Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_4314na 1ON93049723390.0
AGR094Wna 2ON1381345181e-60
AGR093Wna 1ON6132305412e-58
SAKL0H17182gna 2ON6851524683e-48
Kwal_56.23599na 2ON6482434142e-41
KLTH0G13816gna 2ON6551524114e-41
KLLA0F18997gna 2ON4002113755e-38
AER235C5.277ON324861465e-09
Ecym_73645.277ON3301331403e-08
SAKL0G10912g5.277ON337971342e-07
Kwal_23.55935.277ON350951182e-05
KLLA0F21824g5.277ON2761531072e-04
KLTH0G06908g5.277ON3611191055e-04
TDEL0E034905.277ON34587960.007
NDAI0D015805.277ON299100880.052
KLLA0C17380g4.39ON111977880.10
KAFR0D050205.277ON25794800.51
NCAS0A017304.97ON784121810.60
NCAS0A066405.277ON27059742.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4314
         (930 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar t...   905   0.0  
AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No...   204   1e-60
AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; N...   213   2e-58
SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some...   184   3e-48
Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {...   164   2e-41
KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON} cons...   162   4e-41
KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]...   149   5e-38
AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON} ...    61   5e-09
Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON} ...    59   3e-08
SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conser...    56   2e-07
Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa] ...    50   2e-05
KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa] ...    46   2e-04
KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conser...    45   5e-04
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     42   0.007
NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277      39   0.052
KLLA0C17380g Chr3 (1524716..1528075) [3360 bp, 1119 aa] {ON} wea...    39   0.10 
KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277      35   0.51 
NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97      36   0.60 
NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5....    33   2.6  

>Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar to
           Ashbya gossypii AGR093W +AGR094W
          Length = 930

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/497 (90%), Positives = 450/497 (90%)

Query: 434 YHLQPDHQNQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLQQMHPNLQQLQNY 493
           YHLQPDHQNQH                                  CLQQMHPNLQQLQNY
Sbjct: 434 YHLQPDHQNQHQQALPVRSPPPPPSPPLPLPQQQQLKHPQYPRQQCLQQMHPNLQQLQNY 493

Query: 494 PNGSTTPCYYQNYFYDSVALFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIV 553
           PNGSTTPCYYQNYFYDSVALFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIV
Sbjct: 494 PNGSTTPCYYQNYFYDSVALFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIV 553

Query: 554 TSLQKTVTSISLTNSVSTKGKVTKLKQSTATTPICSKFTYDSNISGVTSVSGHMNYSETN 613
           TSLQKTVTSISLTNSVSTKGKVTKLKQSTATTPICSKFTYDSNISGVTSVSGHMNYSETN
Sbjct: 554 TSLQKTVTSISLTNSVSTKGKVTKLKQSTATTPICSKFTYDSNISGVTSVSGHMNYSETN 613

Query: 614 VSNTGDQELVNPLLESYESFIVKNDPRSNTKTAESSHQAPVTAQKDRGELPFQSENIFEV 673
           VSNTGDQELVNPLLESYESFIVKNDPRSNTKTAESSHQAPVTAQKDRGELPFQSENIFEV
Sbjct: 614 VSNTGDQELVNPLLESYESFIVKNDPRSNTKTAESSHQAPVTAQKDRGELPFQSENIFEV 673

Query: 674 QKDDEGSILSYHPITFADSATSYSNILPRSMPPSGTVSIPLKRGRMATLMSSALPQDSTS 733
           QKDDEGSILSYHPITFADSATSYSNILPRSMPPSGTVSIPLKRGRMATLMSSALPQDSTS
Sbjct: 674 QKDDEGSILSYHPITFADSATSYSNILPRSMPPSGTVSIPLKRGRMATLMSSALPQDSTS 733

Query: 734 STICYSNSTSNIHNNAKEGQLVSSEVASNTNNLSSSTEHKLKKLRSRYKESSGSKLSKGV 793
           STICYSNSTSNIHNNAKEGQLVSSEVASNTNNLSSSTEHKLKKLRSRYKESSGSKLSKGV
Sbjct: 734 STICYSNSTSNIHNNAKEGQLVSSEVASNTNNLSSSTEHKLKKLRSRYKESSGSKLSKGV 793

