Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43138.257ON59759732020.0
AGR092W8.257ON59659618180.0
SAKL0H17160g8.257ON73952218300.0
KLLA0F19041g8.257ON76351718190.0
Kwal_56.236078.257ON72553117970.0
KLTH0G13794g8.257ON72553117920.0
Kpol_392.98.257ON59460817640.0
NDAI0J014008.257ON58859817600.0
TDEL0F038408.257ON72652217410.0
ZYRO0C01782g8.257ON73052517380.0
TBLA0E044008.257ON58960317200.0
YDR109C8.257ON71551817050.0
KAFR0B055608.257ON60559416920.0
Suva_2.2698.257ON72558016940.0
Skud_4.3708.257ON71451916860.0
Smik_4.3558.257ON70451816790.0
KNAG0H032608.257ON58059416560.0
NCAS0B038708.257ON59659516560.0
CAGL0B01727g8.257ON57759516240.0
TPHA0B032408.257ON58559215030.0
Suva_14.931.111ON5436135487e-62
Skud_14.891.111ON5696085182e-57
YNL249C (MPA43)1.111ON5426054882e-53
Kwal_33.135301.111ON5346144854e-53
Smik_14.861.111ON5436064769e-52
KLTH0F03080g1.111ON5336064627e-50
TDEL0C059001.111ON5436074592e-49
KNAG0F006601.111ON5356134592e-49
SAKL0C03432g1.111ON5476024496e-48
ZYRO0F16016g1.111ON5426034401e-46
KLLA0C02937g1.111ON5164893004e-28
NCAS0A007801.111ON5495111412e-08
KLLA0E23013g5.42ON335177790.49
Kwal_14.20648.175ON447100732.5
NDAI0H002204.9ON810124723.7
KLLA0D00748g6.5ON78957716.2
SAKL0G10516g5.294ON292102689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4313
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...  1238   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   704   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   709   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   705   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   696   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   694   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   684   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   682   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   675   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   674   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   667   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   661   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   656   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   657   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   654   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   651   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   642   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    642   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   630   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   583   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   215   7e-62
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   204   2e-57
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   192   2e-53
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   191   4e-53
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   187   9e-52
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   182   7e-50
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   181   2e-49
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   181   2e-49
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   177   6e-48
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   174   1e-46
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   120   4e-28
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    59   2e-08
KLLA0E23013g Chr5 complement(2049719..2050726) [1008 bp, 335 aa]...    35   0.49 
Kwal_14.2064 s14 (594241..595584) [1344 bp, 447 aa] {ON} YER136W...    33   2.5  
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    32   3.7  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...    32   6.2  
SAKL0G10516g Chr7 (895476..896354) [879 bp, 292 aa] {ON} highly ...    31   9.1  

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/597 (100%), Positives = 597/597 (100%)

Query: 1   MLQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIR 60
           MLQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIR
Sbjct: 1   MLQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIR 60

Query: 61  KIICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEV 120
           KIICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEV
Sbjct: 61  KIICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEV 120

Query: 121 NEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKC 180
           NEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKC
Sbjct: 121 NEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKC 180

Query: 181 RSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAG 240
           RSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAG
Sbjct: 181 RSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAG 240

Query: 241 DYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLATV 300
           DYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLATV
Sbjct: 241 DYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLATV 300

Query: 301 AGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLC 360
           AGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLC
Sbjct: 301 AGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLC 360

Query: 361 KLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATII 420
           KLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATII
Sbjct: 361 KLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATII 420

Query: 421 GQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLA 480
           GQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLA
Sbjct: 421 GQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLA 480

Query: 481 NCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPKQS 540
           NCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPKQS
Sbjct: 481 NCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPKQS 540

Query: 541 ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENSV 597
           ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENSV
Sbjct: 541 ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENSV 597

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/596 (55%), Positives = 433/596 (72%), Gaps = 6/596 (1%)

Query: 1   MLQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIR 60
           M Q+Y+GVDVGTE  RAC++D  G IL+    PISR + + +++TQSS+EIW A+C  +R
Sbjct: 6   MKQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVR 65

Query: 61  KIICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEV 120
             + +SQV  D + GI FDATCSLVVL+E ++  VAVGP+F D  Q++ILWMDHRA+ E 
Sbjct: 66  AAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEA 125

Query: 121 NEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKC 180
           +EINSTGH  L+YVGGKMS+EMQ+PKIKWL+ ++P+G+F KC+FYDLPDFLTY+ATG + 
Sbjct: 126 SEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIES 185

Query: 181 RSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAG 240
           RSFCSTVCKMGL+P GVD ST GW ++  E IGL ELC   F +LGG +    S F SAG
Sbjct: 186 RSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAG 245

