Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43158.256ON1212121260590.0
AGR095W8.256ON1201122427700.0
SAKL0H17204g8.256ON1211122220750.0
Skud_12.1528.256ON1220125417290.0
KLLA0F18975g8.256ON1200122717250.0
Suva_10.1688.256ON1220125016550.0
Smik_12.1438.256ON1220115316490.0
NDAI0B023808.256ON1219123416260.0
YLR084C (RAX2)8.256ON1220115616130.0
Kpol_392.108.256ON1226124415840.0
KLTH0G13838g8.256ON1214122415800.0
ZYRO0C01804g8.256ON1209123515800.0
TPHA0B032508.256ON1215124115770.0
NCAS0B049808.256ON1204121915720.0
TDEL0F038308.256ON1195123415120.0
KNAG0G020008.256ON1202125614810.0
KAFR0B026908.256ON1210124514680.0
Kwal_56.235898.256ON1213124014261e-176
CAGL0L12144g8.256ON1156107212891e-156
TBLA0E043908.256ON1278119112891e-155
Skud_5.997.144ON22548752.2
NDAI0A058303.255ON15691714.5
NCAS0I017003.255ON15691715.6
NCAS0A104603.255ON15691715.6
CAGL0K11748g3.255ON15690706.7
CAGL0D06028g1.494ON577120736.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4315
         (1212 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...  2338   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...  1071   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   803   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   670   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   669   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   642   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   639   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   630   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   625   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   614   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   613   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   613   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   612   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   610   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   587   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   575   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   570   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   553   e-176
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   501   e-156
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   501   e-155
Skud_5.99 Chr5 complement(146889..147566) [678 bp, 225 aa] {ON} ...    33   2.2  
NDAI0A05830 Chr1 complement(1327489..1327914,1328336..1328380) [...    32   4.5  
NCAS0I01700 Chr9 complement(315266..315691,316042..316086) [471 ...    32   5.6  
NCAS0A10460 Chr1 (2077290..2077334,2077694..2078119) [471 bp, 15...    32   5.6  
CAGL0K11748g Chr11 (1131241..1131285,1131832..1132257) [471 bp, ...    32   6.7  
CAGL0D06028g Chr4 (571551..573284) [1734 bp, 577 aa] {ON} simila...    33   6.8  

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score = 2338 bits (6059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1153/1212 (95%), Positives = 1153/1212 (95%)

Query: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60
            MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD
Sbjct: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60

Query: 61   YYTYKGQQIFTGLADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVF 120
            YYTYKGQQIFTGLADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVF
Sbjct: 61   YYTYKGQQIFTGLADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVF 120

Query: 121  EGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKW 180
            EGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKW
Sbjct: 121  EGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKW 180

Query: 181  DATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNS 240
            DATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNS
Sbjct: 181  DATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNS 240

Query: 241  TNIETNALASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKI 300
            TNIETNALASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKI
Sbjct: 241  TNIETNALASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKI 300

Query: 301  RIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENS 360
            RIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENS
Sbjct: 301  RIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENS 360

Query: 361  TSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEY 420
            TSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEY
Sbjct: 361  TSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEY 420

Query: 421  DTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGKPSVTLTPSIPYP 480
            DTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGKPSVTLTPSIPYP
Sbjct: 421  DTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGKPSVTLTPSIPYP 480

Query: 481  GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNRWIYQNNENLKYDPLFRGYLDD 540
            GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNRWIYQNNENLKYDPLFRGYLDD
Sbjct: 481  GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNRWIYQNNENLKYDPLFRGYLDD 540

Query: 541  SPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQYAASNFT 600
            SPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMK            FQYAASNFT
Sbjct: 541  SPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNLLNGLFQYAASNFT 600

Query: 601  NTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDII 660
            NTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDII
Sbjct: 601  NTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDII 660

Query: 661  VDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSLSILNLT 720
            VDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSLSILNLT
Sbjct: 661  VDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSLSILNLT 720

Query: 721  IDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNG 780
            IDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNG
Sbjct: 721  IDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNG 780

Query: 781  AIAIDADSNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXXXXXXXXIVVYGEHEPE 840
            AIAIDADSNEVVTSGLPSVDDGIIYRGLFIND                  IVVYGEHEPE
Sbjct: 781  AIAIDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPE 840

Query: 841  YLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTM 900
            YLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTM
Sbjct: 841  YLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTM 900

Query: 901  VLFGRNYTLLVGGTFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAG 960
            VLFGRNYTLLVGGTFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAG
Sbjct: 901  VLFGRNYTLLVGGTFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAG 960

Query: 961  LLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVD 1020
            LLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVD
Sbjct: 961  LLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVD 1020

Query: 1021 GQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINAM 1080
            GQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINAM
Sbjct: 1021 GQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINAM 1080

Query: 1081 YYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDDTPAASEP 1140
            YYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDDTPAASEP
Sbjct: 1081 YYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDDTPAASEP 1140

Query: 1141 ATHEKHTKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLFGDHNAYEPLKPRINEAEML 1200
            ATHEKHTKK                             YLFGDHNAYEPLKPRINEAEML
Sbjct: 1141 ATHEKHTKKLAKIFVVLIALALALATVAVLGVVGVLFAYLFGDHNAYEPLKPRINEAEML 1200

Query: 1201 KTVPPEKLMKFI 1212
            KTVPPEKLMKFI
Sbjct: 1201 KTVPPEKLMKFI 1212

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1224 (45%), Positives = 774/1224 (63%), Gaps = 35/1224 (2%)

Query: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60
            M +H   +  L+ +  + +GS +  V  HF+I  +  P LDLS  RN +LL+FDDFQ F+
Sbjct: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60

Query: 61   YYTYKGQQIFTGLADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVF 120
            YY YKGQQ+FTG    + +SLIYYS  TYVQLA+L D   +++IVP+G DSFILSG G  
Sbjct: 61   YYNYKGQQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKL 120

Query: 121  EGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKW 180
            +  RLEHQL+YNLS+ E+TEIL + LE VNDIL DG++VYFGG FTY+DGN SGHS V+W
Sbjct: 121  QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQW 180

Query: 181  DATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLS-- 238
            +AT +++SLLPF GFG+GS VNNI+KL  S +LFVG+FS ++  +     +V +S     
Sbjct: 181  NATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQ 240

Query: 239  -NSTNIETNALASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHS----TMGELTIRVIN 293
             N T IETNAL SLR+S++  DG L+   F+CP  + DSW +PHS      GEL I+V++
Sbjct: 241  LNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLH 300

Query: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353
            ++ PSKIRIYNSK + N++ LFRIVTSPS+SIMNMTY+DP TG LA CDAWCPL P S L
Sbjct: 301  RIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNL 360

Query: 354  SNLAENSTSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGI 413
            ++ A  S  + +A   N+  VL+KWT  YQEFAF+N++ ++E+ FIA+DS+G+NVGL+G+
Sbjct: 361  TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGV 420

Query: 414  ELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGKPSVTL 473
            ELFQ EYD YVN+TLNQPNC  QQ  P S  +   +W+QG  D SY++ +     P V +
Sbjct: 421  ELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTAN--IWHQGATDASYLSANVVESNPMVNV 478

Query: 474  TPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNRWIYQNNENLKYDPL 533
             P IP+ G YTLNL TPGC  D TC +RGIVNVT+ A NGT LM RWIYQNN  LKYDPL
Sbjct: 479  KPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRWIYQNNYRLKYDPL 538

Query: 534  FRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQ 593
            + G+LD +P V +EW+ PI+ A    +MVADRV++IIDS++ L+              FQ
Sbjct: 539  YTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLD-DIRHPREKSLNGLFQ 597

Query: 594  Y--AASNFTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISR 651
            Y  A S+  N           I++ P  ++P   SL GQ+Y+  L +G  S   +A ++ 
Sbjct: 598  YTPAGSSLDNGI------QKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTP 651

Query: 652  RKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSN-QTNMASSLSFNGSISTIFRSN 710
            +  DWND+ V  Q  D  G + GI PYS GL  T   N  +  +S+L ++G+  + F  N
Sbjct: 652  KGTDWNDVDVTRQ--DVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLN 709

Query: 711  APSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNV 770
            + + SI+N+TIDGSE+L+F+N ++YN S+ S +  S   +LS LSA AN  +DL+  G++
Sbjct: 710  SETSSIINMTIDGSELLLFNNKFIYNTST-SQMLTSSMFQLSALSAAANSNNDLLFTGSI 768

Query: 771  QSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXX--XXXXX 828
               KH   +GA+A+DA+ N + TSG PS+    ++RG+++ND                  
Sbjct: 769  ADIKHGSAHGAVALDAEGN-IFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVAT 827

Query: 829  XXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIK 888
              +V+        LS + +TV +M+Y+K +N L + T+       +L ++DL       +
Sbjct: 828  GGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAR 887

Query: 889  ETFEIGEVINTMVLFGRNYTLLVGGTFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQL 948
            E    GE IN++VLFG + TLLVGG+F ++GC DLCLYN+   +W+ F  G I+G+I+QL
Sbjct: 888  EKLNPGERINSIVLFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQL 947

Query: 949  QFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELI 1008
            QF++   L+  G +      ++  +  DL    ++ + +  N   F  VLT+G+S  E +
Sbjct: 948  QFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYV 1007

Query: 1009 AHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGN 1068
            A DG QV+H+   +WK ++P + GQ +I+G++LL    +   S  KR+RVGNELVVI+G 
Sbjct: 1008 AEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLM--LNNPRSQNKRNRVGNELVVIHGQ 1065

Query: 1069 FSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSND 1128
             +S +YG+INAM+Y+F  W PYYF++   +  +  +P+GQ+FLN+D+S  +++ + L  +
Sbjct: 1066 MNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPL--E 1123

Query: 1129 NDNDDTPAASEPATHEKHTKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLFGDHNAYE 1188
                D+P  +EP       +K                             Y FGDHNAY+
Sbjct: 1124 VVVSDSPPTAEPK------RKLAKGYVVLIALGLALATIALLGIIGVILAYAFGDHNAYQ 1177

Query: 1189 PLKPRINEAEMLKTVPPEKLMKFI 1212
            PLKPRINE EMLKTVPPEKLMKFI
Sbjct: 1178 PLKPRINEDEMLKTVPPEKLMKFI 1201

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1222 (39%), Positives = 701/1222 (57%), Gaps = 53/1222 (4%)

Query: 17   LAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGLADE 76
            L  GSQ++ +    NI   + P +DLS+  N ++ +  DF+   +Y Y GQ+ FTG   E
Sbjct: 17   LVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGSITE 76

Query: 77   RKNSLIYYSNNTYVQLAELPD---GAEIKKIVPWGDDSFILSGRGVFEG-HRLEHQLIYN 132
             +  LIYYSN T+++L  L D    A+I  I+P+GDDSFILSG G   G H LE QL+YN
Sbjct: 77   TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYN 136

Query: 133  LSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPF 192
            LSS E T I  + +  VNDIL D E+VYFGG F Y  GN +GHSVV W++T     LLPF
Sbjct: 137  LSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPF 196

Query: 193  YGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPH-RNVSSSFLSNSTNIETNALASL 251
             GFG  SVVN+I++LD+ NI+F GKF+T+D+  LL   R  +SS   N+T+IE + L  L
Sbjct: 197  KGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS--KNATDIEFDQLIPL 254

Query: 252  RFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQ 311
            + +     G+L  S+ +CP   +D W    +  G+ T+ ++  + PSK+RIYN+ DS+ Q
Sbjct: 255  KHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDSDYQ 314

Query: 312  VNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENST-SSVMAAFPN 370
            V+LFRI+TSP+  IMN+TY+DP TG L+ CDAWCPL    +L     N T SS   A+  
Sbjct: 315  VSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIG 374

Query: 371  NNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQ 430
            NNN  +KWT+AYQEFAFVN V ++ LTF+A+DS+G +VGL G E++Q  Y T+ N+TLNQ
Sbjct: 375  NNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQ 434

Query: 431  PNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSF--TAGKPSVTLTPSIPYPGIYTLNLV 488
            PNCD+  ++  +V S    W QG  D SY+ +++  T   PSV   P+I Y G YTLN+V
Sbjct: 435  PNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFYPNITYAGDYTLNMV 494

Query: 489  TPGCLTDNTCAFRGIVNVTIRAQ-NGTHLMNRWIYQNNENLKYDPLFRGYLDDSPNVVLE 547
            TPGC  D +C+ RGIVNVT+  Q N T L  + IYQNN + KYD L+ GYL+ +P + L+
Sbjct: 495  TPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPKITLK 554

Query: 548  WIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQYAASNFTN-TNLST 606
            +   I+  ++ ++MVADRV  IIDSI+  ++             FQY  SNFT  +N S 
Sbjct: 555  FYESINTDSSTSIMVADRVDVIIDSIDQSKIG-LKTINETLNGLFQYQISNFTTISNDSL 613

Query: 607  LVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDPQLI 666
             +G+T I++Y + N+P +S LF   YN+TL +   + +G+A + +  DD N  I+  Q +
Sbjct: 614  KIGNTTINRYSIENVPSNSELFAGYYNNTLLV-DGAFNGIA-VLQLNDDLN--IISEQRM 669