Query: 794 QYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLX 853
           QYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKL 
Sbjct: 794 QYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLT 853

Query: 854 XXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSLKYA 913
                       AFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSLKYA
Sbjct: 854 QFRKKRTFQKKKAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSLKYA 913

Query: 914 LVKYRPKLKDIIMGYND 930
           LVKYRPKLKDIIMGYND
Sbjct: 914 LVKYRPKLKDIIMGYND 930

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/339 (83%), Positives = 284/339 (83%)

Query: 1   MKVVVAVNLIVLYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDAL 60
           MKVVVAVNLIVLYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDAL
Sbjct: 1   MKVVVAVNLIVLYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDAL 60

Query: 61  FKLLMSSTPELLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAF 120
           FKLLMSSTPELLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAF
Sbjct: 61  FKLLMSSTPELLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAF 120

Query: 121 KHSSETCKGILGALKLLQKLQMIMFAEKPMLNDTNDPDSESVVWKPLDTAIAIQFLNSLP 180
           KHSSETCKGILGALKLLQKLQMIMFAEKPMLNDTNDPDSESVVWKPLDTAIAIQFLNSLP
Sbjct: 121 KHSSETCKGILGALKLLQKLQMIMFAEKPMLNDTNDPDSESVVWKPLDTAIAIQFLNSLP 180

Query: 181 ANQVTPLGRINSYTGRSHGSSQNGMLHQPVMQIHSQYQDQEPSLKXXXXXXXXXXXXXXX 240
           ANQVTPLGRINSYTGRSHGSSQNGMLHQPVMQIHSQYQDQEPSLK               
Sbjct: 181 ANQVTPLGRINSYTGRSHGSSQNGMLHQPVMQIHSQYQDQEPSLKDQQIRQQLEQQQQSP 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXPSKEKPFXXXXXXXXXXXXXXXXXXDLLHDHNDEKPAK 300
                                 PSKEKPF                  DLLHDHNDEKPAK
Sbjct: 241 IQSQLLLQHHQQQQGQDQERQPPSKEKPFHQHQQQQQQHQQHQEQQQDLLHDHNDEKPAK 300

Query: 301 LTSQLLEQSSGQQALSERLILPHPQKQQAPLPSTALALH 339
           LTSQLLEQSSGQQALSERLILPHPQKQQAPLPSTALALH
Sbjct: 301 LTSQLLEQSSGQQALSERLILPHPQKQQAPLPSTALALH 339

>AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No
           homolog in Saccharomyces cerevisiae
          Length = 138

 Score =  204 bits (518), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 96/134 (71%), Positives = 113/134 (84%)

Query: 793 VQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKL 852
           +QYQPPLT++GK Y++ ++GKFSI+MS+DQDSIYSIYNEFYQSLKLQV++FVQD+GKSKL
Sbjct: 1   MQYQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKL 60

Query: 853 XXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSLKY 912
                        AFVYLVEKI+YF+KL PEQVLDI D+VR+KE KSVVWVCNNLG+LK 
Sbjct: 61  VQFRKKRTFQKKKAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKC 120

Query: 913 ALVKYRPKLKDIIM 926
           ALVKYRP L DIIM
Sbjct: 121 ALVKYRPDLHDIIM 134

>AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; No
           homolog in Saccharomyces cerevisiae
          Length = 613

 Score =  213 bits (541), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 119/230 (51%), Positives = 163/230 (70%), Gaps = 10/230 (4%)

Query: 487 LQQLQNYPNGSTTPCYYQNYFYDSVA---LFQQGIPEINQRLHHLTVQNNKLKQQDTILM 543
           LQQ Q+    STTP  Y    YDS     LFQQ IP+INQR++HLT++NNKLKQQDT+LM
Sbjct: 378 LQQPQSA--SSTTPVQYYYPNYDSACSSPLFQQSIPDINQRIYHLTLENNKLKQQDTVLM 435