Query: 241 DYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLATV 300
           + VG LS+ AAA LGLT +C+V SG+IDAYAGWVGT+ A      +    E  + RLA V
Sbjct: 246 EPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAAV 305

Query: 301 AGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLC 360
           AGTSTC I +S+ PHF++GVWGPYRD L  GYW TEGGQSCTGALLAH L +HPAY  L 
Sbjct: 306 AGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELH 365

Query: 361 KLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATII 420
           + A+ +G++ FD+IN RL++L+ E GA+S+ AL KH F YGDYHGNRSP+ADP+MRA ++
Sbjct: 366 QAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMV 425

Query: 421 GQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLA 480
           G SMDVS DDLA+  L A EFIA Q R I++H+  +G  + ++Y+SGGQ RN +L +LLA
Sbjct: 426 GLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLA 485

Query: 481 NCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPKQS 540
           +  + P+V P+++ AAVVFGSALL  AA E YL   + TA  S+I+     +S  +    
Sbjct: 486 DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATA--SSILP----SSASRAPMH 539

Query: 541 ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENS 596
            LW +M+ LT  G ++ PS   D +IRLL+ KY++FL+M E QK YR LV   EN+
Sbjct: 540 RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENT 595

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/522 (63%), Positives = 416/522 (79%), Gaps = 11/522 (2%)

Query: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61
           + +Y+GVDVGT S RAC++D  G ILSLA +PI RQE++P+Y+TQSS EIW AIC+C++ 
Sbjct: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121
           ++ DS V+ + I GIGFDATCSLVV+E+ ++K VAVGP+F + EQ+IILWMDHRAIDE  
Sbjct: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151

Query: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181
           EIN+T  +CLKYVGG+MS+EM+IPKIKWLKNNLP+ KF+KC+F+DL D+LT++ATG + R
Sbjct: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211

Query: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTAS---NFLS 238
           S+CSTVCK GLLP+GV+ S +GW ++   +IGL +LC+ +F KLGG + S  S    FLS
Sbjct: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGSTFLS 271

Query: 239 AGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLG------SDGQESEL 292
           AG+ +G L   AA +LGL   C+V SG+IDAYAGWVGT+AA   +       +D +++ +
Sbjct: 272 AGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGI 331

Query: 293 --ASSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVL 350
             A+ RLA VAGTSTCHI +SK P F+DGVWGPYRD + PG+W  EGGQSCTGALLAHVL
Sbjct: 332 DHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVL 391

Query: 351 KSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPI 410
             HPAY  L  L+    +SKFD++N+RLE L ++RGA+SV AL KHLFFYGDYHGNRSPI
Sbjct: 392 TIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPI 451

Query: 411 ADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQC 470
           ADP+MRA +IGQSMD S+DDLAIM LGACEFIAQQTRQIVE +  SGH I +I+MSGGQC
Sbjct: 452 ADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQC 511

Query: 471 RNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512
           RN +L++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE +
Sbjct: 512 RNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF 553

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 41/58 (70%)

Query: 538 KQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAEN 595
           K   LW VM N+TG G++++PS+    +  LLD KY+IFLDM ETQ+RYR+ V + EN
Sbjct: 672 KGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVEN 729

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/517 (63%), Positives = 416/517 (80%), Gaps = 11/517 (2%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           +Y+GVDVGT S RACV+D  G ILSLA +PI R E++PNY+TQSS EIW AIC+C++ ++
Sbjct: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
            DS V   +I GIGFDATCSLVV++   N+ V VGP+F D  Q+IILWMDHRAI+E  EI
Sbjct: 96  RDSGVDPRTIHGIGFDATCSLVVVDN-NNEDVGVGPDFTDNLQNIILWMDHRAIEETEEI 154

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           N+TG +CLKYVGG+MS+EM+IPKIKWLKNN+P+ KF +C+F+DL D+LT++ATG++ RS+
Sbjct: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDYV 243
           CSTVCK GLLPLGV+GS  GW ++  ++IGL EL   +F+KLGG V+ T   FLSAG+ +
Sbjct: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET--TFLSAGECI 272

Query: 244 GHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA--GITLGSDGQESEL------ASS 295
           G L++E+AA+LGL+T C+V SG+IDAYAGWVGT+AA   + + +  +  E+      A+ 
Sbjct: 273 GTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATG 332

Query: 296 RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPA 355
           RLA VAGTSTCHI +SK P F+ GVWGPYRD + PG+W+ EGGQSCTGALLAHVL +HPA
Sbjct: 333 RLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPA 392

Query: 356 YDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNM 415
           Y  L +L+    +SKFD++N+RLE L ++R A SV AL KHLFFYGDYHGNRSPIADP+M
Sbjct: 393 YAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSM 452