Query: 667  DTEGPVTGIFPYSNGLALTVHSN-QTNMASSLSFNGSISTI--FRSNAPSLSILNLTIDG 723
             T GP  GI  YSNGL      N  +   S+LS+NG+ S+    R+N    +  N+TID 
Sbjct: 670  GTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFN--NITIDD 727

Query: 724  SEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIA 783
            SE+LVF+N Y++NVSS   I N+ +  LSL SAG+N ++D IL G V   ++   NGA+ 
Sbjct: 728  SELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVY 787

Query: 784  IDADSNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXXXXXXXXIVVYGEHEPEYLS 843
            I+ D+N + T GLPS D   +Y   +IND                  ++  G    +   
Sbjct: 788  IN-DANSISTIGLPSFDGKRVYTATYIND-SSTAYAYSSKNDSTHHVLIARGNRSEDLPV 845

Query: 844  TDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTMVLF 903
            +    VN M+Y KD +LLAV T+       SL + ++S      +E       +N +V F
Sbjct: 846  SWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAF 905

Query: 904  GRNYTLLVGGTFTRN----GCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVA 959
             +N +LLVGG FT +     C  LCLYNY  + W+ F + +I+G+I  LQF +G  L+++
Sbjct: 906  NKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLLIS 965

Query: 960  GLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFV 1019
            G L + +   + L ++++++ E+     G+     Q  +T  +++ ELI    N++ ++ 
Sbjct: 966  GNLYTENETGINLAKLNMASNEVTILRHGST--MVQSFVTFDHTTDELITQSDNEISYYT 1023

Query: 1020 DGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINA 1079
            +G+WKN++ +    +   G  L+      + +  KRD V N  +++NG+     YG ++A
Sbjct: 1024 NGEWKNLTSEDFNDSLYMGAQLIPL----KQTSSKRD-VSNRALLVNGDLKHSTYGSVSA 1078

Query: 1080 MYYDFNGWNPYYF----SVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDDTP 1135
            M YDF  W PY+     +  R SN         +F+NKD+S   ++Q  L   N +  T 
Sbjct: 1079 MLYDFEDWMPYFIVDGENAGRASN---------IFMNKDLSSLYTTQTILQGSNTSTSTT 1129

Query: 1136 AASEPA----THEKHTKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLF-GDHNAYEPL 1190
            +++ P+     +E  + K                             Y F G+   YEPL
Sbjct: 1130 SSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPL 1189

Query: 1191 KPRINEAEMLKTVPPEKLMKFI 1212
            KPR++E +M+ TVPPEKLMKF+
Sbjct: 1190 KPRVDEGDMIDTVPPEKLMKFV 1211

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1254 (34%), Positives = 683/1254 (54%), Gaps = 76/1254 (6%)

Query: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60
            M++H+   L+  F+A  ++ SQ+  + +  +I     P+L++S   ++ + I        
Sbjct: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60

Query: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118
             Y Y GQQ FT       NS  L+YYSNNTY+Q+ +  D   I KI P+G DSFILSG G
Sbjct: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120

Query: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178
                  + +Q++YNLS+  +  I  +PL  V  +L +G  VYFGG F+YN+G+++GHS +
Sbjct: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180

Query: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALL----PHRNVSS 234
             WD+    + LLPF GFG+ S VN+IIKL+D NILF GKF T+D+++ L     +   +S
Sbjct: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNS 240

Query: 235  SFLSNSTNIETNALASLRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVI 292
            + L N+T +E      LR+++    G  T  S++ VCP  + D+W  P +T G L  ++ 
Sbjct: 241  TSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYP-ATSGTLVCKLP 299

Query: 293  NQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSV 352
             +++P+K+R+YNS+DS+ ++++F+I+T+PS SIMN+TY+DP++G L  CD +CPL   + 
Sbjct: 300  YEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRAT 359

Query: 353  LSNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLL 411
            L + ++N +S + M +F +NNN  VKW++ +Q+FAF N +P+  L F AI+S+G +VGL 
Sbjct: 360  LLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLS 419

Query: 412  GIELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK--- 468
            G+EL+Q  + TY NN+LN+  C +  N  +S       WY GL  +SY+AT +   +   
Sbjct: 420  GLELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEP 479

Query: 469  -PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNE 526
             P V   P+I +PG Y +N  TPGC+ D+TC+ RGIVNVT+   QN T +    IYQNN+
Sbjct: 480  TPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNND 539

Query: 527  NLKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRV---TSIIDSIEDLEMKXXXX 583
            NLKYD ++ GYLD SP ++LE++  I  +    V+VAD+V   T ++D+   L       
Sbjct: 540  NLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTK 599

Query: 584  XXXXXXXXFQYAASNFTNTNLS-TLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSP- 641
                     QY  SNFT+T  + T +G+T ++ + V N P++SSLF     D L +G   
Sbjct: 600  EYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTN 659

Query: 642  ---SIDGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLAL---TVHSNQTNMAS 695
               SI GL       D+   ++ + Q+I  +G V G+   S GL +    + SN  N +S
Sbjct: 660  NHISIIGL------NDNLEVVLSEKQII--QGDVHGMTQTSQGLLIFGDLLSSN--NQSS 709

Query: 696  SLSFNGSISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLS 755
             L FNGS   +F  +    S +N+++  ++++VFDN Y+ N SS + I NS +  LSL S
Sbjct: 710  VLLFNGSFENVFNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWS 769

Query: 756  AGANLEDDLILAGNVQSTKHFVPNG-AIAIDADSNEVVTSGLPSVDDGII-YRGLFINDX 813
            AG+N  DD++ +G V   +    NG A  +  D  + +     ++D+ ++ Y   ++N+ 
Sbjct: 770  AGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQAL-----NLDNAVVPYLAAYLNES 824

Query: 814  XXXXXXXXXXXXXXXXXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLA 873
                             I      +P +     +++  MLY  + +LL V +  ++   A
Sbjct: 825  TTAYAYETNLLNK----IYFSNNVDPSW--NWSTSITRMLYANNQSLLTVGSESSTT--A 876

Query: 874  SLYIHDLSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATN 931
             L I +L        ET      IN +V F +N +LLVGG F  ++  C  LCLYNY + 
Sbjct: 877  ELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESK 936

Query: 932  NWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNT 991
            +W+ F +    G+I QL F   + L+++GL  + + + ++L   +L+N  +I  L G   
Sbjct: 937  SWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEG 996

Query: 992  GTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNS 1051
                 V+T       ++A +   +  + D +W NI+      + I  ++ ++T+ +   +
Sbjct: 997  KINSFVVT----EESIVAWNDTSLLIYRDQEW-NITSVPGNDSSIGSVSTINTN-AGPGT 1050

Query: 1052 IMKRDRVGNE---LVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQ 1108
            + +R     E   +++++GNFS PDYG++  + +DF  W+PY+  V   SN+    P   
Sbjct: 1051 LNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYF--VSESSNTSNRNPT-- 1106

Query: 1109 LFLNKDVSFTSSSQIYLSNDNDNDDTPAASEPAT---------HEKHTKKXXXXXXXXXX 1159
            +F+N+DVS   +SQI LSN N  +  P ++               K  K+          
Sbjct: 1107 IFINRDVSTEFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKSKKRIDRGFVVLIG 1166

Query: 1160 XXXXXXXXXXXXXXXXXXXYLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212
                               Y+F D    Y+P+KPRI+E EML TVPPEKLMKF+
Sbjct: 1167 LALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1227 (34%), Positives = 667/1227 (54%), Gaps = 55/1227 (4%)

Query: 6    YTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYK 65
            Y LLVL   AG+ +GSQ++ +    NI++Y AP+ D     +  L   ++F+     +Y 
Sbjct: 9    YVLLVL---AGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYT 60

Query: 66   GQQIFTGLADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRL 125
            GQQ FT  A+E  +SL+YYSN+T+V+L E      +  IVP  +DSFILSG G   G  L
Sbjct: 61   GQQNFTVQANE--SSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVAL 118

Query: 126  EHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDK 185
            E Q++ NL+S   + I    +E+V DILT  E V F G F+ +  N +GH  V WD    
Sbjct: 119  EQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVAN 178

Query: 186  SSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPH-RNVSSSFLSNSTNIE 244
            ++ L PF GFG+ S+VN+++KL+  NILF G F  I N +LL    N ++S   + T+++
Sbjct: 179  TTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQ 238

Query: 245  TNALASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYN 304
             +    L+ SS+  +  + S   +CP G  + W+   +    L   + N++ PSK+RIYN
Sbjct: 239  FDQSVPLKLSSITGEN-VQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYN 297

Query: 305  SKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSV 364
            S + N++++LFRI+T PS  IMN+TY+DP +G L  CDAWCPL  +  L+ +++NST++ 
Sbjct: 298  SVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAP 357

Query: 365  MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYV 424
             +   NNN+  +KW+ +YQEFAFVN +P+  L F+A+ S+G N  L  IE+F+ E+  Y 
Sbjct: 358  KSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYA 417

Query: 425  NNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGKPSVTLTPSIPYPGIYT 484
            NN+ N+PNC+S   +  + +S D  WY      +Y++T+     P VT  P+I YPG YT
Sbjct: 418  NNSYNEPNCESVTEYSKAELSSDN-WYTTDESDTYISTNIDDNIPYVTFHPNITYPGRYT 476

Query: 485  LNLVTPGCLTDNTCAFRGIVNVTI--RAQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSP 542
             N+ TPGCL DN+C+ RGIVNVT+  R+ N   L +  IYQ N   K+DPL+ G L  +P
Sbjct: 477  FNIYTPGCLQDNSCSKRGIVNVTMIDRSINEV-LASVLIYQTNNEDKFDPLYTGSLGSAP 535

Query: 543  NVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQYAASNFTNT 602
             +++ W   I    +++VMV DR+  I + I+ + +             FQY  +N T +
Sbjct: 536  EIIVTWDKAI--GESDSVMVVDRLGVITEYIDTISIS-SNDTTFHLNGLFQYNTANVTAS 592

Query: 603  NLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVD 662
              ST   +   + Y + N P  ++L+    N+ + IG  + +G+AK+    +    +I  
Sbjct: 593  IFST---NDTFNDYALYNFPLDANLYAASLNNDILIGG-NFNGIAKVELNDE---ALISS 645

Query: 663  PQLIDTEGPVTGIFPYSNGLAL--TVHSNQTNMASSLSFNGSISTIF-RSNAPSLSILNL 719
             Q + T G  TGIF YSNGL L  T      +    LS++G+    F + + P   I+N 
Sbjct: 646  SQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNF 705

Query: 720  TIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPN 779
            TIDG E+L+FDN Y++NVS+   +SNS T +++  SAG N  +D +L G+         N
Sbjct: 706  TIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELN 765

Query: 780  GAIAIDADSNEVVTSGLPSV-DDGIIYRGLFINDXXXXXXXXXXXXXXXXXXIVVYGEHE 838
            G  ++ +D  +V +  LP +  D   Y+  +IND                  +++   + 
Sbjct: 766  GLASLSSDG-QVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNS 824

Query: 839  PEYLSTDD--STVNDMLYIKDSNLLAVVTSG---TSQGLASLYIHDLSADFAPIKETFEI 893
              ++      + +N  LY    N+LA+ T+G   +SQ      I +L+      +  F  
Sbjct: 825  SSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFST 884

Query: 894  GEVINTMVLFGRNYTLLVGGTFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLD- 952
             E +N+MV F  N ++LVGG++  + C DLCLYNY T  WT F++ +ITGDIRQ+QF D 
Sbjct: 885  NERVNSMVSFSSNNSILVGGSYEIDNCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADE 944

Query: 953  GNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDG 1012
            G TL+V GL+ +++  ++QL+ +++ +  I S ++ + T      + + +S+  +IA   
Sbjct: 945  GKTLLVGGLIKTNNESNIQLLSVEVGS-NIFSTVK-SGTEPLLSFVPIDDSTDNIIAQMN 1002

Query: 1013 NQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSP 1072
            +++     G W +  P  +  + ++G  +LS   S+     KRD  G+ +V++ G  +S 
Sbjct: 1003 SEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTESK-----KRDE-GSHIVLLEGTLNSS 1056

Query: 1073 DYGDINAMYYD--FNGWNPYY-FSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDN 1129
            ++G++ ++ YD     W PY+  S P+E    E +P    F N +  + SSSQ  L ++N
Sbjct: 1057 EWGNLTSVVYDGSTQKWQPYFVISDPKE---QESLPSSSFFQNVNDLYLSSSQTVLQSNN 1113

Query: 1130 DNDDTPAASEPATHEKHT----KKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLFGDHN 1185
             +    +   P+T         KK                             Y F ++N
Sbjct: 1114 SDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNN 1173

Query: 1186 AYEPLKPRINEAEMLKTVPPEKLMKFI 1212
             YE LKPRIN+ EML TVPPEKLMKFI
Sbjct: 1174 GYESLKPRINQDEMLDTVPPEKLMKFI 1200

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1250 (34%), Positives = 673/1250 (53%), Gaps = 68/1250 (5%)

Query: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60
            M++H+   L L  +   ++ SQ+  +    +I     P L++S   ++ + I        
Sbjct: 1    MFVHRLWTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60

Query: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118
            +Y Y GQQ FT       NS  L+YYSNNTY+ L E  +   I KI P+G DSFILSG G
Sbjct: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120

