+ +  +L ++ + +  +E
Sbjct: 661 KIGLADRDDLILKKIQNKLKTAE 683

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  501 bits (1291), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 281/667 (42%), Positives = 416/667 (62%), Gaps = 55/667 (8%)

Query: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60
           + SYE YMNL+++ D  ++ VP +I+++V+ NA++P I+V ST  L++H+EE + I SLY
Sbjct: 2   VFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLY 61

Query: 61  KLLRYFGDYIQDRDQLDD--------KISAKLQPNNR--------------RQRQNSLFQ 98
            LLR+FG  + DRDQ ++        K++ +   N +              R   NSL+Q
Sbjct: 62  MLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQ 121

Query: 99  RNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKH 154
           R++  S+Y+RF  PL D+I+  D + +  +++ LE  L E+L  +++      P  LLK 
Sbjct: 122 RDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKT 181

Query: 155 SIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSK 212
           SI+H F  +  S+T  LSP+  FNHPI++LLA+DIT+ E+YE A E L EFK++ N +  
Sbjct: 182 SIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPS 241

Query: 213 FPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIF-TNFRDRSIV 271
           FP+FINTND+LPVF+LC+++ +  ++E  Q+L   +KKQLFVES+ LP++ T F D  +V
Sbjct: 242 FPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVV 301

Query: 272 -LHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETI 330
            LH P+ +S++E ++   +PV  KL  +LV  IYD I+ +V DLM PFM RK++FW+ETI
Sbjct: 302 SLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETI 361

Query: 331 LQPRKSIFHSNKLLKRFISKSSGS---PTASMPTSPDGHFLASSN-EFLLRKLADWCFML 386
           L PRKS+FH  K  K+F++KS+ +   P + +  +   ++L+S++ EFL+RKLADW  M+
Sbjct: 362 LTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMV 421

Query: 387 SDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYL 446
           SD+KTAY+ YE L +DFE  P Y++SC E+ A+SLLMGA +IVTAKM+KN+I+P I + L
Sbjct: 422 SDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERAL 481

Query: 447 D--------------YAVNNIISLD----QIRCMIYMTELFLSLSDTWTSAPFAIKYLEV 488
                          +  ++ +S      + RCM   +ELFLSLSDTWTS PFAI YLE 
Sbjct: 482 GAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLET 541

Query: 489 ILQKENLKLGPVCRNLIWERISFAYRLRIDPRI-HAXXXXXXXXXXXLEEELYLNPHKLH 547
           IL +   KLGP+   +IWER+S  Y +RIDPRI H               +   N     
Sbjct: 542 ILNE--CKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKNADVFT 599

Query: 548 CGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLS 607
              I ++G TR RK A+F+L+AA+KW +  Q R+ +W L      Y DL   N E  L +
Sbjct: 600 TEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYT 659

Query: 608 RLADAVV 614
           RL + ++
Sbjct: 660 RLRNELI 666

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  484 bits (1246), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 292/670 (43%), Positives = 409/670 (61%), Gaps = 58/670 (8%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
            SYE YMNLL + +   + +P EI+R+++ +A++P I+V ST  L++H+++ + I SLY 
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 62  LLRYFGDYIQDRDQLDD-KISA--------KLQPNNRRQRQNSLFQRNS--SRYIRFQTP 110
           LLR+FG  + DRDQ  + K +A          +    R R NSLFQR+S  S+YIRF  P
Sbjct: 64  LLRFFGGCVSDRDQASESKANAPHSSSSLTTTKTTRARSRSNSLFQRDSTQSQYIRFTRP 123

Query: 111 LTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITML--SS 166
           L D++   D + + F+   LE  L ++L+ +E+ T + +  +LLK S++H F ++   S+
Sbjct: 124 LPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAISST 183

Query: 167 TTLSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVF 226
           TTLSP+ SFNHPI++L+ALDIT  + YE A+ LL++FKNL NT+ KFP +INT D+LPVF
Sbjct: 184 TTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLPVF 243

Query: 227 ILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFRDRS--IVLHPPITNSLQEQL 284
           +LC++  SP++ +  + L   IKKQLFVES+ LP++ N       I LH P+ +SL E +
Sbjct: 244 LLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLDEMI 303

Query: 285 YDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLL 344
           Y         L   L    YD +  +V  L+IPFM RKI+FW+ET+LQP+KSIFH +K L
Sbjct: 304 YFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSKFL 363