Query: 416 RATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVL 475
           RA IIGQSMD S+DDL+IM LGACEFIAQQTRQIVE +  SGHE+ +I+MSGGQCRN +L
Sbjct: 453 RAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLL 512

Query: 476 IKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512
           ++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE +
Sbjct: 513 MRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF 549

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 34/49 (69%)

Query: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLV 590
           LW VM N+TG G+++ P+     +  LL+ KY+IFLDM  TQ++YR LV
Sbjct: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLV 759

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/531 (60%), Positives = 415/531 (78%), Gaps = 11/531 (2%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           +YIGVDVGT S RAC++D  G ILSLA +PI R++++PN++TQSS EIW+A+C C++ ++
Sbjct: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
            DS V  + I GIGFDATCSLVV+EE +NK VAVGP+F +  Q+IILWMDHRAI+E  +I
Sbjct: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           N+TG +CLKYVGG+MS+EM+IPKIKWLKN+LP  KFD+C+F+DL D+LT++A+G + RSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVV--SSTASNFLSAGD 241
           CSTVCK GLLP+GV+GS +GW ++   +IGL +    +F K+GG V  S    NFLSAG+
Sbjct: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273

Query: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAG--------ITLGSDGQESELA 293
           +VG +    A +LGL+  C+V SG+IDAYAGWVGT+AA         + +  +    + A
Sbjct: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333

Query: 294 SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSH 353
           + RLA VAGTSTCHI +S+ P F+DGVWGPYRDAL   +W  EGGQSCTGALLAHV+ +H
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393

Query: 354 PAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADP 413
           PAY  L +LA    +SKFD++N+RLE L +++ ++SV  L +HLFFYGDYHGNRSPIADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453

Query: 414 NMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNL 473
           +MRA IIGQSMD S+DDLA+M LGACEFIAQQTRQIVE +  SGH++ +I+MSGGQCRN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513

Query: 474 VLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY-LHGCSDTASVS 523
           +L++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE + L G +   SVS
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVS 564

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (72%)

Query: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENS 596
           +W VM N+TG G++++P    + + +LLD KY+IFLDM ETQ++YR+LV   E S
Sbjct: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/531 (61%), Positives = 416/531 (78%), Gaps = 11/531 (2%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           +Y+GVDVGT S RAC++D  G ILSLA +PI R++++ N++TQSS EIW+A+C C++ ++
Sbjct: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
            DS V  + I GIGFDATCSLVV+EE TNK VAVGP+F + +Q+IILWMDHRAI+E   I
Sbjct: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           N+TG +CLKYVGG+MS+EM+IPKIKWLKN+LP+ KF++C+F+DL D+LT++A+G + RSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVV--SSTASNFLSAGD 241
           CSTVCK GLLP+GV+GS +GW ++   +IGL EL   +F ++GG V  S    NFLSAG+
Sbjct: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273

Query: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGI-----TLGSDGQES---ELA 293
           ++G +    A +LGL+  C+V SG+IDAYAGWVGT+AA        L    QE    + A
Sbjct: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333

Query: 294 SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSH 353
           + RLA VAGTSTCHI +S+ P F+DGVWGPYRDAL   +W  EGGQSCTGALLAHVL +H
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393

Query: 354 PAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADP 413
           PAY  L +LA    +SKFD++N+RLE L +++ A+SV  L KHLFFYGDYHGNRSPIADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453

Query: 414 NMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNL 473
           +MRA IIGQSMD S+DDLA+M LGACEFIAQQTRQIV+ +  SGH++++I+MSGGQCRN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513

Query: 474 VLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY-LHGCSDTASVS 523
           +L++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE + L G     SVS
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVS 564

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 39/52 (75%)

Query: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRA 593
           +W VM N+TG G++++P+   +++  LL+ KY+IFLDM ETQ++YR +V  A
Sbjct: 671 MWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDA 722

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/608 (54%), Positives = 431/608 (70%), Gaps = 30/608 (4%)

Query: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61
           + HYIGVDVGT SVRACV++  G ILSL SK I+++E++PNY+TQSS EIW+ IC C+  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121
           ++ +SQ++  S++GIGFDATCSLVV+++ T + V VGPNF+D  ++IILWMDHRA+ E +
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181
           EIN+TG +CLKYVGGKMS+EM++PKIKWLKNNL  G F  C+F+DL D+LTY+AT    R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSST--ASNFLSA 239
           SF STVCK GLLPLGV+GS  GW ++ F  I L EL    FS +GG + S    +N  S 
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240

Query: 240 GDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA-----GITLGSDGQESELAS 294
           G+YVGHLS+ +A +LGL T CIV SG+IDAYAGWVGT+AA     G     D   S+L S
Sbjct: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300

Query: 295 S--RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKS 352
           S   LA +AGTSTCHIT+S  P F++G+WGPYRD L   +W  EGGQSCTGALL H+L +
Sbjct: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360