Query: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178
               G  L +Q++YNLS+  +  I  + L  V  +L +   VYFGG F+YN+G+++GH  +
Sbjct: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180

Query: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLS 238
             WD+T  ++ LLPF GFG+ S VN+I+KL+D NILF GKF T+D++++L   + +++  S
Sbjct: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNAS 240

Query: 239  ---NSTNIETNALASLRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVIN 293
               N+T +E      LR++S    G  T  SS  VCP+ S D+W  P  T G L   +  
Sbjct: 241  STLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYP-GTSGSLVCTLPY 299

Query: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353
            ++ P+KIR+YNS +S+N ++LF+I+T+PS SIMN+TY+DPI+G L  CD +CPL     L
Sbjct: 300  EVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTL 359

Query: 354  SNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLG 412
             + ++N +SS+ M +F +NNN  VKW++ +Q+FAF N + +  L F A++S+G+ VGL G
Sbjct: 360  LSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSG 419

Query: 413  IELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSF----TAGK 468
            +EL+Q  + TY NN+LN+  C +  N  +S +  D  WY GL  QSY+A  +    T   
Sbjct: 420  LELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPT 479

Query: 469  PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNEN 527
            P+VT  PSI +PG YT+N  TPGC+ DNTC+ RGIVNVT+   QN T +    IYQNN N
Sbjct: 480  PTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNN 539

Query: 528  LKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXX 587
            LKYD ++ GYLD SP +V++++  I  +    +MVAD+V  I DS++             
Sbjct: 540  LKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKR 599

Query: 588  XX---XXFQYAASNFT-NTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSI 643
                    QY  SNFT  T+  T + +T ++ + V N P +SS+F  +Y+  L +G    
Sbjct: 600  HTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKD- 658

Query: 644  DGLAKISRRKDDWND--IIVDPQLIDTEGPVTGIFPYSNGLAL--TVHSNQTNMASSLSF 699
            + ++ I     D+ND   +   +    +G V G+   + GL +   V S+  N ++ L F
Sbjct: 659  NHISVI-----DFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSD-NKSTVLMF 712

Query: 700  NGSISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGAN 759
            NGS  ++   +    + +N+T+  ++++VF+N Y++N SS S ISNS +  LSL SAG N
Sbjct: 713  NGSFESVSNYSKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNN 772

Query: 760  LEDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDXXXXXX 818
              DD++ +G V   +    +G+       NE     L +++ GI+ Y G ++N+      
Sbjct: 773  DNDDVLFSGAVSQMQFSDLSGSARF---LNESTVEAL-NLNKGIVPYLGAYLNESTIAYA 828

Query: 819  XXXXXXXXXXXXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIH 878
                        I       P +  +++  +  M+Y  +  LL  V    S   A L I 
Sbjct: 829  YKTNSLSK----IYFSNNVSPSWNWSNN--ITKMVYANNQTLL--VIGSESSTTAELSIL 880

Query: 879  DLSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRF 936
            +L        ET      IN  V F +N +LLVGG F  ++  C  LC+YNY + +W+ F
Sbjct: 881  NLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTF 940

Query: 937  MDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQH 996
             +  I G+I QL F + + L+++GL A+   + ++L   +L+N  ++  L G+  G   +
Sbjct: 941  FNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGS--GGKLN 998

Query: 997  VLTVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKR- 1055
              TV   S  ++A +   +  + D +W   S   +G + ++ +T + T+ +   ++ KR 
Sbjct: 999  SFTVTEES--IVAWNDTSLLIYKDQKWNTTSLPGNGSS-VSSVTTIDTN-TDSYALRKRA 1054

Query: 1056 --DRVGNELVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNK 1113
              D     ++++NGNFS P YG++  + +D   W PY+ S   E++S        +F+N+
Sbjct: 1055 TTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSETLEASS----YNPTIFINR 1110

Query: 1114 DVSFTSSSQIYLSNDN---------DNDDTPAASEPATHEKHTKKXXXXX-XXXXXXXXX 1163
            DVS   +SQI LSN N               +++    ++K  KK               
Sbjct: 1111 DVSADFNSQIPLSNSNMTVTSPQSTSPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALA 1170

Query: 1164 XXXXXXXXXXXXXXXYLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212
                           Y+F D    Y P+KPRI+E EML TVPPEKLMKF+
Sbjct: 1171 LGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1153 (35%), Positives = 643/1153 (55%), Gaps = 51/1153 (4%)

Query: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60
            M++H+   L   F+A  ++ SQ+  + +  +I     P+L++S   ++ + I        
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118
            +Y Y GQQ FT       NS  L+YYSNNTY+QL +  D   I KI P+GDDSFILSG G
Sbjct: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120

Query: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178
                  + +Q++YNLS+  +  I  + L  V  +L +   VYFGG F+YN+G++ GHS +
Sbjct: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180

Query: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALL---PHRNVSSS 235
             WDA   ++ LLPF GFG+ S VN+I+KL+D NI+F GKF T+D++++L    +   +S+
Sbjct: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNST 240

Query: 236  FLSNSTNIETNALASLRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVIN 293
            F  N+T +E     SLR++S    G  TL S++ VCP  + ++W  P +T G L   +  
Sbjct: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYP-ATSGSLVCNLPY 299

Query: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353
            +++P+KIR+YNS+D+ +++ LF+I+T+PS SIMN+TY+DP++G L  CD +CPL   + L
Sbjct: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359

Query: 354  SNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLG 412
               ++N++SS+ M  F + NN  VKW++ +Q+FAF N +P+  L  IA++S+G ++GL G
Sbjct: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419

Query: 413  IELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---- 468
            +EL+Q  + TY NN+LN+  C +  N  +S +  +  WY GL  +SY+AT++   +    
Sbjct: 420  LELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPI 479

Query: 469  PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNEN 527
            P V   P+I + G YT+N  TPGC+ DNTC+ RGIVNVT+   QN T +    IYQNN+N
Sbjct: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539

Query: 528  LKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSI---IDSIEDLEMKXXXXX 584
            LKYD +F GYLD SP +VLE+I  I  +    V+VADRV  I   +D+   L        
Sbjct: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599

Query: 585  XXXXXXXFQYAASNFTNTNLS-TLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSI 643
                   FQY  SNFT T  + T VG+T ++ +PV N P ++SL  +IYND L +G  S 
Sbjct: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVS- 658

Query: 644  DGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQT-NMASSLSFNGS 702
                +IS    + N  I   +    +G V GI     GL +      + N ++ L FN S
Sbjct: 659  ---NRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNES 715

Query: 703  ISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLED 762
               +   +    S  N++I  +E+ VFDN Y+ N SS + ISNS +  LSL +AG N   
Sbjct: 716  FGKVPNYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNG 775

Query: 763  DLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDXXXXXXXXX 821
            D++ +G V   +    NG+ +     NE     L ++  GI+ Y G ++N+         
Sbjct: 776  DVLFSGTVSHMEFSNLNGSASF---KNEDQVQAL-NIGRGIVPYFGAYLNE----SVSAY 827

Query: 822  XXXXXXXXXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLS 881
                     I    +  P +  ++  T+  MLY  +  +L V  S  S   A L I +L 
Sbjct: 828  AYETDALNKIYFSNKVNPSWNWSN--TITRMLYANNQTMLVV--SSESSSTADLTIFNLR 883

Query: 882  ADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDG 939
                   ET      ++ +V F +N ++LVGG F  T+  C  LCLYNY T +W+ F + 
Sbjct: 884  NMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNN 943

Query: 940  NITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLT 999
             I G++ QL   + + L+++GL  + + + ++L   +L+N  ++  L G+  G     + 
Sbjct: 944  TIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSE-GKLNSFVV 1002

Query: 1000 VGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKR---D 1056
              NS   L+A +   +F + + +W NI+   S  + I  ++ +ST+ ++ +++ KR   +
Sbjct: 1003 TDNS---LVAWNDTSLFIYGNQKW-NITSLPSDDSLIGSVSTISTN-TKSDTLNKRATNN 1057

Query: 1057 RVGNELVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVS 1116
                 ++++NGNF+ P YG++ ++ +DF  W PY+ S    SNS    P    F+N+DVS
Sbjct: 1058 AHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFIS--EISNSSNYNP--TFFINRDVS 1113

Query: 1117 FTSSSQIYLSNDN 1129
               +SQI L N N
Sbjct: 1114 TEFNSQITLPNLN 1126

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1234 (34%), Positives = 666/1234 (53%), Gaps = 67/1234 (5%)

Query: 17   LAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTG--LA 74
            + Q SQ++ + N  N+T    P L+L+   +    +  D     +Y YKGQQ FT   + 
Sbjct: 15   ILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIP 74

Query: 75   DERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLS 134
                N LIYYSNNT +QL E  +   I KI P+G DSFILSG G   G+ L +QL+YNL+
Sbjct: 75   GSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLT 134

Query: 135  SFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYG 194
            +  I  I    +E V  IL D  +VYFGG FT  +G  + HS++ WD+T  S+  L F G
Sbjct: 135  TLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGG 194

Query: 195  FGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSS-SFLSNSTNIETNALASLRF 253
            FG+ S++N+I+KL+D NILF G+F T+D    L     SS + + NST ++   L  L  
Sbjct: 195  FGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSA 254

Query: 254  SSL-VHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQV 312
            S+    + T +S  FVCP+ + +SW I   T G LT ++  ++ P+KIRIYNS + +NQV
Sbjct: 255  STWDTGESTFDSDTFVCPDTTEESW-IQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQV 313

Query: 313  NLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTS-SVMAAFPNN 371
            +LFRI+T+ ++ IMN+TY+DPI+  L  CDA+CPL   ++LS    N+TS S       +
Sbjct: 314  SLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLAD 373

Query: 372  NNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQP 431
            N   +KWT  +QEFAF+N++ +  + F+A+DS+G+NV L   +L+Q  Y  + N+TLN+P
Sbjct: 374  NTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEP 433

Query: 432  NCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLV 488
            NC+S ++  +S +S +  W  GL  Q+Y++T++T  +   P V+ +P I YPG Y++N+ 
Sbjct: 434  NCNSIESSSSSSLSAND-WEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIY 492

Query: 489  TPGCLTDNTCAFRGIVNVTIRAQNGTHLM-NRWIYQNNENLKYDPLFRGYLDDSPNVVLE 547
            TPGC  D+TC+ R IVNVT+   +GT ++    IYQNN+ LKYD L+ GYL  SP V +E
Sbjct: 493  TPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIE 552

Query: 548  WIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXX---XFQYAASNFTNTNL 604
            ++  +  +     +VADR+  +IDS+E   +                 QY  SNF+ ++ 
Sbjct: 553  YVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSS 612

Query: 605  STL---VGSTNIDQYPVRNIPHSSSLFGQIYND-TLFIGSPSIDGLAKISRRKDDWNDII 660
             T    + +T+++Q  +     ++S++  +Y+D TL +G+   +G  K+ +  ++ +  I
Sbjct: 613  ETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNS--NGGIKVVKLNENMD--I 668

Query: 661  VDPQLIDTEGPVTGIFPYSNG-LALTVHSNQTNMASSLSFNGSISTI--FRSNAPSLSIL 717
                     G   G   YS G LA   ++  + +   +++NG+ + I  F  N+   +++
Sbjct: 669  ESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVV 728

Query: 718  NLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFV 777
            NLTI  +E+LV DN  +YNVSS S I+NS  L+LSL S+G+NL  D + +G +    +  
Sbjct: 729  NLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLDYTD 788

Query: 778  PNGAIAIDADSNEV-VTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXXXXXXXXIVVYGE 836
             NG+IAI  +     +T+ + S +   +Y GLF+ND                  +   G 
Sbjct: 789  LNGSIAIGNNFTVTNITNNVSSTNS--LYTGLFLND---SLSIYASKTDSYSELLFSNGY 843

Query: 837  HEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEV 896
              P         +N M+Y     +LAV +S  ++  + L I +L+       ET  +   
Sbjct: 844  SAPWSFF---EGINYMVYSSHQTMLAVASSDFNKN-SELSILNLTTFETIANETLNVNSK 899

Query: 897  INTMVLFGRNYTLLVGGTFT--RNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGN 954
            IN ++ F  N TL+VGG FT  ++ C  LCLYNY +N W  F + +I G I Q++ ++G 
Sbjct: 900  INGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGT 959

Query: 955  TLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQ 1014
             L+++GL  + +   + L  +DLS    +S ++  +    Q   T+G+   ++I  +G  
Sbjct: 960  QLLLSGLFNAQNISSVNLAIMDLSTYA-VSSIKMGDANILQSFATIGD---KIITWNGIM 1015

Query: 1015 VFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGN-ELVVINGNFSSPD 1073
            +  + +G W  I  + +  T I  +  +   F    ++ KRD  G+ +  +INGN    +
Sbjct: 1016 LESYENGAWSTIQSNFNSSTTIRSIEPIG--FGP--TLQKRDGTGSADGFIINGNIYDTE 1071

Query: 1074 YGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDD 1133
            YG I AM Y+F  W PYY  +   +NS      GQ+F+N+D S   +SQ  L N N+   
Sbjct: 1072 YGTIQAMIYNFKEWRPYY--IISSTNSQ---IAGQIFMNRDDSALYNSQSVLQNPNNATV 1126