Query: 345 KRFISKSSGSPTAS---MPTSPDG--HFLASSNEFLLRKLADWCFMLSDYKTAYSIYEIL 399
           K+ +S++S S       +    DG  +F +SS E LLRKLADW  MLSD+KT Y+ YEIL
Sbjct: 364 KKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEIL 423

Query: 400 IRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDY----AVNNIIS 455
             D E +P Y++SC E+ A+SLLMGA +IVT KM+KNDI PLI + LD     A N  +S
Sbjct: 424 SHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTHLS 483

Query: 456 LDQI-----------------RCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKENLKLG 498
             +I                 RC+I  +ELFLSLSDTWTS P+AI YLE IL++   +LG
Sbjct: 484 NKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPYAINYLESILEES--RLG 541

Query: 499 PVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLEEELYLNPHK-------LHCGKI 551
           P  R +IWER+S  Y LR+DPRI +             EE   N H+       L+   I
Sbjct: 542 PCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNL--EEPADNEHRILNSQDDLNPSNI 599

Query: 552 QNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLAD 611
            +QG TR RK A F+LLAAK W + GQ +Q  W L     +Y  +   N +  +L+RL +
Sbjct: 600 VSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLRE 659

Query: 612 ----AVVDSE 617
               AV DS+
Sbjct: 660 EYNIAVSDSK 669

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  459 bits (1181), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 236/459 (51%), Positives = 322/459 (70%), Gaps = 14/459 (3%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
           LS+ KYMNL  + D   +PVP EISRK++ +A+SP ++V ST AL++H++E + + SLY 
Sbjct: 3   LSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSLYM 62

Query: 62  LLRYFGDYIQDRDQLDD--KISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVGD 119
           LLRYFGD + DRDQ +   ++  +   N  R R NSLFQR +S Y+RF  PLTD+I V +
Sbjct: 63  LLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDVRE 122

Query: 120 NHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTT--LSPYHSF 175
           +  +  +++ LE  L ++L  +E +T +D+P  LL+HSI+HKF T   S+T  LSPY SF
Sbjct: 123 SRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESF 182

Query: 176 NHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSP 235
           NHP+ +LLALDI++ + YE AR+LL+ FKN+ NT   FPAFIN ND+LPVF+LC+++ S 
Sbjct: 183 NHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSR 242

Query: 236 QQWETVQSLMKVIKKQLFVESVPLPIFTN----FRDRSIVLHPPITNSLQEQLYDSSHPV 291
           +Q+E  QSL K IKKQLFVES+ LP +          S +LH PI +SL+E +Y      
Sbjct: 243 EQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMKES 302

Query: 292 SLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKS 351
           ++ L   L+  IYD + +++++LMIPFM RKISFWDE+ILQPRKSIF ++K  ++ ISK+
Sbjct: 303 TITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKT 362

Query: 352 SGSPTASMPTSPD----GHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYP 407
              P AS   +       +F A+SNEF+LRKLADW FMLSD+K AYS YE+L +DFE  P
Sbjct: 363 PAPPPASDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRP 422

Query: 408 LYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYL 446
            Y++SC E+ ALS+LMGA SIVT KMIKNDIDPLI + L
Sbjct: 423 EYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRAL 461

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  439 bits (1129), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/662 (39%), Positives = 380/662 (57%), Gaps = 71/662 (10%)

Query: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
            SYE YMNLL + +  S+ VP +I+R+++ +A++P I+V S+ AL+ H+ E +K+ S Y 
Sbjct: 3   FSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSAYL 62

Query: 62  LLRYFGDYIQDRDQL------DDKISAKLQPNNRRQRQNSLFQRNS--SRYIRFQTPLTD 113
           L R FG  I DRDQL      DD  +        R+R NSLFQR++  S++IRF  PL D
Sbjct: 63  LFRLFGGCISDRDQLMEHYTLDDSSTG----GRTRKRSNSLFQRDATQSQFIRFAQPLPD 118

Query: 114 IISVGDNHQVEFND--LEESLSEFLKDIEEHTVNDS----------------------PC 149
           ++      Q  F++  LE  L+ +L  I++ T  D                       P 
Sbjct: 119 LLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPH 178

Query: 150 ELLKHSIFHKFITML--SSTTLSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLP 207
           +LL+++++H F  +   S+T +SP+ +FN P++ L+A+D+++G++YE+ R+L+  FKNL 
Sbjct: 179 KLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLN 238

Query: 208 NTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFRD 267
             L  FP FIN ND+LP+ +LC+D +   Q  T + L + IKK LFV+S+PL ++    +
Sbjct: 239 KFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPE 298