Query: 353 HPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIAD 412
           HPAY  L +  +   +  F+F+NNRL EL++E  A+S+ +LGKH F YGDYHGNRSPI+D
Sbjct: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420

Query: 413 PNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRN 472
            +MRA IIGQSMD S+D LAIM L ACEFI+QQ+RQI+  + ++GH I  IYMSGGQ RN
Sbjct: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480

Query: 473 LVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASE----KYLHGCSDTASVSTIVDQ 528
            +L++LLA+CT LP+V+P+YIDA+V+FGSA+LG  A +    K+L G  +     T    
Sbjct: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKT---- 536

Query: 529 QRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRD 588
                        LW  M  LT  G +I P+ +   +  LL+ KY+IFLDM ETQ++YR 
Sbjct: 537 -------------LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRR 583

Query: 589 LVTRAENS 596
            +   E S
Sbjct: 584 QIDEIEAS 591

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/598 (54%), Positives = 437/598 (73%), Gaps = 18/598 (3%)

Query: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61
           + +YIGVDVGT SVRAC++D  GTI S A   I RQE++ + +TQSS EIWRA+CFC++K
Sbjct: 5   IYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKK 64

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121
           ++ +    +D + GIGFDATCSLVV+++VTN+GVAVGP+F+D  QDIILWMDHRA+ E  
Sbjct: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124

Query: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181
           EINST   CLKYVGG+MSIEM++PKIKWLK ++ +  F +CEFYDL D+LT++ATG K R
Sbjct: 125 EINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTR 184

Query: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVS-STASNFLSAG 240
           SFCS VCK G++P+GV+GS  GW +D   +I L EL   +++KLGG VS S   NFL+AG
Sbjct: 185 SFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAG 244

Query: 241 DYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASS--RLA 298
           +Y+  L+D+A  +L L+ +CIV SG+IDAYAGW+GT+ +G           +A++  RLA
Sbjct: 245 EYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGRLA 304

Query: 299 TVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDT 358
            VAGTSTCHI +SK P F+ GVWGPY+D +  GYW TEGGQSCTGALL HVL++HP+Y  
Sbjct: 305 AVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKE 364

Query: 359 LCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRAT 418
           L ++++  G++KFD++N RL E+ +    +SV  L KH+FFYGD HGNRSP+ADP+M+  
Sbjct: 365 LEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGA 424

Query: 419 IIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKL 478
           I+G SMD S+D+LA   L ACEFIAQQ RQI+E +  +GHEI++IYMSGGQCRN +L+KL
Sbjct: 425 IVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKL 484

Query: 479 LANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY-LHGCSDTASVSTIVDQQRITSELKP 537
           LA+C+ L +++P+YID+AVVFG+A+LG +AS+ Y L+G      ++T             
Sbjct: 485 LADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINT------------- 531

Query: 538 KQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAEN 595
            ++ILW+ M  +T +G  I P      +  LLD KY+IFLDM + QKRYR +V   E+
Sbjct: 532 -ENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/522 (60%), Positives = 404/522 (77%), Gaps = 14/522 (2%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           +Y+GVDVGT S RAC++D  G ILSLA KPI R+E++PNY+TQSS EIW++IC C++ ++
Sbjct: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
            DS V  + I GIGFDATCSLVV+++  +K V VGP F + +Q+I+LWMDHRAI E NEI
Sbjct: 94  RDSGVPVERIHGIGFDATCSLVVVDD-EDKEVGVGPVFANNDQNIVLWMDHRAIAETNEI 152

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           N+T  +CLKYVGG+MS+EM+IPKIKWLKNNLP+ +FDKC+F+DL D+LT++AT    RSF
Sbjct: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAEL-----CRREFSKLGGVVSSTASNFLS 238
           CSTVCK GL+P+GV+GS +GW +D    I L EL     C+  +         T  +FLS
Sbjct: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLS 272

Query: 239 AGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLG-SDGQESEL----- 292
           AG+YVG L +EAA +LGL   C+V SG+IDAYAGWVGT+AA   +   D  E++      
Sbjct: 273 AGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGI 332

Query: 293 --ASSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVL 350
             A+ RLA VAGTSTCHI +S+ P F++GVWGPYRD +  G+W  EGGQSCTGALLAHV+
Sbjct: 333 DRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVM 392

Query: 351 KSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPI 410
            +HPA+  L  L+    ISKFD++N+RLE L ++RG +SV AL KHL+FYGDYHGNRSPI
Sbjct: 393 STHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPI 452

Query: 411 ADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQC 470
           ADP+MRA IIGQSMD S+DDLAIM LGACEFIAQQTRQIVE +  +GH+I++I+MSGGQC
Sbjct: 453 ADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQC 512