Query: 1134 TPA------------ASEPATHEKHT--KKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY 1179
            T              +S+P  H+K    KK                             Y
Sbjct: 1127 TTPSSTSSGTPSATHSSQPH-HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAY 1185

Query: 1180 LFGDHN-AYEPLKPRINEAEMLKTVPPEKLMKFI 1212
            +F D + +++ L PR NE EML+TVPPEKLMKF+
Sbjct: 1186 IFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1156 (35%), Positives = 640/1156 (55%), Gaps = 57/1156 (4%)

Query: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60
            M++H+   L   F+  +++ SQ+  + +  +I     P+L++S   ++ + I        
Sbjct: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60

Query: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118
            +Y Y GQQ FT       +S  L+YYSNNTY+QL +  D   I KI P+G DSFILSG G
Sbjct: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120

Query: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178
                  + +Q++YNLS+  +T I  + L  V  +L D   +YFGG F+YN+G+++G+S +
Sbjct: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180

Query: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDN-TALLPHRNVSSSFL 237
             WD+   ++ LLPF GFG+ S VN+I+KL++ NILF G+F T+D+ +AL+   N  ++  
Sbjct: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNST 240

Query: 238  S--NSTNIETNALASLRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVIN 293
            S  N+T +E      LR++S    G  T  S + VCP  + D+W  P  T G L   +  
Sbjct: 241  SSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPD-TSGSLVCNLPY 299

Query: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353
            +++P+KIR+YNS+ S++++++F+I+T PS SIMN+TY+DP++G L  C  +CPL   + L
Sbjct: 300  EVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATL 359

Query: 354  SNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLG 412
             + ++N +SS+ M  F +NN   VKWT+ +Q+FAFVN +P+  L F+A++S+G +VGL G
Sbjct: 360  LSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSG 419

Query: 413  IELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---- 468
            +EL+Q  + TY N++LN+  C +  N  +S       WY GL  +SY+A  +   +    
Sbjct: 420  LELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPI 479

Query: 469  PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNEN 527
            P V   P+I +PG YT+N+ TPGCL DNTC+ RGIVNVT+   QN T +    IYQNN+N
Sbjct: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539

Query: 528  LKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSI---IDSIEDLEMKXXXXX 584
            LKYD ++ GYLD SP +VLE++  I       V+VAD+V  I   +D+   L        
Sbjct: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKK 599

Query: 585  XXXXXXXFQYAASNFTNTNLS-TLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSI 643
                    QY  SNFT+T L+ T VG+T ++ +PV+N P +SSL+  IY++ L IG   +
Sbjct: 600  ETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIG--GV 657

Query: 644  DGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLAL---TVHSNQTNMASSLSFN 700
                 I    DD+       Q I  +G V GI   + GL +    + SN  N ++   FN
Sbjct: 658  SNRISIVDLNDDFEVTSSKNQTI--QGDVHGITKTNQGLLIFGDILSSN--NQSAVFLFN 713

Query: 701  GSISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANL 760
            GS   +F  +    S LN+++  ++ +V DN YV N SS + I NS +  LSL +AG N 
Sbjct: 714  GSFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNG 773

Query: 761  EDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDXXXXXXX 819
            + D++ +G V   ++   NG++    + NE+    L   + GI+ Y G ++N+       
Sbjct: 774  DGDVLFSGAVSHMQYGNLNGSVRF-LNENEIEPLNL---EGGIVPYLGAYLNE----SAT 825

Query: 820  XXXXXXXXXXXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHD 879
                       I    E  P +     S +  MLY  +  LLAV  S  S   A L I D
Sbjct: 826  AYAYEVDSLNKIYFSNEVYPSW--NWSSGITQMLYADNQTLLAV--SAGSSTTAELSIFD 881

Query: 880  LSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFM 937
            L        ET      IN +V F +N ++LVGG F  T   C  LCLYNY +  W+ F+
Sbjct: 882  LRNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFL 941

Query: 938  DGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHV 997
            +  I G+I QL F + + L+++GL  + + + ++L   +L+N  +I  L G+        
Sbjct: 942  NNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFT 1001

Query: 998  LTVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKR-- 1055
            +T       ++A +   +F + + +W NI+      + I+ ++ + TD  + N++ KR  
Sbjct: 1002 VT----EDSIVAWNDTSLFIYRNQEW-NITSLPGNASSISSVSAIYTDI-ESNTLNKRGI 1055

Query: 1056 DRVGN-ELVVINGNFSSPDYGDINAMYYDFNGWNPYYFS-VPRESNSDEVIPQGQLFLNK 1113
            + V N  ++++NGNF+   YG + ++ +DF  W PY+ S     SN + +I     F+N+
Sbjct: 1056 NNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPII-----FINR 1110

Query: 1114 DVSFTSSSQIYLSNDN 1129
            DVS   +SQ  L+N N
Sbjct: 1111 DVSTEFNSQSPLANVN 1126

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1244 (35%), Positives = 662/1244 (53%), Gaps = 75/1244 (6%)

Query: 14   VAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGL 73
            + G++Q SQ+  V +   I     P ++     N ++ I  + +   +Y Y+GQQ FTG 
Sbjct: 13   IIGVSQASQLTNVKDSLGINTVNIPQINFGNTNN-EIQILSNIEGLTFYQYQGQQNFTGS 71

Query: 74   ADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIY 131
             D   N+  LIYYSN+T ++L E  D  +I +IVP  +D+FILSG G   G +LE+QL+Y
Sbjct: 72   IDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLY 131

Query: 132  NLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLP 191
            NLS   I  +    L+++  IL D ++VYFGG F+Y   N + +S++ W+   K+  +LP
Sbjct: 132  NLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLP 191

Query: 192  FYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSS-------SFLSNSTNIE 244
            F GFG+ S VN+I+KLD+ N+LF G FST+D+ +LL   N+++       S  S  TN+E
Sbjct: 192  FIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLV-SNITTYTQQNSTSSSSTETNLE 250

Query: 245  TNALASLRFSSLVHDGTLNSSA-FVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIY 303
                 SL+++S    G L SS  F+CP G  ++W+    T GE+T  +  + + SKIRI+
Sbjct: 251  LEQQISLKYASWASLGDLKSSTQFICPNGQNEAWS-SAGTTGEITCNLAFEASLSKIRIF 309

Query: 304  NSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSS 363
            NS    +Q+  FRIVT+PS  IMN+TY+DP+T  +  CDA+CPL   + L   +EN+T+S
Sbjct: 310  NSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTS 369

Query: 364  V-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDT 422
               +AF N N   + W+  YQEFAFVN+VP+  L  IA+ S+G NVGL G +L+Q  Y  
Sbjct: 370  ASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSI 429

Query: 423  YVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAG---KPSVTLTPSIPY 479
            + NN+LN+P CDS      S    + +WYQGL  QSY+AT +T G    P V   PSI  
Sbjct: 430  FANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINR 489

Query: 480  PGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMN-RWIYQNNENLKYDPLFRGYL 538
             G YT+N+ TPGC  D TC+FRGIVNVT+       L++   IYQNN  +KYD LF G+L
Sbjct: 490  IGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFL 549

Query: 539  DDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLE-----MKXXXXXXXXXXXXFQ 593
            D +P V LE+   I+   +  V+VAD V  +  +IE  E                   FQ
Sbjct: 550  DYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQ 609

Query: 594  YAASNFTNTNLSTL--VGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISR 651
            Y  SNFT++N ++   V +T+++ +PV     S SL+G  YN+TL +G  SI G+  +S 
Sbjct: 610  YQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGG-SIAGVYALSL 668

Query: 652  RKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTN-MASSLSFNGSISTIFRSN 710
               ++ + I   ++++T G VTG   Y+ G+ L  + N +N + SSLS+NG+  +    N
Sbjct: 669  S--NYTN-IRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVN 725

Query: 711  APSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNV 770
            +   +  NLT   SEIL F+N Y +N S+ S I N+  L LS+ SAG+N   D + +G +
Sbjct: 726  SNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLI 785

Query: 771  QSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDXXXXXXXXXXXXXXXXX 829
              T++  PN   +     N    S    + +GI  Y G+++ND                 
Sbjct: 786  --TRNEFPNLNNSAVLTGNGTAQS--LQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILF 841

Query: 830  XIVVYGE-HEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIK 888
               + G  + P  +S+   + N+ +++  S     +++G S   A L++ + +       
Sbjct: 842  SNGLQGNWNLPRSVSSAYYSDNETMFVGSS-----LSNGDSG--AELFVLNFTTMDLLYN 894

Query: 889  ETFEIGEVINTMVLFGRNYTLLVGGTFT--RNGCRDLCLYNYATNNWTRF---MDGNITG 943
            ETF++   IN++V FGRN +LLVGG FT     C +LCL N   N W+ F    DG ITG
Sbjct: 895  ETFDVNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFSNKFDGTITG 954

Query: 944  DIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNS 1003
                L+F + + L+++G     +   + L  IDL+N E  S L  +     Q V +   +
Sbjct: 955  ----LEFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDS-----QKVNSFNYN 1005

Query: 1004 SSELIAHDGNQVFHFVDGQWKNIS-PDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNEL 1062
            +  ++A D + ++ +    W N   P+T+  T I  + ++S   +  ++    + + +EL
Sbjct: 1006 NGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDEL 1065

Query: 1063 VVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQ 1122
            +++ G   S DYG + AM+YDF  W PYY + P  S +     +  LF+NKD+S    SQ
Sbjct: 1066 ILVFGELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLNTS---KNSLFMNKDISLLYESQ 1122

Query: 1123 IYLSNDNDNDDTPAASEPATHEKHT-------------KKXXXXXXXXXXXXXXXXXXXX 1169
            + L N N      + S  +   + +              K                    
Sbjct: 1123 VVLQNPNSTISISSTSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAI 1182

Query: 1170 XXXXXXXXXYLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212
                     Y+F D    Y  +KPRI+E EML TVPPEKLMKFI
Sbjct: 1183 LGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1224 (32%), Positives = 649/1224 (53%), Gaps = 48/1224 (3%)

Query: 14   VAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTG- 72
            +A    GS ++ + +   +  Y  P+LDLS  +N+++ +  +F+  +   Y GQ+ FTG 
Sbjct: 14   LAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGE 73

Query: 73   LADERKNSLIYYSNNTYVQLAELPDGAEI---KKIVPWGDDSFILSGRGVFEGHRLEHQL 129
            ++   +N+LIYYSN T++++    D +E+     IVP+ DD+FILSG G   GH+L  QL
Sbjct: 74   VSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQL 133

Query: 130  IYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSL 189
            ++NLSS E  EI  + L  VN I  +G+ V+FGG F Y   N + HS++ WD+      +
Sbjct: 134  LFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEV 193

Query: 190  LPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNALA 249
            LPF GFG+ S VN+I+ LD+SNILF G FS +DNT  L + NVS++  SN++  E     
Sbjct: 194  LPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNT--SNTSVPELGHQI 251

Query: 250  SLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSN 309
            SL+ ++ V DGTL+ SA  CP   +  W    ST G+  + +  +  PSK+R++N++DS+
Sbjct: 252  SLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSD 311

Query: 310  NQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSVMAAFP 369
             QV+LFRIVT+PS  IMN+TY+DP TG LA CDAWCPL     L++++  S       + 
Sbjct: 312  EQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYF 371

Query: 370  NNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLN 429
             N   L +W+ ++Q+FAFVN VP+ +LTFIA+DS+G +VGL GIEL+++ Y  Y NNTLN
Sbjct: 372  ENRTTL-QWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLN 430

Query: 430  QPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSF--TAGKPSVTLTPSIPYPGIYTLNL 487
             PNC        +++S  + W  G  + +Y++TS   +   P V   PSI YPG+YT+++
Sbjct: 431  APNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSVQDSETNPFVIFYPSIIYPGVYTIDV 490

Query: 488  VTPGCLTDNTCAFRGIVNVTIR-AQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSPNVVL 546
            +TPGCL D++C  RGI+N TIR  QN T L +  IYQNN+  K+D L+ G+LD    V L
Sbjct: 491  LTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTL 550

Query: 547  EWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQYAASNFTNTNLST 606
            E+ G I+      VMVA +   I+ +IED +                + +++ T++ LS 
Sbjct: 551  EFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFENNTSGFINGLLHYSTSNTSSFLSE 607

Query: 607  L--VGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDPQ 664
            L    +T++  Y V  +P  S++F  ++ D L +   + DG  +++R K   N++ ++  
Sbjct: 608  LGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVL--FTTDG--EMARLKLA-NNLSIEEY 662

Query: 665  LIDTEGP-VTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSLSILNLTIDG 723
              +T G  ++ I  YS GL +    N ++  ++  FNG+   +   N+   +  NLT+  
Sbjct: 663  TFETIGKDISTISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNLTLGQ 722

Query: 724  SEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIA 783
            +E+L+FD   + N ++   I ++  L L + SAG N  +D +  G V    +   NG+  
Sbjct: 723  TEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFF 782

Query: 784  IDADSNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXXXXXXXXIVVYGEHEPEY-L 842
            I  +S E V+    ++   + Y   F+++                  + V  +      L
Sbjct: 783  ISTNSEE-VSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQL 841