Query: 268 RSIV-LHPPITNSLQE--QLYDSSHPVS-----------LKLCPRLVKLIYDTINSMVED 313
             +V LH PI +SL E  + Y S+                 L   ++  +Y  ++ +V++
Sbjct: 299 SPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDE 358

Query: 314 LMIPFMNRKISFWDETILQPRKSIFH-SNKLLKRFISKSSGSPTASMPTSPDGHFLASSN 372
           ++IPFM+RK  +W+E ILQPRKSIFH SN   K+FI K+    T     S    F ASS 
Sbjct: 359 MLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKT----TTQRDPSDTQFFPASST 414

Query: 373 EFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAK 432
           E LLRKLADW  MLSD+KTAY  Y+ L  D +N P Y++SC E+ A+SLL+GA +IVT K
Sbjct: 415 ECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVK 474

Query: 433 MIKNDIDPLIMKYLDYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAPFAIKYLEVILQK 492
           MIK +I PLI + +        S  + RCMI   ELFL+L DTWTS P+AI+YLE IL +
Sbjct: 475 MIKTEITPLIERAVATYRQQGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETIL-R 533

Query: 493 ENLKLGPVCRNLIWERISFAYRLRIDPRIHAXXXXXXXXXXXLEEELYLNPHKLHCG-KI 551
           +  +LG   + +IWER+S  Y+ R DPR+ +                  +P     G +I
Sbjct: 534 DCPQLGACSQVMIWERLSDCYQSRTDPRVASALSTNT------------SPGSAQPGNEI 581

Query: 552 QNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLAD 611
             QGFTR RK A F+L+AAKKW + GQ RQ  W L     +Y      + +G L+ RL  
Sbjct: 582 LAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNT 641

Query: 612 AV 613
            V
Sbjct: 642 EV 643

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  426 bits (1094), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 243/586 (41%), Positives = 352/586 (60%), Gaps = 37/586 (6%)

Query: 67  GDYIQDRDQLDDKISAKLQPNNRRQRQNSLFQRNS--SRYIRFQTPLTDIISVGDNHQV- 123
            +Y+    + D+ +    Q    R R NSLFQR+S  S++IRF  P+ D++  G    + 
Sbjct: 135 NNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRPIEDLLYSGGTGDML 194

Query: 124 -EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTT--LSPYHSFNHPIL 180
            +++ LE  L   LK +E++T +D   + L+ S++H+F +   S+T  LSPY SFNHPI+
Sbjct: 195 FDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIV 254

Query: 181 ALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWET 240
           +L+A+DIT+G+ YELAR+LL+ FKN   T++ FP F++TND+LPVF+LC++ SS ++ E 
Sbjct: 255 SLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVFVLCYNGSSAEESEK 314

Query: 241 VQSLMKVIKKQLFVESVPLPIFTN--FRDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPR 298
              L K IKKQLF E + +P++      D ++ LH P  +SL E LY      + KL   
Sbjct: 315 STELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEMLYVFQTSKTDKLPLT 374

Query: 299 LVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSS--GSPT 356
           L+ LIYD +  +  DLMIPFM RKI+FW+ETILQP+KS+F   KL ++F+ + S      
Sbjct: 375 LINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRKFMGRPSMTNGRQ 434

Query: 357 ASMP---TSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSC 413
            ++P      + +F ++SN FLLRKLADW  M+SD+KTAY+ +E L+ D E YP Y++SC
Sbjct: 435 ENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASC 494

Query: 414 QEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDYAVNNIISLDQI-------------- 459
            E+ A+ +LMGA +IVT KMIKND++PLI + LD   N  + L+ I              
Sbjct: 495 LEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSIAESEESPDTEPVRS 554

Query: 460 ---RCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLR 516
              RCM+  +ELFLSLSDTWTS P+A+  LE IL +   KLG   + +IWER+S  Y LR
Sbjct: 555 YETRCMLITSELFLSLSDTWTSTPYALSNLETILSE--CKLGACSQIMIWERLSDCYNLR 612

Query: 517 IDPRI-HAXXXXXXXXXXXLEEELYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQ 575
            DPR+ H               E  +   K     I  +G TR RK + F+LLAAKKW +
Sbjct: 613 TDPRVKHKLRSNISTSSVSEVSEEEI--KKQDVSSIVLKGLTRQRKASFFRLLAAKKWAE 670