Query: 471 RNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512
           RN +L++LLA+CT LPI++P+YIDAAVVFGSALLG  ASE +
Sbjct: 513 RNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESF 554

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%)

Query: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENSV 597
           LW VM  +TG G+++ PS   D +  LL+ KY+IFLDM ++Q+RYR+ + + E ++
Sbjct: 669 LWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAI 724

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/525 (62%), Positives = 395/525 (75%), Gaps = 20/525 (3%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           +YIGVDVGT S RAC++D  G I+SLA KPI R+E++P Y+TQSS EIW AIC+C++ ++
Sbjct: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
            DS V  + I GIGFDATCSLV +       V VGP+F++ +Q+IILWMDHRA+ E  EI
Sbjct: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           NST H  LKYVGG+MSIEM+IPKIKWLKN++P+ KF+   F+DL DFLTY+ATG   RSF
Sbjct: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTA----SNFLSA 239
            S+VCK GLLPLGV+GS  GW  +    I L EL   +F+KLGG V        SNFLSA
Sbjct: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272

Query: 240 GDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELA------ 293
           G YVG LS EAAADLGL   C+V SG+IDAYAGWVGT+AA     +D +  ELA      
Sbjct: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQ----TDEEIPELAKCEKGK 328

Query: 294 ------SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLA 347
                 + RLA VAGTSTCH+ +S+ P F+ GVWGPYRD + PG+W  EGGQSCTGALLA
Sbjct: 329 LGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLA 388

Query: 348 HVLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNR 407
           HVL +HPAY  L  L+++ G+SKFD++N+RLE L   R  +SV AL KHLFFYGDYHGNR
Sbjct: 389 HVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNR 448

Query: 408 SPIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSG 467
           SPIAD  MRA IIGQSMD SVDDLA+  LGACEFIAQQTRQIVE + +SGH I+SI+MSG
Sbjct: 449 SPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSG 508

Query: 468 GQCRNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512
           GQCRN +L++LLA+CT LPI++P+YIDAAVVFGSALLG  ASE Y
Sbjct: 509 GQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESY 553

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%)

Query: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAE 594
           LW VM ++TG G+++ P+   + +  LL+ KY+IFLDM  TQ++YR  + R E
Sbjct: 669 LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/603 (54%), Positives = 426/603 (70%), Gaps = 29/603 (4%)

Query: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61
           + +YIGVDVGT S RAC++D++G ILS+    I RQE++P Y+TQS+N+IW  IC CIR 
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 62  IICDSQV--VKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDE 119
           I+ +S V  +   I GIGFDATCSLVVL   T++ VAVGPNF+D +Q++ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 120 VNEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNK 179
             EINST  +CLKYVGG+MS+EM+IPKIKWLKNN+    +  C+F DLPDFLTY+ATGN 
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 180 CRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVV---SSTASNF 236
            RSFCS VCK GLLPLGV+GSTKGW ++   +IGL +L    F KLGG V   S    +F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 237 LSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAG-------ITLGSDGQE 289
            +AG+++G+LSD+++  +G+++KC V+SG+IDAYAGW+GTIAA        +    D   
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 290 SELASS-RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAH 348
             + SS RLA VAGTSTCHI+++  P F+ GVWGPYRD L   +W  EGGQSCTGALL H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 349 VLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRS 408
           VL++HPAY  LC ++K Q IS F+ +NN++ EL  +R       L K+LFFYGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 409 PIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGG 468
           P+AD  MR  IIG SMD S++DL  M LGACEFIAQQTR IV+ + +SG+ + S+YMSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 469 QCRNLVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQ 528
           QCRN +L++L++NC  LP+V+PK ID AVVFGSAL+G  ASE               + +
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE---------------LSK 525

Query: 529 QRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRD 588
               +  KP Q ILW VM  +TG G ++ P +      +LL  KY+I+LDMI TQKRYR 
Sbjct: 526 SHSDNTKKPDQ-ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRS 584

Query: 589 LVT 591
           +V 
Sbjct: 585 MVN 587

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/518 (59%), Positives = 394/518 (76%), Gaps = 9/518 (1%)

Query: 3   QHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKI 62
           + Y+GVDVGT S RACV+D  G +LSLA KPI R+++  N++TQSS EIW A+C+C+R +
Sbjct: 38  KFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTV 97

Query: 63  ICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNE 122
           + +S V  + + GIGFDATCSLVV+     + +AVGP+F + +Q+IILWMDHRA+ E  E
Sbjct: 98  VEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEE 157

Query: 123 INSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRS 182
           INS+G +CLKYVGG+MS+EM+IPKIKWLKNNL  G F  C+F+DLPD+LT++ATG + RS
Sbjct: 158 INSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRS 217