Query: 843  STDDSTVNDMLYIKDSNLLAVVTSGTSQGLAS-LYIHDLSA--DFAPIKETFEIGEVINT 899
            S     V  M   K+ +LLA+   G  Q   S L + + S+    A  K   EI   +N+
Sbjct: 842  SAWSGKVGAMASSKNDSLLAI--GGKDQHTDSQLLVTNSSSGESLASYKWDSEIS--LNS 897

Query: 900  MVLFGRNYTLLVGGTFTRNG--CRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLM 957
            ++ F RN ++LVGG+F  N   C  LCL+NY    W+ F++ +I G I +++  + + L+
Sbjct: 898  IIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLL 957

Query: 958  VAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFH 1017
            +AG    +++  + L  I L +    S++      T    +++  SS+ ++A     +  
Sbjct: 958  IAGSFRLNETDGVSLASICLKDSS--SEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQ 1015

Query: 1018 FVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDI 1077
               G+W+ IS + +  ++  GL +     + R    KRD   +++++I G+     +G I
Sbjct: 1016 LESGKWQQISTNFTENSKFKGLDVFPLKDTTRK--QKRDS-SSKVLLITGSLQHAKFGSI 1072

Query: 1078 NAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDDTPAA 1137
            NA +YD   W P+  S    S+SD  +    +FLN+D+S     + YL     ++ +   
Sbjct: 1073 NAAFYDSGEWTPFLSSNQATSSSD--LETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGT 1130

Query: 1138 SEPATH--------EKHTKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLFGDH-NAYE 1188
            S   +         ++  KK                             Y FGD  + Y+
Sbjct: 1131 SGTPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQ 1190

Query: 1189 PLKPRINEAEMLKTVPPEKLMKFI 1212
              KPR +E EM+ TVPPEKLM+FI
Sbjct: 1191 LSKPRTDENEMIDTVPPEKLMRFI 1214

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1235 (33%), Positives = 639/1235 (51%), Gaps = 57/1235 (4%)

Query: 6    YTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYK 65
            + LL   F+  +  GSQ++ +    N +    P LDL++ RN  L +  DFQ   +Y Y 
Sbjct: 4    FALLSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYT 63

Query: 66   GQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGH 123
            GQ+ FT   +   +S  LIYYSN+T++QLA   +  +IK+IVP G+DSFILSG G  +G+
Sbjct: 64   GQENFTSPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGY 123

Query: 124  RLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDAT 183
             L+ QL YNL+      I +E L  VN IL D  +VYFGG FT+++G+ +GHSVV W++ 
Sbjct: 124  NLQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSE 183

Query: 184  DKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNS--- 240
              S+SLLPF GFGQ S VN+II+LD  NILF G F  +D+  LL +  + S+  S+    
Sbjct: 184  KNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNW 243

Query: 241  TNIETNALASLRFSSLVHDGT-LNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSK 299
            T++E      L+ ++     +  ++  F+CP+   +SW +   T G L   +  + TP K
Sbjct: 244  TDVELGLAIPLQNANWTSSSSQFDADDFICPDPERESW-LQSGTSGSLACSLPQETTPYK 302

Query: 300  IRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAEN 359
            IRIYNS   +N+V+LFRI+  P++ I+N++YVDP  G L  CDA+CPL     L   + N
Sbjct: 303  IRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSN 362

Query: 360  STS-SVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQA 418
            S+S   M  F +NN   +KW   +QEFAFVN VPI  + F+A+ S+G NVGL   + FQ+
Sbjct: 363  SSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQS 422

Query: 419  EYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTP 475
                Y NN+LNQP C   Q++  + +S +  W QGL  Q+Y++TS+   +   P VT  P
Sbjct: 423  RASIYANNSLNQPACGKMQSYSNATISNND-WRQGLNGQTYLSTSYVEDQGNIPRVTFHP 481

Query: 476  SIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTH-LMNRWIYQNNENLKYDPLF 534
             I YPG Y++ L TPGCL D TC  R IVNVT+   +    L +  IY+NN  LKYD L+
Sbjct: 482  QIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELW 541

Query: 535  RGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQY 594
             G+L  SP V LE+  PI P    +V+VAD ++    S +  E              FQY
Sbjct: 542  DGHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDITLNGI---FQY 598

Query: 595  AASNFTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIY-NDTLFIGSPSIDGLAKISRRK 653
              SNFT       +G+T++D +P+    ++SSLF  +Y NDTL +     D  +K +  K
Sbjct: 599  QISNFTKNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLA----DSKSKAAEIK 654

Query: 654  DDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNMAS-SLSFNGSISTIFRSNAP 712
             D N  +   +  +    V GI  YS+GL L    N +     +LSFNGS ++  + N  
Sbjct: 655  LDKNWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRS 714

Query: 713  SLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQS 772
                 N+ + G+E+LVFDN + YNVSSQS +SN+    LS+ SAG N   DLI +G V  
Sbjct: 715  VERFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSD 774

Query: 773  TKHFVPNGAIAIDADSNEVVTSGLPSVDDGI-IYRGLFINDXXXXXXXXXXXXXXXXXXI 831
              +    G +++  + + V ++    + D I  Y G ++ND                  I
Sbjct: 775  NDYENLQGPVSLFQNGSAVSSN----IKDNINPYMGAYLNDTLTAYAYKDGSDSR----I 826

Query: 832  VVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETF 891
            V     E  +  T+  ++  M+Y     LLA+ TS +        + +L+       ET 
Sbjct: 827  VFSNGDEGPWRWTN--SIETMIYRNRDALLALGTSSSPSLPQLSVL-NLTTSEVLANETL 883

Query: 892  EIGEVINTMVLFGRNYTLLVGG--TFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQ 949
            + G  +N+M+LFG+N TLL+GG  +F+   C  LCLYNY    W+ F + +ITG + Q+Q
Sbjct: 884  DKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQ 943

Query: 950  FLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIA 1009
              + + L++AG L  + + D+ LV ++++   + + L+G        V+    S   L+ 
Sbjct: 944  LRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV----SEDRLVV 999

Query: 1010 HDGNQVFHFVDGQWKNISPDTSGQ-TQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGN 1068
             +   +  + +  W++IS   S   T++  +  +S + S             + +++ GN
Sbjct: 1000 WNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGN 1059

Query: 1069 FSSPDYGD-INAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSN 1127
              +   GD   A  YD+  W P + +  +  NS+       +F+N+DVS    S+  L N
Sbjct: 1060 DKTQ--GDSYQASIYDYYSWTPLFIANSKSENSNS---GPNIFMNQDVSDFFISEQMLPN 1114

Query: 1128 DNDNDDTPAASEPATH-------EKH--TKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1178
              ++  + ++S  ++        +KH  + K                             
Sbjct: 1115 PTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIA 1174

Query: 1179 YLFG-DHNAYEPLKPRINEAEMLKTVPPEKLMKFI 1212
            Y+FG D   YE L P     +  +T PP K  KF+
Sbjct: 1175 YMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1241 (33%), Positives = 638/1241 (51%), Gaps = 71/1241 (5%)

Query: 8    LLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQ 67
            L+VL  +A  A  S ++ ++   NI ++  P+L+ +   NS + +  D +   +Y Y+GQ
Sbjct: 10   LVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSNS-IQLLGDVENLQFYHYEGQ 68

Query: 68   QIFTGLADE---RKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHR 124
            Q FT   +      N+LIYYS++  +QL    +  +I+KI+P GDDSF+LSG G   G+ 
Sbjct: 69   QNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYA 128

Query: 125  LEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATD 184
            L  QL+YNL++  I  I  + L ++  IL D E+VYFGG FTY   + +  SV+ W+ T 
Sbjct: 129  LGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTS 188

Query: 185  KSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSF------LS 238
                 LPF GFG  S VN+I+KL+D NILFVG F T+ N++LL + N +S+F        
Sbjct: 189  DEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTY-NTTSNFSNFTNSTE 247

Query: 239  NSTNIETNALASLRFSSL-VHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTP 297
            NS+ I+     SL++++        + + FVC  GS+++W I     G L +   N ++P
Sbjct: 248  NSSTIQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAW-IVEGRSGNLQLNFPNTVSP 306

Query: 298  SKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLA 357
            SKIRIYN+  + + V+LFRIVTSPS  IMN+TYVDP+TG L  CDA+CPL   S L   +
Sbjct: 307  SKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETAS 366

Query: 358  ENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELF 416
             NSTS      F NNN   V W+ +YQEFAF+N + +  LT IA DS+G    L GIELF
Sbjct: 367  SNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELF 426

Query: 417  QAEYDTYVNNTLNQPNCDSQQN--FPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSV 471
            Q  +  Y NNTLNQP CD++    F +SV+S D  WY+GL   SY+A ++ +     P+V
Sbjct: 427  QDSHTAYANNTLNQPGCDTESTSLFSSSVLS-DNGWYKGLDSDSYIAANYQSDSSPLPTV 485

Query: 472  TLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNENLKY 530
               P+I   G +++ + TPGCL D TC  R IVNVT+    +GT L  + IYQNN  +KY
Sbjct: 486  QFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKY 545

Query: 531  DPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRV--TSIIDSIEDLEMKXXXXXXXXX 588
            D +F G L  SP + L +   I P   + ++VADRV  T    +++D+ +          
Sbjct: 546  DEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLK 605

Query: 589  XX-XFQYAASNFTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLA 647
                FQY  SNFT ++  T VG+ +I Q  +   P S SL G  +N+++F+   S   + 
Sbjct: 606  LNGLFQYQLSNFT-SDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAG-STSNIV 663

Query: 648  KISRRKD-DWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSN--QTNMASSLSFNGSIS 704
            ++    D +  + +V    +D  G  T I  YS GL      N   TN+  +LSFNG+ S
Sbjct: 664  QLQLNSDLELRNTVV----VDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFS 719

Query: 705  TIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDL 764
            +  +      +  N T +GSE+L F+N Y+YNVSS+S I N+     S+L+ GAN  +D 
Sbjct: 720  SFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDT 779

Query: 765  ILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXX 824
            +L GN+  +++   N  + +  +S+    +   S+   + Y  +F+ND            
Sbjct: 780  LLLGNIVRSEYSNFNEPLKLYGNSSLESLTFSSSI---VPYAAVFLNDTANLYAYKDGEN 836

Query: 825  XXXXXXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADF 884
                   ++YG +    L     T+N + +  +S+LL    + T+ G +SL I ++S   
Sbjct: 837  SK-----IIYGNNMTTSLDF-SGTLNKLSFSNNSSLL-FANAITNNGSSSLVISNISDGM 889

Query: 885  APIKETFEIGEVINTMVLFGRNYTLLVGGTFTRN--GCRDLCLYNYATNNWTRFMDGNIT 942
            +   E       I +M+ F  N T+LV G FT +   C  +CLYNY T  W+ F +  I 
Sbjct: 890  SLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIK 949

Query: 943  GDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLS--NMEIISKLQGTNTGTFQHVLTV 1000
            G I ++Q  + + ++++GL ++ +   + L  +D+   N+ ++S        +F H    
Sbjct: 950  GSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIH---- 1005

Query: 1001 GNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGN 1060
                  +     + +  +   +W  IS   +    I  +  +S D     S + +     
Sbjct: 1006 --DGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDLQNSTSNVSK----- 1058

Query: 1061 ELVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSS 1120
             ++   G F+S  YG +NAM +    W PY+     + N D   P   LF N+D+S   +
Sbjct: 1059 -ILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNED---PAITLFENRDLSSLFN 1114

Query: 1121 SQIYLSNDNDNDDTPAASEPATH---------EKHTKKXXXXXXXXXXXXXXXXXXXXXX 1171
            S+  L  +  + +T + S  ++          E    K                      
Sbjct: 1115 SKNSLPANITSAETSSRSTVSSATATTVVNKIEGKHSKIDRGFVVLIALALAVGTVALLG 1174

Query: 1172 XXXXXXXYLFGDHNAYEPLKPRINEAEMLKTVPPEKLMKFI 1212
                   Y+F D   YE +KPRI+  EML TVPPEKLMKFI
Sbjct: 1175 LFGVTIAYIFRDEQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1219 (35%), Positives = 661/1219 (54%), Gaps = 58/1219 (4%)

Query: 20   GSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTG--LADER 77
             SQ++ +  + NIT    P+L+L+T  NS  L+     +  +Y Y GQQ FT   L +  
Sbjct: 18   ASQLSSLQENLNITHINIPNLNLTTDDNSFELL-GGIDSLSFYRYTGQQNFTSGILPNSN 76

Query: 78   KNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLSSFE 137
             N L YYSNNT++QL E    + I++I+P+G DSFILSG+G   G+ L +QL++NLSSF 
Sbjct: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFS 136

Query: 138  ITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYGFGQ 197
            + +I  + L+ VN IL DG VV FGG FT +  +L+GHSV  W+ T  S+SLLPF GFG+
Sbjct: 137  LKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196

Query: 198  GSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNALASLRFSSLV 257
             S++N+I KL+D NILF GKF T+DN+ LL   NV +  + N ++I    L  L  ++  
Sbjct: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL---NVVNDTMRNISDINLGQLIPLSAATWS 253

Query: 258  HDGT-LNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFR 316
              G+  +   FVCP+ + ++W   + T G L   +   + P+KIRIYNS D +N+++LFR
Sbjct: 254  STGSFFDEETFVCPDPTIEAW-FQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFR 312