Query: 576 CGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLADAVVDSENSQR 621
             Q RQ +W L   + +Y+D  F   E  +  +L   ++  ENS++
Sbjct: 671 QHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLL--ENSKK 714

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 55/79 (69%)

Query: 2  LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
           +YE YMNL+ + D+  + VP++IS++++ NA++P I+V +T  L+ H+ E + I S Y 
Sbjct: 3  FTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSFYT 62

Query: 62 LLRYFGDYIQDRDQLDDKI 80
          LLRYFG  I DRDQ ++ I
Sbjct: 63 LLRYFGGCISDRDQSNEYI 81

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  395 bits (1015), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 255/633 (40%), Positives = 356/633 (56%), Gaps = 112/633 (17%)

Query: 90  RQRQNSLFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVN 145
           R+R NSLFQR+S  S+YIRF  P+ D+++  D     F+   LE  L  +LK IE +T  
Sbjct: 185 RKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTTP 244

Query: 146 DSPCELLKHSIFHKF--ITMLSSTTLSPYHSFNHPILALLALDITQGEEYELARELLMEF 203
           D P   LK S++H+F  +T+ S+T L P+ SF+HPI++LL++D+T  + Y+ A+E+L++F
Sbjct: 245 DMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIKF 304

Query: 204 KNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFT 263
           KN+ +    FP ++N ND+LPVF+LC+D SSP+Q +  + +   IKKQLF ES+ LP++ 
Sbjct: 305 KNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLWN 364

Query: 264 N---FRDRSIVLHPPITNSLQEQLY-------DSSHPVSLKLCPRLVKLIYDTINSMVED 313
           +     D+ + LH P+ +S+ E LY        +S     KL   LVK IY+ I ++  +
Sbjct: 365 DKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSVN 424

Query: 314 LMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPTAS--------------- 358
           L+IPFM RKI FWDETILQPRKSIF  NKL K F++++S   +++               
Sbjct: 425 LIIPFMQRKIRFWDETILQPRKSIFR-NKLFKSFMNRNSNVSSSTGTSSSEISNSISKHH 483

Query: 359 ---MPTSPDGH--FLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSC 413
              +    +GH  F A S EF LRKLADW  M+SD+KTAY+ YE L RD EN   YM+SC
Sbjct: 484 HSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASC 543

Query: 414 QEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLD-------------YAVNNI------- 453
            E+ A+S+LMGA +IVTAKM+KND+DPLI   L+                NNI       
Sbjct: 544 LEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNSRS 603

Query: 454 ------------------ISLDQIRCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKENL 495
                             I   +IRCM+ ++ELFLSLSDTWTS P+A++YLE IL   + 
Sbjct: 604 SISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILS--DY 661

Query: 496 KLGPVCRNLIWERISFAYRLRIDPRI-------------HAXXXXXXXXXXXLEEELYLN 542
           KLGP  + ++WER+SF Y LR+DPRI              A              E Y N
Sbjct: 662 KLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRN 721

Query: 543 PHK---------------------LHCG-KIQNQGFTRYRKEAVFQLLAAKKWLQCGQTR 580
             K                       CG  I + GFTR RK A F+L+AAKKW +  Q R
Sbjct: 722 DGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQWR 781

Query: 581 QGAWSLKRCNRVYRDLPFANAEGTLLSRLADAV 613
           Q  W LK    VY+++ F++ +  +L +L D +
Sbjct: 782 QLDWCLKDIENVYKEVGFSDRKDLILIKLKDQL 814

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 55/74 (74%)

Query: 2  LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61
           SYE YMNLL + D+ ++ +P +I+++++ N+++P ISV +T  L++H+++ + I SLY 
Sbjct: 3  FSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSLYM 62

Query: 62 LLRYFGDYIQDRDQ 75
          LLRYFG  I DRDQ
Sbjct: 63 LLRYFGGCISDRDQ 76

>NDAI0D03590 Chr4 complement(853792..856818) [3027 bp, 1008 aa] {ON}
           Anc_4.105 YGL016W
          Length = 1008

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 63/151 (41%), Gaps = 19/151 (12%)

Query: 375 LLRKLADWCFMLSDYKTAYSIYE----ILIRDFENYPLYMSSCQEFSALSLLMGAHSIVT 430
           + +KL D  +  S++   Y I E    I    F N PL MS        +L +G      
Sbjct: 218 IFQKLLDLMYHSSEHTDKYLIAEKVLTIFANVFANDPLLMSFPLREQVEALFLGISRSGN 277