Query: 183 FCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDY 242
           FCS VCK G LP+GV+GS  GW ++    IGL+EL + +F +LGG +     NFL+AG+ 
Sbjct: 218 FCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLRE-KKNFLTAGEC 276

Query: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDG-QESEL-------AS 294
           +  L  +AA  LGLT  C+V+SG+IDAYAGWVGT+AA       G  E+E        A 
Sbjct: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAI 336

Query: 295 SRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHP 354
            RLA VAGTSTCHI +SK P F+ GVWGPYRD L  G+W  EGGQSCTG LL H++ +HP
Sbjct: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396

Query: 355 AYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPN 414
           A+  L  +A   G+SKF+++N  LE L E+R  +SV +L KHLFFYGDYHGNRSPIADPN
Sbjct: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456

Query: 415 MRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLV 474
           MRA IIGQSMD S++DLA+M L ACEFI+QQTRQI+E + +SGHEI +I+MSGGQCRN +
Sbjct: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516

Query: 475 LIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512
           L++LLA+CT LPIV+P+Y+DAAVVFGSALLG AASE +
Sbjct: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDF 554

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 38/57 (66%)

Query: 540 SILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENS 596
           S LW VM  LTG  +I+ P+     +  LLD KY+IFLDMIETQ++YR +V + E S
Sbjct: 656 SFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGS 712

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/594 (53%), Positives = 418/594 (70%), Gaps = 22/594 (3%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           H+IGVDVGT SVRACV+D  G IL+L  KPISR+E++P ++TQSS EIW +ICFC+RK+I
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
            D+++  + +IGIGFDATCSL V+++ T +G+AVGP F   +Q+II+WMDHRA  E +EI
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           NS     LKYVGGKMSIEM++PKIKWLKN++P+  F K  F+DLPD+LT++ATG + RS 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDYV 243
           CS VCK GLLP+GV+GST+GW +    + GL EL   EF ++GG   + + NFLSAG+YV
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGG-PGNNSRNFLSAGEYV 258

Query: 244 GHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLG------SDGQESELASSRL 297
             LS  +   LGLT  C+V SGLIDAYAG +GTIAA I         ++GQ+ + A  RL
Sbjct: 259 STLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGRL 318

Query: 298 ATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYD 357
           A VAGTSTCHIT+S  P F++GVWGPY+D L   YW  EGGQSCTG LL HV+ +HPAY+
Sbjct: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378

Query: 358 TLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRA 417
            L   A    +  F+ +N  + +L E++G  ++  L K LF YGDYHGNRSPIADP MRA
Sbjct: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438

Query: 418 TIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIK 477
           +IIGQSMD +V+ LA++ L ACEFIA QTR I+  + ++GH I SIYMSGGQCRN +L++
Sbjct: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498

Query: 478 LLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKP 537
           LLA+ T LP+V+PKYIDAAVVFG+AL+G  A +              + +Q     +  P
Sbjct: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWD--------------VFNQCETNDDRVP 544

Query: 538 K-QSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLV 590
           + +  LW  M  +TG G  I P     +   LL+ KY+I++DM +TQK+YR L+
Sbjct: 545 QVEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLI 598

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/580 (55%), Positives = 419/580 (72%), Gaps = 23/580 (3%)

Query: 3   QHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKI 62
           + ++GVDVGT S RAC++D  G ILSLA KPI R+E++ N++TQSS EIW A+C C++ +
Sbjct: 42  KFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAV 101

Query: 63  ICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNE 122
           + +S+V    + GIGFDATCSLVV+     KG+AVGP+F + +Q+IILWMDHRA+ E  E
Sbjct: 102 LQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEE 161

Query: 123 INSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRS 182
           INSTG +CLKYVGG+MS+EM IPKIKWLKNNL    F  C+F++LPD+LT++ATG + RS
Sbjct: 162 INSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRS 221

Query: 183 FCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDY 242
           F S VCK G LP GV+ S  GW ++    IGL+EL   +F +LGG +     NFLSAG+ 
Sbjct: 222 FASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK-KNFLSAGEC 280

Query: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDG------QESELASS- 295
           VG L   +A +LGLT  CIV SG+IDAYAGWVGT+AA  +    G      +++++ S+ 
Sbjct: 281 VGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAI 340

Query: 296 -RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHP 354
            RLA VAGTSTCHI +SK P F+ GVWGPYRD L   +W  EGGQSCTGALLAHV+K+HP
Sbjct: 341 GRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHP 400

Query: 355 AYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPN 414
           A+  L +LA    IS F+++N+ LE L ++R  +SV +L KH FFYGDYHGNRSPIADPN
Sbjct: 401 AFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPN 460

Query: 415 MRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLV 474
           MRA IIGQSMD SV+DLA+  LGACEFI+QQTRQI+E + ++GH I +I+MSGGQCRN +
Sbjct: 461 MRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGL 520