Query: 317  IVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENST-SSVMAAFPNNNNVL 375
            I + PS SIMN+TY+DP+ G L  CDA+CPL    VL + +EN T SS M    N+N   
Sbjct: 313  IFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSD 372

Query: 376  VKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDS 435
            ++W+  +QEFAFVN++    L F+A++S+G NVGL   +++Q  Y  + NN+LN+P+C+S
Sbjct: 373  IRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNS 432

Query: 436  QQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLVTPGC 492
             ++F +S +S +T W +G+ DQ+Y+ T++   +   P VT  P + Y G Y++ L TPGC
Sbjct: 433  LESFSSSDLSNNT-WTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGC 491

Query: 493  LTDNTCAFRGIVNVTIRAQNGTHLMN-RWIYQNNENLKYDPLFRGYLDDSPNVVLEWIGP 551
              DNTC+ RGIVNVT+   N   +++   IYQNN+ LKYD L+ GYL+ SP + + +   
Sbjct: 492  QQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVTYHSG 551

Query: 552  IDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQYAASNFTNTNLST---LV 608
            I        +V DR+  +I+S++ L               FQY  SNF+ ++  +    V
Sbjct: 552  IYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARV 611

Query: 609  GSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDPQLIDT 668
             +T+I+Q  +     + SL   +YNDTL +G+   DGL+     KD     I        
Sbjct: 612  ANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGD-DGLSIYELNKD---LAIQSSSQQGI 667

Query: 669  EGPVTGIFPYSNGLALTVHSNQTNMASS-LSFNGSISTIFRSNAPSLSILNLTIDGSEIL 727
            EG +TG+  YSNG+ +    N +  +S+ LSFNGS  +I    +P  +  N+TID SE+L
Sbjct: 668  EGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDDSELL 727

Query: 728  VFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDAD 787
            VFDN  ++NVSS S ISN+ +  LSL S+G+N   D + +G +   +    +G+++I   
Sbjct: 728  VFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSI--- 784

Query: 788  SNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXXXXXXXXIVVYGEHEPEYLSTDDS 847
            +N +  + L S+  G  Y  +F+ND                  I   G   P   +    
Sbjct: 785  ANNLSATSLRSI--GSPYAAIFLND--SVTGYVLKNDSSTSEMIFSDGSKAPWRWT---G 837

Query: 848  TVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTMVLFGRNY 907
             V+ MLY+ + ++LAV +S +  G   L I +L +      ET      + TMV F RN 
Sbjct: 838  YVDSMLYLTNQSMLAVGSSSSVNG--ELSILNLDSFKVLANETLNQNSSVKTMVHFERNS 895

Query: 908  TLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASS 965
            ++LVGG F  +   C  LCLYNY  N W  F++G I G I +LQ  + + L++AG+  + 
Sbjct: 896  SILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTK 955

Query: 966  DSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKN 1025
                + L  ++L++ +++    G      +  +T+ ++   + A +   +F +    W +
Sbjct: 956  SQSSVNLALMNLTDNKLVLIRWGFKEPV-KDFITIDDN---IFAWNETSLFEYTSNSWVD 1011

Query: 1026 IS-PDTSGQTQINGLTLLSTDFSQRNSIMKRD--RVGNELVVINGNFSSPDYGDINAMYY 1082
            I   +++  T I+ +   +T     N++ KRD     N ++++ G      YG I AM Y
Sbjct: 1012 IPISNSNSSTTIDSIGWTTT---TDNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIY 1068

Query: 1083 DFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDNDDTPAASEPAT 1142
            +F  W PY       S++++     +LF+++DVS    SQ+ L   N      A+S   T
Sbjct: 1069 NFEEWIPYLSINSLVSSANQ---PAELFIDRDVSKLFDSQLALQVSNTTASITASSSTPT 1125

Query: 1143 HEKHTKKXXXXX--------XXXXXXXXXXXXXXXXXXXXXXXXYLFGDHNA-YEPLKPR 1193
                 KK                                     Y F D +  Y+ + PR
Sbjct: 1126 PTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPR 1185

Query: 1194 INEAEMLKTVPPEKLMKFI 1212
            +NE EMLKTVPPEKLM+FI
Sbjct: 1186 VNEDEMLKTVPPEKLMEFI 1204

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1234 (34%), Positives = 651/1234 (52%), Gaps = 67/1234 (5%)

Query: 6    YTLLVLSFVA-GLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTY 64
            Y LL L F +  L+  SQ+  + N   I     P LD        L +F  F    +  Y
Sbjct: 2    YGLLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLFGGFNALTFPQY 58

Query: 65   KGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEG 122
            +GQ+ FTG  +   +S  ++YYSN+T+++L      + ++KIVP+G +SFIL G G   G
Sbjct: 59   EGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLG 118

Query: 123  HRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDA 182
            + L  QL+YNLS   +  I +  L  V  IL D  V YFGG F++++G+  GHSV  W++
Sbjct: 119  YELGRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNS 178

Query: 183  TDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTN 242
            +  ++SLLPF GFG+ S+VN+IIKLD  NILF G+F T+D+  LL   N ++S  ++S +
Sbjct: 179  SSNTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLI-TNENTSKTNHSQS 237

Query: 243  IETNALASLRFSSL--VHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKI 300
            IE N L  LR ++     D + +SSAF+CP    ++W++P ST G L   +  +  P K+
Sbjct: 238  IEINELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSVP-STSGSLEASLPYESYPKKV 296

Query: 301  RIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENS 360
            RIYNS + +N V+LFRI+T PS  IMN+TYVDP++G L  CDA+CPL     L     N 
Sbjct: 297  RIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANG 356

Query: 361  TSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEY 420
             +S +    +NN   ++W+  YQ+FAFVN++ + +L F+A+ S+G  VGL   +L+Q   
Sbjct: 357  NTSQVVRL-DNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTL 415

Query: 421  DTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSI 477
             TY NN+LN+  C+S      S +S D+ W QGL  QSY+   F  G+   P VT  P+I
Sbjct: 416  TTYANNSLNEVGCESNDIASTSALS-DSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAI 474

Query: 478  PYPGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNR-WIYQNNENLKYDPLFRG 536
             Y G YT+NL TPGC +D TC  R IVNVT+ ++ G  +++   ++QNNE +KYD ++ G
Sbjct: 475  NYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSG 534

Query: 537  YLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQYAA 596
            +L+ +P + LE+  PI P   +NV+VADR+  I++S++ L  K            FQY  
Sbjct: 535  HLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDIL--KNQTDETIPLNGMFQYQL 592

Query: 597  SNFTN-TNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDD 655
            SNFTN T+    + +T ++ Y V+N P ++SLF  +YN+TL++G  S+ G+A +   +D 
Sbjct: 593  SNFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGG-SVSGVAAVELDEDL 651

Query: 656  WNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNM-ASSLSFNGSISTIFRSNAPSL 714
                +       T G V GI  YS+G+ L    N ++   S+L+FNG   +         
Sbjct: 652  H---VSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLR 708

Query: 715  SILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTK 774
            +  N++    E+LVF+N YV+N+SS S ISNS T  LSL SAG N  DD + +G V  TK
Sbjct: 709  TYTNVSFQQDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAV--TK 766

Query: 775  HFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDXXXXXXXXXXXXXXXXXXIVV 833
            +  P    +    SN  V     S+ +G   Y    +ND                    +
Sbjct: 767  NQFPGLYGSASIYSNSSVAHF--SLQNGAQPYAACHLNDSVTAYAYRYGSVSQ------L 818

Query: 834  YGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSG-TSQGLASLYIHDLSADFAPIKETFE 892
            Y ++  E   T   T+N M Y K+S +LA+ T G T + + SL+  +L++       T  
Sbjct: 819  YFDNGKEGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLF--NLTSFDVLANTTIS 876

Query: 893  IGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQF 950
                I++MV F RN +LLVGG +  +   C  LCLYNY    WT+F + +ITG+I ++Q 
Sbjct: 877  ENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQL 936

Query: 951  LDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAH 1010
             +   L+++G +  ++   + L+  ++SN E+   +  +N G  +  +   N   ++I  
Sbjct: 937  SESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSN-GPIKSFIAEDN---DIITW 992

Query: 1011 DGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVG---NELVVING 1067
            +   +  + DG W+N+  D S    I  +  + T+     ++ KR       + ++V   
Sbjct: 993  NETSLSGYSDGDWQNLEFDNSSLISIVDVIAVKTE----PALDKRQTFSSTFDAILVAGQ 1048

Query: 1068 NFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYL-- 1125
            N++      I    Y+F  W PYY +   +   DE   +   F N+D S    SQ  L  
Sbjct: 1049 NYAEYPQASI----YNFQRWLPYYVANKAD---DEDPSRTTFFTNQDDSQLYDSQNLLSD 1101

Query: 1126 -------SNDNDNDDTPAASEPATHEKHTKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1178
                   S+ +    +  +    +  + + K                             
Sbjct: 1102 PTRTTTSSSSSTTSSSQTSPSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLA 1161

Query: 1179 YLFGDHNAYEPLKPRINEAEMLKTVPPEKLMKFI 1212
             +F  H+ YE + PR +E+EM+ TVPPEKL+KF+
Sbjct: 1162 LVFNGHSGYEQVDPRADESEMIDTVPPEKLLKFL 1195

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1256 (32%), Positives = 638/1256 (50%), Gaps = 122/1256 (9%)

Query: 10   VLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQI 69
             L F   + + S +  V    N T+ T P  D+   +N+Q  I DD     +Y Y GQQ 
Sbjct: 8    CLWFAVAITRASNLENVRRILNATEVTVPTFDVGN-KNNQFQILDDINGISFYEYLGQQN 66

Query: 70   FTGLADERK-NSLIYYSNNTYVQLAE-LPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEH 127
            FT  A+      LIYYSN T++ L++ +   A+I+ I+P GDDSFILSG+G+     L  
Sbjct: 67   FTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLAS 126

Query: 128  QLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSS 187
            QL++N++   IT+I   PL  +  +  DG +VYF G FT+N+        + WD+ D+S 
Sbjct: 127  QLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIMWDSRDRSI 182

Query: 188  SLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNA 247
            +LLPF+GFG  + +N+I+KL+D NILF G FST+ N++LL   NVS   + N+T++  N 
Sbjct: 183  NLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLLNP 242

Query: 248  LASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKD 307
               L++S    +G L+SS  +CP+ S DSW++  +T G+ T  +  Q+TPSKIRIYNS D
Sbjct: 243  SVPLQYSQWKTNGELDSSQLICPDPSKDSWSV-SATTGDFTCELPFQITPSKIRIYNSPD 301

Query: 308  SNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSVMAA 367
             ++QV+LFR +T P+ SIMN+TY+DP++G +  CDA+CPL   +VL +  +N+  +   A
Sbjct: 302  KDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTVA 361

Query: 368  FPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNT 427
              NNN+  ++WT  YQEFA V+ V    L F A+ S+G+N+GL G +++QA +  + NN+
Sbjct: 362  IINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNS 421

Query: 428  LNQPNC-----DSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSIPY 479
             N PNC     DS   F +S +S +     G     Y+   +T  +   P VT    I +
Sbjct: 422  FNTPNCNNNDKDSNNTFTSSSLSPNNWTSVG----EYLTVGYTPNENPVPKVTYKIDIQH 477

Query: 480  PGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNENLKYDPLFRGYL 538
             G Y++N+ TPGC  DNTC+ RGIVN T+        L    IYQNN+ +KYD L+ G L
Sbjct: 478  SGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQL 537

Query: 539  DDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKXXXXXXXXXXXXFQYAASN 598
            + S  + + +   +  +     +VADRV   I S+ DL  +            FQY  SN
Sbjct: 538  NSSCEITMTYYSGLYASNTVTTIVADRVDLNIISM-DLSHRTEVSKLALNGL-FQYQISN 595

Query: 599  FTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWND 658
            FTN ++   + +T+++Q+ + N   S SL     +++  + S +   +  I+   D    
Sbjct: 596  FTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDL--S 653

Query: 659  IIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSLS--- 715
            +    +LI TE   T   PYSNGL +            L   G++S +F+ N  +L+   
Sbjct: 654  VQNSTRLISTEN-FTTFQPYSNGLVM------------LDGQGNVS-LFKDNFKNLNTTM 699

Query: 716  -------ILNLTIDGSEILVFDNGYVYNVSSQSDI-SNSETLKLSLLSAGANLEDDLILA 767
                   + N+T++G E+LVF+NGY+YNV+SQ    SNS    L++ SAGAN  +D I  
Sbjct: 700  DGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFL 759

Query: 768  GNVQSTKHFVPNGAIAIDADSNEVVTS-GLPSVDDGIIYRGLFIND-------XXXXXXX 819
            G V   ++ + N +  ++AD N+ +    LPS  + +  RG+F+ND              
Sbjct: 760  GKVVQWQYAIANQSAQVNADFNDGIEQMSLPS--NTVPSRGIFLNDDSTGYFYKESNKSK 817

Query: 820  XXXXXXXXXXXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHD 879
                       +  YGE E             ++Y K+  LL V     +   ++L + +
Sbjct: 818  LYITNSNSTSGLEWYGEPET------------VVYDKNDTLLMVGYYNDNTFSSTLSLTN 865