Query: 544 QQINNLRQIVTSLQKTVTSISL-TNSVSTKGKVTKLKQSTATTPICSKFTYDSNISGVTS 602
           Q IN+L+Q+V+SLQKTVTS+SL T +   KGKVTKLK+S ATTPI S F  +SN S +TS
Sbjct: 436 QHINSLKQLVSSLQKTVTSMSLATGTTPVKGKVTKLKRSAATTPIRSTFINESNNSSMTS 495

Query: 603 VSGHMNYSETNVSNTGDQELVNPLLESYESFIVKNDPRSNTKTAESSHQAPVTAQKDRGE 662
           +SG +NYSE+N +N  D ELV+PLLE+YE FI+K + R  +++A  +H+   ++Q  +  
Sbjct: 496 ISGALNYSESNTANAADDELVDPLLENYEPFILKTEQRQQSRSA--NHEPSSSSQGMQSV 553

Query: 663 LPFQSENIFEVQKDDEGSILSYHPITFADSATSYSNILPRSMPPSGTVSI 712
           L FQ++ +F++ +DD  S+LSY  +   DS+ SYS++L R  P   +V I
Sbjct: 554 LSFQNDPLFDIPRDDTSSLLSYQTVPVPDSSASYSSMLAR--PVGASVDI 601

 Score =  207 bits (526), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 139/211 (65%), Gaps = 2/211 (0%)

Query: 12  LYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDALFKLLMSSTPEL 71
           L    Q++ +ML+R+R  EDLYQ YT TKEQCLS++Q+     IDVD++F+LLM  TPEL
Sbjct: 20  LLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPGGGIDVDSMFELLMMRTPEL 79

Query: 72  LNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGIL 131
           L LVSLPAM+RF EW+++T +I+++    R++ITPTRC NFLK DV  F H +E   G+ 
Sbjct: 80  LGLVSLPAMVRFFEWAQRTETIAAET--TRAVITPTRCYNFLKEDVGTFAHGAEVVGGVF 137

Query: 132 GALKLLQKLQMIMFAEKPMLNDTNDPDSESVVWKPLDTAIAIQFLNSLPANQVTPLGRIN 191
            AL+LLQ+LQMI+F EKPML+D NDPDS S +WKPLD+   +Q L+SL  +  T  G++ 
Sbjct: 138 EALQLLQQLQMIVFREKPMLHDRNDPDSASPMWKPLDSPTTLQLLHSLVHDSATGSGKLG 197

Query: 192 SYTGRSHGSSQNGMLHQPVMQIHSQYQDQEP 222
                        ML +     H  Y  QEP
Sbjct: 198 GLAHDDTALLSRDMLDRSAAHAHGHYPQQEP 228

>SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some
           similarities with uniprot|Q74ZV5 Ashbya gossypii AGR094W
           AGR094Wp
          Length = 685

 Score =  184 bits (468), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/152 (56%), Positives = 109/152 (71%)

Query: 775 KKLRSRYKESSGSKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQ 834
           KK R +YK++ GS+LSKG  Y PP++  GK Y++ EDG+ +IVMS+DQDSIYSIYNEFYQ
Sbjct: 530 KKARPKYKDTPGSQLSKGKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQ 589

Query: 835 SLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRI 894
           SLK QV+SFV+D+GKS+L             AFVYL EKI+Y   +P E VL I+D +R 
Sbjct: 590 SLKPQVESFVKDFGKSRLVQFKKKRTFQKKKAFVYLAEKIAYMQNMPVETVLGIIDQIRH 649

Query: 895 KEGKSVVWVCNNLGSLKYALVKYRPKLKDIIM 926
           +E KSVVW CNNL  LK  LVK+RP L+D + 
Sbjct: 650 REEKSVVWACNNLNLLKDMLVKHRPDLRDTVF 681

 Score =  156 bits (395), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 110/170 (64%), Gaps = 1/170 (0%)

Query: 11  VLYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDALFKLLMSSTPE 70
            L+    +L ++L +IRN ++LYQFYT  +EQCLSY+Q   +V +D D++FK LM+   E
Sbjct: 55  ALWLLRDILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVDPDSIFKNLMAYPTE 114

Query: 71  LLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGI 130
           +L+ + +P  +RF++W+  T  I +     R I+T  RCL FLK+D +   H+S T + I
Sbjct: 115 VLSAIYIPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDDSNVLSHTSGTAQRI 174

Query: 131 LGALKLLQKLQMIMFAEKPML-NDTNDPDSESVVWKPLDTAIAIQFLNSL 179
           +  LKLLQ+LQMI+F EKP+  ND  D  + + VW+PL++    +FL SL
Sbjct: 175 VEGLKLLQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEFLESL 224

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 35/51 (68%)

Query: 513 LFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSI 563
           +F Q IP++ QRLH+L ++N  L++Q+ +L+Q +++L   +  LQ  V+ +
Sbjct: 321 IFNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQIAQLQNFVSVV 371

>Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {ON}
           [contig 176] FULL
          Length = 648

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 137/243 (56%), Gaps = 20/243 (8%)

Query: 682 LSYHPITFADS-ATSYSNILPRSMPPSGTVSIPLKRGRMATLMSSALPQDSTSSTICYSN 740
           LS  P+  A   AT Y +++P +  P  +  IP  R R A           T STI  S+
Sbjct: 418 LSSQPVNQAQQLATGYESLMPFN--PGTSEFIPDTRLRGA----GQFIHGETMSTI--SS 469

Query: 741 STSNIHNNAKEGQLVSSEVASNTNNLSSSTEHKLKKLRSRYKESSGSKLSKGVQYQPPLT 800
              +I + +  G L +S+  S           K K +   Y+   G+KL+KG  Y PP  
Sbjct: 470 RGDSIASTSPVGLLATSDFHSPAK--------KPKPVSYNYE---GAKLTKGETYHPPQA 518

Query: 801 SEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXX 860
            +GKRY+L E+GK +IVM+  Q S+Y +YNE+YQSL+ QVD++ +DYGK  +        
Sbjct: 519 PDGKRYLLDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRT 578

Query: 861 XXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSLKYALVKYRPK 920
                AFV  VE++S  + +PPE VLD++DDVR++E KSVVW CNNLGS + AL  Y P+
Sbjct: 579 FQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPE 638

Query: 921 LKD 923
           LKD
Sbjct: 639 LKD 641

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 93/170 (54%), Gaps = 7/170 (4%)

Query: 12  LYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCI-DVDALFKLLMSSTPE 70
           L+    +L N+L+  RNH  L   Y + K +C     +G+   I  V+ +FK+LM    E
Sbjct: 63  LFVLQDVLWNLLVHFRNHGTLQASYEMAKHRC-----EGHYPSILSVECIFKVLMDYPAE 117

Query: 71  LLNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGI 130
           LL+ + +P +LRF +WS      S ++K +R+IIT  R + FL  + H F +++ T    
Sbjct: 118 LLSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVANFHEFSYNAATLYQA 177

Query: 131 LGALKLLQKLQMIMFAEKPML-NDTNDPDSESVVWKPLDTAIAIQFLNSL 179
             +LKLLQ L+M +  +KP+L +D+ D ++    W PL++      + SL
Sbjct: 178 SQSLKLLQSLEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESLIKSL 227

 Score = 38.5 bits (88), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 513 LFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSISLTNSVSTK 572
           LF Q  P I  R++ L V N +L Q +  L + +  L+  + +L+K+V + SL     T 
Sbjct: 319 LFSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQNLEKSVENTSLQRQNVTS 378

Query: 573 GKVTKL---KQSTATTPICSKF---TYDSNISGV 600
            KV        ++A   + S +   T D  ISGV
Sbjct: 379 PKVVHTGFPSSASANVVVPSSYPMETSDLAISGV 412

>KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON}
           conserved hypothetical protein
          Length = 655

 Score =  162 bits (411), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 100/152 (65%)

Query: 775 KKLRSRYKESSGSKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQ 834
           K+ + R +   G+KLSKG  YQPP    GK Y+L  +G+ +IVM+++Q S+Y +YNE+YQ
Sbjct: 500 KRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYNEYYQ 559