Query: 475 LIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSE 534
           L++LLA+CT LPI++P+YIDAAVVFGSALLG AASE      SD A+  TI   +R  S 
Sbjct: 521 LMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASE-----ASDLANEKTICQTRR--SS 573

Query: 535 LKPKQSIL---WTVMANLTGIGQI----IEPSNMLDSEIR 567
           L  K+ ++   +  + NL+G  Q     + P N   S I+
Sbjct: 574 LSQKEKVVNDPYKPIQNLSGEDQNLAFDVSPPNSTPSYIK 613

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 5/78 (6%)

Query: 517 SDTASVSTIVDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIF 576
           + T++V+  + ++R  S       +LW VM  LTG  +++ P++    +  LLD KY+IF
Sbjct: 645 TSTSTVTRGLQKERCNS-----GDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIF 699

Query: 577 LDMIETQKRYRDLVTRAE 594
           LDM E Q++YR++V R E
Sbjct: 700 LDMAENQRKYRNMVDRVE 717

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/519 (59%), Positives = 391/519 (75%), Gaps = 9/519 (1%)

Query: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61
           ++ Y+GVDVGT S RAC++D  G +LSLA KPI R+E++PN++TQSS EIW A+C C++ 
Sbjct: 37  VKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKA 96

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121
           +I +S+V  D + G+GFDATCSLVV+     KGVAVGP+F   +Q+IILWMDHRA+ E  
Sbjct: 97  VIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETE 156

Query: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181
           EINS+  +CLKYVGG+MS+EM+IPKIKWLKNNL    F  C+F+DLPD+LT++ATG + R
Sbjct: 157 EINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENR 216

Query: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGD 241
           SF S VCK G LP GV+GS  GW ++    IGL+EL   +F KLGG +     NFLSAG+
Sbjct: 217 SFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHK-KNFLSAGE 275

Query: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA-------GITLGSDGQES-ELA 293
            +G L  +AA +LGLT  C+V+SGLIDAYAGWVGT+AA       G+    D   +   A
Sbjct: 276 CIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGA 335

Query: 294 SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSH 353
             RLA VAGTSTCHI +SK P F+ G+WGPYRD L  G+W  EGGQSCTG LL HV+K H
Sbjct: 336 IGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIH 395

Query: 354 PAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADP 413
           PAY  L +L    G+SKF+++N+ LE + ++R  +SV +L +HLFFYGDYHGNRSPIAD 
Sbjct: 396 PAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADS 455

Query: 414 NMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNL 473
           NMRA IIGQSMD SV+DLAI  L ACEFI+QQTRQIVE + +SGH+I +I+MSGGQCRN 
Sbjct: 456 NMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRND 515

Query: 474 VLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512
           +L +LLA+C+ LPIV+P+YID AVVFGSALLG AASE +
Sbjct: 516 LLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAF 554

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 35/56 (62%)

Query: 541 ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENS 596
           ILW VM  LTG  + + P+     +  LLD KY+IFLDM ETQKRYR +V   E S
Sbjct: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEES 711

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/518 (59%), Positives = 390/518 (75%), Gaps = 9/518 (1%)

Query: 3   QHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKI 62
           + Y+GVDVGT S RAC++D  G ILSLA KPI R+E+  N++TQSS EIW A+C+C+RK+
Sbjct: 29  KFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKV 88

Query: 63  ICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNE 122
           I ++ V    I GIGFDATCSLVV+     K +AVGP+F + +Q+IILWMDHRA+ E  E
Sbjct: 89  IQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEE 148

Query: 123 INSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRS 182
           IN +G+ CLKYVGG+MS+EM+IPKIKWLKNNL  G F  C+F+DLPD+LT+RATG + RS
Sbjct: 149 INFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRS 208

Query: 183 FCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDY 242
           F S VCK G LP GV+GS  GW +   + IGL+EL   +F KLGG + +   NFLSAG+ 
Sbjct: 209 FSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-KNFLSAGEC 267

Query: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA-------GITLGSD-GQESELAS 294
           +G L  +AA  LGLT  C+V+SG+IDAYAGWVGT+AA       G+T   D   +   A 
Sbjct: 268 IGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAI 327

Query: 295 SRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHP 354
            RLA VAGTSTCHI +SK   F+ G+WGPYRD L  G+W  EGGQSCTG LL HV+ +HP
Sbjct: 328 GRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHP 387

Query: 355 AYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPN 414
           A+  L +LA    +SKF+++N+ LE L E+R  +SV  L KHLFFYGDY GNRSPIADPN
Sbjct: 388 AFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPN 447

Query: 415 MRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLV 474
           MRA IIGQSMD S+DDLA++ LGACEFI+QQTRQI+E + +SGH I +++MSGGQCRN +
Sbjct: 448 MRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGL 507