Query: 880  LSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFM 937
            L++     +E   +G  I++++ F +N TLLV G F  +   C DLCLYNY +  W    
Sbjct: 866  LTSFDVIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLA 925

Query: 938  DGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHV 997
            + +++G +  LQ    +T++V G L    + D+ +  ++LSN  + S +   +     H 
Sbjct: 926  NNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHS 985

Query: 998  LTVGNSSSELIAHDGNQVFHFVDGQWKNIS-PDT-SGQTQINGLTLLSTDFSQRNSIMKR 1055
            + V N  S ++A +   +F F    W  +S P T S  T I+ +  +S + +        
Sbjct: 986  MIVSN--SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQFISMEGT-------- 1035

Query: 1056 DRVGNELVVINGNFSSPDYGDINAMYYDFNGWNPY--YFSVPRESNSDEVIPQGQLFLNK 1113
                ++ +++ G F   ++GDI ++ Y+F  W PY  Y   PR+         G LF+N+
Sbjct: 1036 ----DDALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQG-------TGHLFMNR 1084

Query: 1114 DVSFTSSSQIYLSNDN------------------DNDDTPAASEPATHEKHTKKXXXX-X 1154
            D+S  + +QI L N                     +   P  S   TH K  ++      
Sbjct: 1085 DISLHNIAQIPLLNSTRVLTNQSFASSTSSSVSSTSTTLPKVS--TTHSKPGRRIVDRGF 1142

Query: 1155 XXXXXXXXXXXXXXXXXXXXXXXXYLFGDH--NAYEPLKPRINEAEMLKTVPPEKL 1208
                                    Y+F D+  ++Y+ L PR++E  M+ T+PPEKL
Sbjct: 1143 VVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1245 (33%), Positives = 643/1245 (51%), Gaps = 68/1245 (5%)

Query: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60
            M  H   +  LS    L+  SQ++ + N   I  +  P L  S+  +S L +   +    
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   YYTYKGQQIFTG--LADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118
             YTY GQQ F+     D   N L+YYSNNT +QL +  D   I  IVP G DSFILSG G
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG 120

Query: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178
                + LE+QL YNLSS  +  I    LE V  IL D ++VYFGG FT+++G   GHSV 
Sbjct: 121  SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA 180

Query: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLS 238
             W+ T  S+ LLPF GFG+ S +NNI++L+D NILF G+F T+D+ +LL     +S+  +
Sbjct: 181  VWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTSN--TSNATT 238

Query: 239  NSTNIETNALASLR---FSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQM 295
            N  ++E + L  L    +SS V D   ++S+F+C    +D+W +  +T G L   +    
Sbjct: 239  NIYDLELSPLLPLNEATWSSDVSD--FDASSFICVNPDSDAWFVSGTT-GTLACSLPYDS 295

Query: 296  TPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSN 355
              +KIRIYNS DS NQ++ FR+++ PS SIMNMTY+DP TG L  CD++CPL     LS+
Sbjct: 296  ALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSS 355

Query: 356  LAENSTSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIEL 415
             ++ ++ S MA   ++N  ++KW+A YQEF FVN V    L F+A++S+G NV L G  L
Sbjct: 356  ASDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSL 415

Query: 416  FQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---PSVT 472
            +Q EY  + NN+LN  +C S  +   S    D  W  G   Q+Y+ T +T G    P VT
Sbjct: 416  YQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVT 475

Query: 473  LTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNR-WIYQNNENLKYD 531
               ++PY G Y +NL TPGC  D TC+ RG+VNVT+  ++   +++   IYQNNE LKYD
Sbjct: 476  FNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYD 535

Query: 532  PLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDL----EMKXXXXXXXX 587
             LF GYL +S  +VLE++  I   +    +VADR    + S++ L      K        
Sbjct: 536  ELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALN 595

Query: 588  XXXXFQYAASNFTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLA 647
                +Q +  + T  + S  VG T ++QYP+     +SSLF   Y++ L +G       A
Sbjct: 596  GLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYA 655

Query: 648  KISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTNMAS-SLSFNGSISTI 706
                  +D N    D   +  EG    + P+S G+ L  + N + +   ++++NGS +  
Sbjct: 656  L--ESSNDLNFSTSDNSGV--EGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPF 711

Query: 707  FRSNAPSLSIL-NLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLI 765
             +    S+    N+T   SEILVF+N Y+YNVSS + +SNS +L LSL SAGAN   DL+
Sbjct: 712  TQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLL 771

Query: 766  LAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXXX 825
              G      +   N +I I A++   +  GL   +    Y GL++N              
Sbjct: 772  FNGASSQMSYSFNNESINIGANN---IVQGLNFNESIDPYLGLYMN----TSHGAYFYQD 824

Query: 826  XXXXXIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSA-DF 884
                 +      +P +   +D  V   +Y  + +LL   TS + +  + L + + +  D 
Sbjct: 825  DDNTRVYFTNGSQPSWQWPND--VVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDV 882

Query: 885  APIKETFEIGEVINTMVLFGRNYTLLVGGTFTRN--GCRDLCLYNYATNNWTRFMDGNIT 942
               +        I+ +V F  N T ++GG F+     C  LCL+NY  + W+ F D +I 
Sbjct: 883  IANESLSSQQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASIN 942

Query: 943  GDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGN 1002
            G +  +Q  + + L+V+GL ++ +   + +  ++L N + I+ L+   + TF+   TV +
Sbjct: 943  GTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNK-ITALKSGESNTFKS-FTVAD 1000

Query: 1003 SSSELIAHDGNQVFHFVDGQW--KNISPDTSGQT--QINGLTLLSTDFSQRNSIMKRDRV 1058
               +++A +   +  + D  W  + IS   S      +N +TL S       ++ KRD  
Sbjct: 1001 --QKIVAWNNTALSIYEDNVWTVERISNINSSSVVDNLNYVTLAS-------ALSKRDTS 1051

Query: 1059 GNELVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDV-SF 1117
             ++ ++++G      YG I AM YDF+ W PY       S SD  I     F+++D+ SF
Sbjct: 1052 SSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLL---INSESDSSI---NAFIDRDMSSF 1105

Query: 1118 TSSSQIYLSN------DNDNDDTPAASEPAT---HEKHTKKXXXXXXXXXXXXXXXXXXX 1168
            T++    L+N       + +  +P AS  AT   ++ H +K                   
Sbjct: 1106 TNTQVALLTNSGTVSNSSSSTTSPGASASATSIPNKTHKRKIDRGFVVLLGLALALGTVA 1165

Query: 1169 XXXXXXXXXXYLFGDHN-AYEPLKPRINEAEMLKTVPPEKLMKFI 1212
                      Y+F D N AYEP+ PRI+E EM++TVPPEKLMK+I
Sbjct: 1166 VLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  553 bits (1426), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 379/1240 (30%), Positives = 615/1240 (49%), Gaps = 69/1240 (5%)

Query: 9    LVLSF--VAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKG 66
            L  SF  VA L  G+ +N + +   +  +  P LDLS   N ++ +  +FQ  +YY Y G
Sbjct: 7    LATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTG 66

Query: 67   QQIFTGLADER-KNSLIYYSNNTYVQLAELPDGAE---IKKIVPWGDDSFILSGRGVFEG 122
            Q  FTG++DE+ + SLIY+SN T ++L+      E   +  ++P  DDSFILSG G   G
Sbjct: 67   QDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISG 126

Query: 123  HRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDA 182
              L+HQ+++NLS    T I  + L  VN I  +G   YFGG F +   +   H ++ WD 
Sbjct: 127  AVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDF 186

Query: 183  TDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTN 242
                   LPF G G+ S VN+I+ LDD+NILF G FSTID  + L     +S+   NST+
Sbjct: 187  VKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL-----NSTLGINSTS 241

Query: 243  IETNALAS---LRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSK 299
                 L+    L+ +    DG+L     VCP  SA S  +   T G+  + + + + PSK
Sbjct: 242  DSAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSK 301

Query: 300  IRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAEN 359
            +R++N++  + +V+LFR++T+PS  IMN+TY+DP +G L  CDAWCPL     L+     
Sbjct: 302  LRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSK 361

Query: 360  STSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAE 419
            + S+    F NN    V+W+ +YQ+FAFVN VP+  +TF+A+DS+G +VG+ G EL++ +
Sbjct: 362  AASTDQVEFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDD 420

Query: 420  YDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK--PSVTLTPSI 477
            +  Y N++ N P+C S  N+  + +S  + W QG  D+ Y+ T     +  PSVT  P I
Sbjct: 421  FSVYANDSFNVPDCSSTSNYSKASLSA-SQWDQGSSDEDYVYTLVENSQEAPSVTFYPQI 479

Query: 478  PYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNENLKYDPLFRG 536
             Y G+YT+N++TPGCL D +C  R +VN ++  + NGT L +  IYQNN+  KYD L+ G
Sbjct: 480  VYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSG 539

Query: 537  YLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSI------EDLEMKXXXXXXXXXXX 590
            YL++   VVLE+ G I     + +MVA +++   D        +  +             
Sbjct: 540  YLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHYSLS 599

Query: 591  XFQYAASNFTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKIS 650
                   NF + N      ST++ QY V N   +S+ F   + + + + + S     K+S
Sbjct: 600  NSSSYLQNFKSNN------STDLAQYSVSNFAKNSNFFVDKFKNYIMLFASS----GKVS 649

Query: 651  RRKDDWNDIIVDPQLIDTE---GPVTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIF 707
            + + D      D + + TE     V+G+F +S GL +    + +   +   +NGS   I 
Sbjct: 650  KLEIDQQ---FDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKF-YNGSFFDIP 705

Query: 708  RSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILA 767
             S++   +  N T+DG+E++   N Y  N ++ +   NS  + L+  SAG N   + +  
Sbjct: 706  LSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFY 765

Query: 768  GNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDXXXXXXXXXXXXXXX 827
            G++   ++   NG+  I ++S       L      I Y   +I++               
Sbjct: 766  GSLTRNEYTDLNGSFFISSNSQSSSR--LRGSQGRIWYDATYIDNSTTGYAFYDPSSTNG 823

Query: 828  XXXIVVYGEHEPE----YLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSAD 883
               + +Y +   E    Y  T+   V  MLY K+S+LLA+     ++    L + +L+  
Sbjct: 824  SYGVSIYKDMAKERDLSYRWTN--MVGSMLYSKNSSLLALGMKNETRS-PQLLLTNLTTG 880

Query: 884  FAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDGNI 941
                   ++    IN+++ F +N ++LVGG F  + + C  LCL++Y   +W+ F D  I
Sbjct: 881  EDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMI 940

Query: 942  TGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVG 1001
             G I  ++  + ++L++ G    +D+K + L  + L++       QGT   T    + V 
Sbjct: 941  NGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTE--TILDFIFVD 998

Query: 1002 NSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNE 1061
                 L+A   N +F   +  W++IS      +   GL+        +N   KR+   N 
Sbjct: 999  GKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNK--KREEEKNS 1056

Query: 1062 LVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSS 1121
            L +I G+     YG I+A  YDFN W PY+ + P  + S + + Q +++ NKD+S   + 
Sbjct: 1057 L-LITGDLLHKTYGKISAALYDFNDWIPYFSTTP--ATSTDGLGQSRIYSNKDISSAFNY 1113

Query: 1122 QIYLSNDNDNDDTPAASEPATHE--------KHTKKXXXXXXXXXXXXXXXXXXXXXXXX 1173
            Q  L +    + +   S  ++              K                        
Sbjct: 1114 QGVLQSSRGGNSSSVPSGTSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVI 1173

Query: 1174 XXXXXYLFGD-HNAYEPLKPRINEAEMLKTVPPEKLMKFI 1212
                 + FG   + Y+ L+PR +E+EM+ TVPPEKLM+FI
Sbjct: 1174 GIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  501 bits (1289), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 359/1072 (33%), Positives = 550/1072 (51%), Gaps = 60/1072 (5%)

Query: 40   LDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGLADERKN-SLIYYSNNTYVQLAELPDG 98
            L+ S+ RN+++ +    +TF+YY Y+GQQ FT  +  +    LIYYSNNT ++L  +P  
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61

Query: 99   AEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEV 158
             E++ I+P+ DD FILSG G   G  L  Q++ NL+      I ++ L  V  I  D EV
Sbjct: 62   VEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEV 121

Query: 159  VYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKF 218
            VYFGG  TYN+  +SG SVV+W++T  SSSLLPF GFG  S VN+II+L+++N+LF G+F
Sbjct: 122  VYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQF 181

Query: 219  STIDNTALLPHRNVSSSFLSNSTNIETNALASLRFSSLVHDGTLNSSAFVCPEGSADSWT 278
            + ++N + +   N + +F  +  + E     SLR ++   +  L+  AF+CP     +W 
Sbjct: 182  AKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAW- 240

Query: 279  IPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGAL 338
                + G +T    N +T SKIRIYN+  ++NQ++LFR++  P   I+N+TY+DPI+  +
Sbjct: 241  YSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDI 300

Query: 339  AVCDAWCPLQPLSVLSNLAENST-SSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELT 397
              C   CPL     L N   N T  S +  F NNN+  +KW   YQEFAFVN++PI  L 
Sbjct: 301  KHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQ 360