Query: 431 AKMIKNDIDPLIMKYLDYAVNN------------IISLDQIRCMIYMTELFLSLSDTWTS 478
             + +N     +++Y++Y V N            I+   QI  +    +LF ++S    S
Sbjct: 278 GDIAQN---KWMLQYMNYLVTNEMTSELKDLTVCIVDFLQINTLDVCNKLFTTISTDKFS 334

Query: 479 APFAIKYLEVILQKENLKLGPVCRNLIWERI 509
              + +Y++V+LQ  N  L PV +     R+
Sbjct: 335 ESVSEQYIKVLLQMTNFPLVPVLQEFFSVRM 365

>TPHA0C01330 Chr3 (303967..303999,304095..305213) [1152 bp, 383 aa]
           {ON} Anc_7.210 YER044C-A
          Length = 383

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 9/67 (13%)

Query: 209 TLSKFPAFINTNDV----LPVF-----ILCFDQSSPQQWETVQSLMKVIKKQLFVESVPL 259
           T++ F   +N ND+    LP++      LC+ QSS  ++E ++ +++ ++  +      +
Sbjct: 97  TINSFSEGLNHNDIIRWILPLYKSFLCCLCYSQSSSNEYEQIERILECVQLMMISYCSKI 156

Query: 260 PIFTNFR 266
             FTNFR
Sbjct: 157 ENFTNFR 163

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 275 PITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPR 334
           P+ +SL + L   S  ++ K     +K IY + NS+V  LM  F N + S   ET+ Q  
Sbjct: 440 PVEDSLGKLLATLSKALNSKTYSETIK-IYKSTNSLVTYLMDNFQNNQKSVASETLFQEA 498

Query: 335 KS----IFHSNKLLKRFISK 350
            +      HSN++ KR +S+
Sbjct: 499 VTKLMDSLHSNEITKRAMSE 518

>ZYRO0G10032g Chr7 (799068..802061) [2994 bp, 997 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 997

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 55/134 (41%), Gaps = 15/134 (11%)

Query: 388 DYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLD 447
           D+  A  I  IL   F N P+ M   Q      + +G      A   KN+    +++Y++
Sbjct: 222 DFYQAEKILSILANVFANDPIIMGHPQREQLEVIFLGVSRTGNADSSKNE---WMLQYMN 278

Query: 448 YAVNN------------IISLDQIRCMIYMTELFLSLSDTWTSAPFAIKYLEVILQKENL 495
           + V N            ++   Q+  +    +LF  +S +  +     +Y++V+LQ  N 
Sbjct: 279 HLVTNEMTDDLKELAVCVVDFLQVNTLDMCNKLFTVISSSQVNGENLQQYVKVLLQLTNF 338

Query: 496 KLGPVCRNLIWERI 509
            L PV +     R+
Sbjct: 339 PLVPVLQEFFSVRM 352

>Suva_14.202 Chr14 (366776..368050) [1275 bp, 424 aa] {ON} YNL136W
           (REAL)
          Length = 424

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 484 KYLEVILQKENLKLGPV-CRNLIWERISFAYRLR-IDPR 520
           KY   +LQKE +KLG V     IWE++S +Y L+ ID R
Sbjct: 43  KYPVTLLQKETMKLGKVFTATDIWEKLSQSYNLKDIDRR 81

>Kpol_1058.32 s1058 (88551..94931) [6381 bp, 2126 aa] {ON}
           (88551..94931) [6381 nt, 2127 aa]
          Length = 2126

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 75  QLDDKISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVGDNHQVEFNDLEESLSE 134
           QL   I  ++Q      R +S  QR   + + + T L D++    +  ++F+D    L E
Sbjct: 828 QLMYNIELQIQKGAGSVRSSSKVQRRDFKLVLYLTALNDVLRESRSAILDFSD---ELIE 884

Query: 135 FLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTTLSPYHSFNHPILALLALDITQGEEY 193
           F++ +  +  N  P +++   I H  +  L++T +  Y  F+         DI Q E +
Sbjct: 885 FMRFLYTNITN-PPLDMITSIIVHNVLASLTTTEVVEYQMFSE------TSDIPQSERW 936

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,450,516
Number of extensions: 2904820
Number of successful extensions: 9730
Number of sequences better than 10.0: 66
Number of HSP's gapped: 9919
Number of HSP's successfully gapped: 75
Length of query: 623
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 507
Effective length of database: 40,180,143
Effective search space: 20371332501
Effective search space used: 20371332501
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)