Query: 835 SLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRI 894
           SL+ QVDS+  D+GK  +             AFV  VE+IS  + +PPE VLDIVD+VR+
Sbjct: 560 SLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVDEVRL 619

Query: 895 KEGKSVVWVCNNLGSLKYALVKYRPKLKDIIM 926
           KE KSVVW CNNLG  +  L +Y+P LKD  +
Sbjct: 620 KEKKSVVWACNNLGRFRLVLNRYKPDLKDTAL 651

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 82/152 (53%), Gaps = 5/152 (3%)

Query: 18  MLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDALFKLLMSSTPELLNLVSL 77
           +L N+L+ IR H      Y++ K +  ++ Q      + V+ +FK L +   E+L+ + +
Sbjct: 76  VLWNVLVHIRGHGTFESCYSLAKRRYEAHYQS----LVSVECIFKTLANYPAEILSAMYI 131

Query: 78  PAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGILGALKLL 137
           P +LRF +W      +  + K +R +IT  + + FL  ++    +++ T      ALKLL
Sbjct: 132 PVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYNAATLYQAFRALKLL 191

Query: 138 QKLQMIMFAEKPML-NDTNDPDSESVVWKPLD 168
           Q L++ +F +KP L +D  D +++   WKPLD
Sbjct: 192 QSLEIALFPQKPALYHDPEDEEADDPNWKPLD 223

 Score = 35.0 bits (79), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 61/131 (46%), Gaps = 4/131 (3%)

Query: 505 NYFY-DSVALFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSI 563
           N+ Y +   LF   IP I  R++ L   N +L +++  L Q +N+L+  + S ++ V + 
Sbjct: 318 NFMYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSLNDLKSELQSFKRNVDTA 377

Query: 564 SLTNSVSTKGKVTKLKQSTATTPICSKFTYDSNISGVTSVSGHMNYSETNVSNTGDQELV 623
                + T  + T  +  + T P  +     SN    + ++  +   +T++ N+   +  
Sbjct: 378 IPGVQILTSPRATHSRYPSPTPP--NIILSSSNAIDTSDIAASVQKLDTDLCNSSATQ-T 434

Query: 624 NPLLESYESFI 634
             L+ +YE+ +
Sbjct: 435 RSLISNYENMV 445

>KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]
           {ON} some similarities with uniprot|Q74ZV5 Ashbya
           gossypii AGR094W AGR094Wp
          Length = 400

 Score =  149 bits (375), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 129/211 (61%), Gaps = 13/211 (6%)

Query: 723 MSSALPQDSTSSTICYSNSTSNIHNNAKEGQLVSSEVA--SNTNNL----SSSTEHKL-- 774
           +S ++P ++T+S+  + ++T++ ++    G  ++  +A   NT NL    ++ T+H    
Sbjct: 189 LSQSVPSNATNSS-KFDHATTSAYSKNSSGLDIAFNIAYEENTENLPRRMNTDTDHPQQL 247

Query: 775 ---KKLRSRYKESSG-SKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYN 830
              K+ ++ + +  G + +SKG Q++PPL+ +GK Y++ +DG  SIVM +D DS+YSIYN
Sbjct: 248 NINKQAKTMHAKKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYN 307

Query: 831 EFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVD 890
           EF QSLK Q+DSFVQD+G+SKL             AF   VE I   +    E++LDI+D
Sbjct: 308 EFMQSLKPQIDSFVQDHGRSKLAKFQKKRTFQKRKAFCSFVETIVNSTSFTSEEILDIID 367

Query: 891 DVRIKEGKSVVWVCNNLGSLKYALVKYRPKL 921
            +R +   SV+WVCNNL  LK  L+K RP L
Sbjct: 368 GIRAQNDHSVIWVCNNLNQLKMDLLKQRPDL 398

>AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON}
           NOHBY524; No homolog in Saccharomyces cerevisiae'
          Length = 324

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 825 IYSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQ 884
           +  +Y EF  SLKLQ+  F + YGK +L             A V  +++ + F+    E+
Sbjct: 232 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 291

Query: 885 VLDIVDDVRIKEGKSVVWVCNNLGSL 910
            +   DD+R+++ K+V W+ NNLG +
Sbjct: 292 AIQFFDDIRMEKNKTVAWLYNNLGKI 317

>Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii AER235C
          Length = 330

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 4/133 (3%)

Query: 782 KESSGSKLSKGVQYQPPLTSEGKRYM----LGEDGKFSIVMSSDQDSIYSIYNEFYQSLK 837
           K+ + + L    Q QP      +R +    L E   + + M      +  +Y EF  SLK
Sbjct: 191 KDRNAAALGHLQQRQPHRHISTRRALPASHLQEIEDYELQMIDSPKDVNELYREFDTSLK 250

Query: 838 LQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEG 897
           LQ+  F + YGK +L             A V  +++ + F+    E+ +   D +R+++ 
Sbjct: 251 LQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEEAIQFFDTIRVEKN 310

Query: 898 KSVVWVCNNLGSL 910
           K+V W+ NNLG +
Sbjct: 311 KTVAWLYNNLGKI 323

>SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conserved
           hypothetical protein
          Length = 337

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%)

Query: 814 FSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEK 873
           + + M  +  S+  +Y+EF  SLKLQ+  F + +GK +L             A V  ++K
Sbjct: 235 YELQMIDNPKSVAELYDEFDNSLKLQILEFEKKFGKGQLSRIPKIRTYQRRRALVSEIDK 294

Query: 874 ISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSL 910
            + F+    E  +   +++R ++ K+V W+ NNLG +
Sbjct: 295 YARFTNKSTEDAIHFFENIRNEKNKTVAWLYNNLGRV 331

>Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa]
           {ON} [contig 11] FULL
          Length = 350

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%)

Query: 813 KFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVE 872
           +F++ MS+   +++++Y+EF  SL  Q+  + + YGK +              A V  ++
Sbjct: 248 EFTLQMSNQPTTVFALYSEFETSLGPQMLEYEKRYGKGQSSRLPRIRTFQRRRALVSEID 307

Query: 873 KISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNL 907
           K S  +  P E+ +   + +R +  +SV W+ NNL
Sbjct: 308 KFSRRTGRPIEEAIAYFELIRTRNRRSVAWLYNNL 342

>KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa]
           {ON} conserved hypothetical protein
          Length = 276

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 69/153 (45%), Gaps = 10/153 (6%)

Query: 766 LSSSTEHKLKKLRSRYKESSGSKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSI 825
           LS   E+  +++ SRYK +     SK      PL ++     L     + ++M+    S+
Sbjct: 132 LSREAENASREMPSRYKVAKSQHSSK----IRPLGAKD----LNNVENYHLIMTDCPKSV 183

Query: 826 YSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQV 885
           + +Y+EFY   KLQ+  F + +G  +L             A V  + K +    +  EQ 
Sbjct: 184 HDLYHEFYTDTKLQILHFEEKHGAGQLSKLPKLRTYQRRSALVNAINKYAKGKNITVEQS 243

Query: 886 LDIVDDVRIKEGKSVVWVCNNLGSL--KYALVK 916
           ++    +  +  K++ W+ NNL  +  +Y +V+
Sbjct: 244 IEHFQGIVEENDKTIPWLYNNLAKILEQYGIVQ 276

>KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conserved
           hypothetical protein
          Length = 361

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query: 796 QPPLTSEGKRYMLGEDGK----FSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSK 851
           Q P +S   RY   +D K    + + MS +  ++  +Y E+   L+ Q+  F + YGK +
Sbjct: 240 QTPCSSRHLRY--AKDAKDISAYVLKMSGNPKTVGDMYYEYEHQLRPQILEFEKRYGKGQ 297

Query: 852 LXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSL 910
           +             A +  +EK +       E+ +   +++R +  K+V W+ NNL  +
Sbjct: 298 ISRLPKVRTYQRRRALINEIEKFARREGKSIEEAVQYFEEIRTQNKKTVPWLYNNLNRI 356

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%)

Query: 824 SIYSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPE 883
           S+  +Y+E+  SLK Q++ F + +GK +L             A V  ++K +        
Sbjct: 247 SVAEVYHEYENSLKSQIEEFERLFGKGQLSKLPKIRTYQRRRALVTEIDKYATSYNKTTH 306