Query: 398  FIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQ 457
            F+A +S+  NVGL G +++Q  +  + NN+ N+PNC S  +  + V      W+    D 
Sbjct: 361  FVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDN 420

Query: 458  SYMATSF---TAGKPSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNV-TIRAQNG 513
            SY+A S+      KPS+T    I  PG Y LNLVTPGC  DNTC+ RGIVNV T    NG
Sbjct: 421  SYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNG 480

Query: 514  THLMNRWIYQNNENLKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSI 573
              L +  IYQNN NLKYD +F G L++S +V +E+   I+       +V   V  +  SI
Sbjct: 481  NILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSI 540

Query: 574  --EDLEMKXXXXXXXXXXXXFQYAASNFT--NTNLSTLVGSTNIDQYPVRNIPHSSSLFG 629
              E +  +            F+Y+ SNFT  N  L+  +  T +D + V N    +S+F 
Sbjct: 541  SSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFA 600

Query: 630  QIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLAL---TV 686
               N  L++GS +           +  N   V     +  G + G++    GL +     
Sbjct: 601  VDQNQNLYLGSTN-----GSVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIA 655

Query: 687  HSNQTNMASSLSFNGSISTI-FRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISN 745
            H  +   A  L  N SI+ +   +N    +  N T+ GS +LVFDN  ++N++S     N
Sbjct: 656  HRGREYGAVIL--NKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFEN 713

Query: 746  SETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGIIY 805
            +    L L +AG N  DD++L GN+ +    + N ++ I ++      S     D+  I 
Sbjct: 714  TSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNG---TYSPFSLSDNDTIE 770

Query: 806  RGLFINDXXXXXXXXXXXXXXXXXXIVVYGEHEPEYLS-TDDSTVNDMLYIKDSNLLAVV 864
              +++ND                  +  +   + + L  T  STV  + Y     LL  +
Sbjct: 771  GAIYLND-------TKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAI 823

Query: 865  TSGTSQGLASLYIHDLSADFAPIKETFEIG-EVINTMVLFGRNYTLLVGGTFTRN--GCR 921
               +++  + + + DL +    I +T  +    IN +V F  N T LVGG F+ +   C 
Sbjct: 824  QENSNK--SQIVLIDLFSS-QVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACV 880

Query: 922  DLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDL-SNM 980
             LCLYNY  +NW+ F++ +ITG+I Q++F D   ++++G L  + + D+ L+ I+L SN 
Sbjct: 881  GLCLYNYNNSNWSSFLNNSITGNISQIKFND-TQMLLSGKLEVNKTADINLLSINLTSNK 939

Query: 981  EIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNISP-DTSGQTQINGL 1039
            + I  L   N+      + V N    ++  +   +F     QW N++  D      IN +
Sbjct: 940  QDI--LLYNNSVVLDDFILVRN---LVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRI 994

Query: 1040 TLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINAMYYDFNGWNPYY 1091
                 D              N  ++I G F S  YG INA+ YDFN W PY+
Sbjct: 995  ENFGAD-------------SNPALIIYGQFDSMKYGTINAVIYDFNSWYPYF 1033

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  501 bits (1289), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 377/1191 (31%), Positives = 609/1191 (51%), Gaps = 105/1191 (8%)

Query: 8    LLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDL--STVRNSQLLIFDDFQTFDYYTYK 65
            +L+LS        +Q+N + +   I    AP  +L  ST ++ QLL  + F T ++  Y 
Sbjct: 11   ILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYN 70

Query: 66   GQQIFTG-LADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHR 124
            GQQ FT  +    +N LIYYSN+TY++L ++P    I+ I+P+G D+FILSG G   G  
Sbjct: 71   GQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFE 130

Query: 125  LEHQLIYNLSSFEITEILKEPL-EHVNDILTDGE--VVYFGGGFTY--NDGNLSGHSVVK 179
            L +QL+YNL+   +T I +  L   V  I  D +  +VYFGG F+Y   D N+S + ++ 
Sbjct: 131  LSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNIS-NGLII 189

Query: 180  WDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALL--PHR----NVS 233
            WD++   +    F GFG  SV+NNI+KL+ +++LF G+F T+D+ ++L  P+     N +
Sbjct: 190  WDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNT 249

Query: 234  SSFLS--NSTNIETNALASL---RFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELT 288
            SS LS  N +  E N    L   +FS+   +  +N +  +CP    ++W    S  G L 
Sbjct: 250  SSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWA-SDSKAGSLQ 308

Query: 289  IRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQ 348
            I +   + PSKIRI+NS D +++V  FRI      SIM++ Y+DP+ G L  C  +CPL 
Sbjct: 309  ITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLY 368

Query: 349  PLSVLS--NLAENSTSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGH 406
              + L   N  +N  S V+    +NN   +KW+  YQEFAFVN+  +  L F A+ S+G 
Sbjct: 369  NRNQLKLFNSNDNLKSHVITLL-DNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGS 427

Query: 407  NVGLLGIELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSK---------------DTVWY 451
             VGL G+ LFQ++   + N + N+P+C+ Q  +    + K               D  WY
Sbjct: 428  RVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWY 487

Query: 452  QGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI 508
              LP+  Y+A ++ +     P+VT  P++ Y G YT++++TPGC  DN+C  RGIVNVT+
Sbjct: 488  TPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTM 547

Query: 509  RAQNGTHLMN-RWIYQNNENLKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVT 567
              Q  + ++    IYQ NEN K+D +F GYLD    + + +   +     N  +VADR+ 
Sbjct: 548  WNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRIN 607

Query: 568  SIIDSIEDLEMKXXXXX---XXXXXXXFQYAASNFTNTNLSTLVGSTNIDQYPVRNIPHS 624
             II+S++ +                  FQY   N  N NL+    ++ I+QY   N P +
Sbjct: 608  LIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVN-NLNENYTNSTINQYAYSNYPAN 666

Query: 625  SSLFGQIYN-DTLFIGSPSIDGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGL- 682
             SL    Y+ DTL +G  SI+ L +    K+  N I +     D    VTGI PYS+GL 
Sbjct: 667  VSLIAAAYDKDTLLVGG-SINKLQEFQIEKNGQN-ISLQNTFKDLNS-VTGIVPYSDGLI 723

Query: 683  ALTVHSNQTNMASSLSF-NGSISTI--FRSNAPSLSILNLTIDGSEILVFDNGYVYNVSS 739
            A     + +    +++F N    T+  F     S S ++LT    EIL F+N Y YN S+
Sbjct: 724  AYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSW-EILSFNNKYFYNQSN 782

Query: 740  QSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSV 799
              D  N+ T +LSL SAG N ++DLI +G V   ++    G ++I+A  NE +   L   
Sbjct: 783  MEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINA--NEQIKE-LNLG 839

Query: 800  DDGIIYRGLFINDXXXXXXXXXXXXXXXXXXIVVYGEHEP------------EYLSTD-D 846
            ++   Y  +F+ND                    +Y   EP            E +S    
Sbjct: 840  NNIYPYSAVFLNDSS-----------------TIYAYMEPNTRLNRLIHSNGEQISWSWK 882

Query: 847  STVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTMVLFGRN 906
            + ++ M +  + +LL+V T        S  I +L+++     ET      I++++ F +N
Sbjct: 883  NKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKN 942

Query: 907  YTLLVGGTFTRNG--CRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLAS 964
             ++LVGG FT +   C  LCL+NY T NW+ FM+  + G + +L+  + + ++++G L++
Sbjct: 943  SSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLST 1002

Query: 965  SDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWK 1024
            + S ++ L  ++L+   +   LQ TN  +F+     GN   ++ A + + +F + +  W 
Sbjct: 1003 NKSANIDLALLNLNTYNVSILLQNTNLTSFEF---TGN---QIAAWNSSTLFQYNNEAWS 1056

Query: 1025 NI-SPDTSGQTQINGLTLLSTDFSQRNS---IMKRDRVGNELVVINGNFSSPDYGDINAM 1080
             I  P+ +   +++ +++   D + +NS   + KR      ++V  G F S   G + A+
Sbjct: 1057 QILLPNGTESLKLDSISIF--DITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQAL 1114

Query: 1081 YYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDN 1131
            YY  + W PY++     +N+ +      +F NKD+S    S   L N N N
Sbjct: 1115 YYTSDTWIPYFYG--NLTNNMDTSNSINIFPNKDISSKIISDFVLKNWNFN 1163

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 1179 YLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212
            ++F D    YE LKPR  E EM   VPPEKLM F+
Sbjct: 1243 FIFRDSRGDYESLKPRTTEHEMFDAVPPEKLMPFV 1277

>Skud_5.99 Chr5 complement(146889..147566) [678 bp, 225 aa] {ON}
           YEL001C (REAL)
          Length = 225

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 178 VKWDATDKSS----SLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTI 221
           VK+D T K S    +LL FY     ++  N+  L+DSNI  VG   TI
Sbjct: 49  VKYDVTGKESDGLDTLLEFYARDTATLAYNVTNLEDSNITIVGVAGTI 96

>NDAI0A05830 Chr1 complement(1327489..1327914,1328336..1328380) [471
           bp, 156 aa] {ON} Anc_3.255 YBR048W
          Length = 156

 Score = 32.0 bits (71), Expect = 4.5,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 481 GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHL---MNRWIYQNNENLKYDPLFRGY 537
           G  T      G   D  C F G+V++  +   GT +   M+R I    + L Y P +  Y
Sbjct: 41  GFKTPKTAIEGSYVDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRDYLHYVPKYNRY 100

Query: 538 LDDSPNVVLEWIGPIDPAAANNVMVADRVTS 568
                NV      P+  + A  V V D VT+
Sbjct: 101 EKRHKNV------PVHVSPAFRVQVGDIVTA 125

>NCAS0I01700 Chr9 complement(315266..315691,316042..316086) [471 bp,
           156 aa] {ON} Anc_3.255 YBR048W
          Length = 156

 Score = 32.0 bits (71), Expect = 5.6,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 481 GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHL---MNRWIYQNNENLKYDPLFRGY 537
           G  T      G   D  C F G+V++  +   GT +   M+R I    + L Y P +  Y
Sbjct: 41  GFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRDYLHYVPKYNRY 100

Query: 538 LDDSPNVVLEWIGPIDPAAANNVMVADRVTS 568
                NV      P+  + A  V V D VT+
Sbjct: 101 EKRHKNV------PVHVSPAFRVQVGDIVTA 125

>NCAS0A10460 Chr1 (2077290..2077334,2077694..2078119) [471 bp, 156
           aa] {ON} Anc_3.255 YBR048W
          Length = 156

 Score = 32.0 bits (71), Expect = 5.6,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 481 GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHL---MNRWIYQNNENLKYDPLFRGY 537
           G  T      G   D  C F G+V++  +   GT +   M+R I    + L Y P +  Y
Sbjct: 41  GFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRDYLHYVPKYNRY 100

Query: 538 LDDSPNVVLEWIGPIDPAAANNVMVADRVTS 568
                NV      P+  + A  V V D VT+
Sbjct: 101 EKRHKNV------PVHVSPAFRVQVGDIVTA 125

>CAGL0K11748g Chr11 (1131241..1131285,1131832..1132257) [471 bp, 156
           aa] {ON} highly similar to uniprot|P26781 Saccharomyces
           cerevisiae YDR025w RPS18A or uniprot|P26781
           Saccharomyces cerevisiae YBR048w RPS18B
          Length = 156

 Score = 31.6 bits (70), Expect = 6.7,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 9/90 (10%)

Query: 481 GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHL---MNRWIYQNNENLKYDPLFRGY 537
           G  T      G   D  C F G+V++  +  +GT +   M+R I    + L Y P +  Y
Sbjct: 41  GFKTPKTAIEGSYIDKKCPFTGLVSIRGKILSGTVVSTKMHRTIIIRRDYLHYVPKYNRY 100

Query: 538 LDDSPNVVLEWIGPIDPAAANNVMVADRVT 567
                NV      P+  + A  V V D VT
Sbjct: 101 EKRHKNV------PVHVSPAFRVQVGDIVT 124

>CAGL0D06028g Chr4 (571551..573284) [1734 bp, 577 aa] {ON} similar
           to uniprot|P47113 Saccharomyces cerevisiae YJR053w BFA1
           spindle assembly checkpoint protein
          Length = 577

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 18/120 (15%)

Query: 77  RKNSLIYYSNNTYVQLAE--LPDGAE----IKKIVPWGDDSFILSGRGVFEGHRLEHQLI 130
           R  S +  SNN  V   E  +P   +    +KK   +   S  +S R    G R + + +
Sbjct: 457 RSRSQLISSNNPEVSFTESDVPGNDKFAIGVKKRDRYASTSAAISKRA---GDRADMERV 513

Query: 131 YNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLL 190
           Y LSS E+  +  E       +         GG F   DG+    ++ ++D +DK ++ +
Sbjct: 514 YRLSSKELERLYHEENRWQRKV---------GGWFVLGDGDQQDRTMAQYDPSDKGNNFM 564

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 132,471,601
Number of extensions: 6142184
Number of successful extensions: 18676
Number of sequences better than 10.0: 70
Number of HSP's gapped: 18923
Number of HSP's successfully gapped: 80
Length of query: 1212
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1091
Effective length of database: 39,606,813
Effective search space: 43211032983
Effective search space used: 43211032983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)