Query: 884 QVLDIVDDVRIKEGKSVVWVCNNLGSL 910
           + ++  + VRI + ++V  + NNLG +
Sbjct: 307 EAIEFFEKVRIAKKRTVPGLYNNLGKI 333

>NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277
          Length = 299

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 47/100 (47%)

Query: 811 DGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYL 870
           + K  + M+   +SI  ++ E+   L  +V    + YGK  L             A V  
Sbjct: 191 NKKIQLAMAVKPNSITELFYEYENVLTPKVKDIQKKYGKKCLKQITNIRTLQRRKALVSE 250

Query: 871 VEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSL 910
           ++K +  ++   ++ L++ + +R+K  +SV W+ NN+  L
Sbjct: 251 IKKFAKQNRKSIKETLEVAEYIRLKNNRSVPWLYNNISHL 290

>KLLA0C17380g Chr3 (1524716..1528075) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P23201 Saccharomyces cerevisiae
           YLL021W SPA2 Component of the polarisome which functions
           in actin cytoskeletal organization during polarized
           growth acts as a scaffold for Mkk1p and Mpk1p cell wall
           integrity signaling components potential Cdc28p
           substrate
          Length = 1119

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 9/77 (11%)

Query: 481 QQMHPNLQQL-QNYPNGSTTPCYYQNYFYDSVALFQQGIPEINQRLHHLTVQNNKLKQQD 539
           Q++   +QQL QN    STT     N        FQ+G+ E+  +L+ L+++N +LKQ+ 
Sbjct: 368 QRLTEEVQQLKQNADQSSTTKALDSN--------FQKGMSEMTTQLNQLSIENEELKQEK 419

Query: 540 TILMQQINNLRQIVTSL 556
             L  Q+ N++  V S+
Sbjct: 420 LELQLQLKNIQSPVKSI 436

>KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277
          Length = 257

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%)

Query: 814 FSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKLXXXXXXXXXXXXXAFVYLVEK 873
           F I M  +  +++ +Y +F   +K  V    + YGKS               A V  ++K
Sbjct: 142 FEIPMIENPKTVHELYYDFQNCVKETVRELKEKYGKSYFRKATNIRSYQRRRALVSEIQK 201

Query: 874 ISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNL 907
           +S    +  E+ L   +++R +  K+V W+ +NL
Sbjct: 202 LSEEYDIDIEEALQCFEELRKENYKTVPWLYSNL 235

>NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97
          Length = 784

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 59/121 (48%), Gaps = 6/121 (4%)

Query: 84  IEWSRQTPSI----SSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGILGALKLLQK 139
           +E  ++TPS+    S+ ++++ S I P   LN   +D     ++++T + I       Q 
Sbjct: 235 MEQKQETPSLKRNESNGIRRSESTILPNTKLNVTDDDSRNTSNNNDTDEAIAQKNLTTQA 294

Query: 140 LQMIMFAEKPMLNDTNDPDSESVVWKPLDTAIAIQFLNSLPANQVTPLGRINSYTGR-SH 198
           L+ + F +   L+DTND  SE+      ++ +++   NS  A + T  G + S   R  H
Sbjct: 295 LRKLSFLKTSNLSDTNDKTSETSSNNIRESFVSMTKSNSTVAAK-TDSGNVTSEDSRMRH 353

Query: 199 G 199
           G
Sbjct: 354 G 354

>NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5.277
          Length = 270

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%)

Query: 848 GKSKLXXXXXXXXXXXXXAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNN 906
           GK  L             + V  +  IS    L  E+V++I + +R   GKSV W+ NN
Sbjct: 199 GKKALRNIAKLRTVQRRKSLVRAIHDISTLYNLSLEEVINIFETIRENGGKSVAWMYNN 257

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,595,529
Number of extensions: 3285843
Number of successful extensions: 15375
Number of sequences better than 10.0: 350
Number of HSP's gapped: 15805
Number of HSP's successfully gapped: 456
Length of query: 930
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 811
Effective length of database: 39,836,145
Effective search space: 32307113595
Effective search space used: 32307113595
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)