Query: 475 LIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512
           L++LLA+CT LPIV+P+YID AVVFGSALLG AAS+ +
Sbjct: 508 LMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVF 545

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 517 SDTASVSTIVDQQR--ITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYE 574
           SD +S    +D+ R  +  E    ++ILW VM  LTG  ++I P+     +  LLD KY+
Sbjct: 620 SDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQ 679

Query: 575 IFLDMIETQKRYRDLVTRAENS 596
           IFLDM+ETQ+ YR +V + E +
Sbjct: 680 IFLDMVETQRNYRRMVDKVEET 701

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/594 (52%), Positives = 411/594 (69%), Gaps = 20/594 (3%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           +YIGVDVGT S RA ++   G  L+L   PI RQE++ +++TQSS+EIW A+C C+R ++
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
             S V    + GIGFDATCSLV ++ VT   V VGPNFDD  Q+IILWMDHRA  E + I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           N+TG RCLKYVGG+MS+EM++PKIKWLK ++P+G+F KC+F+DLPD+LT+ AT    RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDYV 243
           CS VCK GLLP GVDGS   W  +  E +GL+EL    F +LGG  S +   FL+AG  V
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGT-SESKPKFLTAGQPV 244

Query: 244 GHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLATVAGT 303
           G L+ EA+   GL+T CIVASG+IDAYAGW+G++ A           ++A +RLA +AGT
Sbjct: 245 GQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLALIAGT 304

Query: 304 STCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLCKLA 363
           STCHI +SK P F+ GVWGPYRD L+PGYW  EGGQSCTGALLAH+L++HPA++ L +LA
Sbjct: 305 STCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELVRLA 364

Query: 364 KNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATIIGQS 423
             Q +S F+++   L+ L  +R  ++V  L +  F YGD+HGNRSP+ADP+MRAT+IGQS
Sbjct: 365 AKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVIGQS 424

Query: 424 MDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLANCT 483
           MDVS++ LA+  L ACEFIA QTRQIVE + ++GH +  +YMSGGQCRN +L++L+A+  
Sbjct: 425 MDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIADSV 484

Query: 484 KLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPKQSILW 543
            +P+VLPKY D  VVFG+ALL   AS+    GC    +     DQ           + LW
Sbjct: 485 GVPVVLPKYTDCCVVFGAALLACCASK----GCDGIEA-----DQ----------STRLW 525

Query: 544 TVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENSV 597
            +M  +T +G  + P++    E + +D KY IFLDMIE QK YR  + +   S+
Sbjct: 526 DIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSI 579

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/595 (52%), Positives = 420/595 (70%), Gaps = 27/595 (4%)

Query: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63
           +Y+G+DVGT SVRACVVD  G +LSL  K I+R+E++PN++TQS+ EIW+A CFC++  I
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123
              +V K  ++GIGFDATCSLV +E+ T+K V VGPNF++ + ++ILWMDHRA+ E NEI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183
           N+T  +CLKYVGG MS+EM IPKIKWLKNN+    F KCEF++L D+LT++ATG + RSF
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSS-TASNFLSAGDY 242
           CS VCK G LP GV+GS++GW ++    IGL +L    +  LGG + + +  NF S+G  
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255

Query: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESEL------ASSR 296
           +G LS+EA  +LGL+  C+V +G+IDAYAG +GTIAA  + GS   +++       A  R
Sbjct: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAA-TSEGSHQIKNDSSIGLQNAIGR 314

Query: 297 LATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAY 356
           LA+VAGTSTCH+ +SK P F+ GVWGPYRD +  GYW  EGGQ+CTG LL++VL  HPA+
Sbjct: 315 LASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAF 374

Query: 357 DTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMR 416
             L   +    I KF ++NN L+EL  +    S   L KH+FFYGDY GNRSP ADP M 
Sbjct: 375 KELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMS 434

Query: 417 ATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLI 476
           A IIGQSM+ ++++LA+  L ACEFIAQQTRQIVE I+++G  ++ IYMSGGQCRN +L+
Sbjct: 435 AAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLM 494

Query: 477 KLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELK 536
           KLL++CT LPI+LPKY+DAAVVFG+A+LG  A                  D  R + E++
Sbjct: 495 KLLSDCTGLPIMLPKYVDAAVVFGAAILGATA------------------DASRKSVEIE 536

Query: 537 PKQS-ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLV 590
                +LW  M  +T  G ++EP+++   + +LLD KY+IFLDM ETQ++YR +V
Sbjct: 537 CDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMV 591

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/595 (51%), Positives = 405/595 (68%), Gaps = 23/595 (3%)

Query: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61
           + +YIGVDVG+ SVRACVVD  G +LS+A++ IS++E  P ++TQSSNEIW A+C+C++ 
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121
            I +S V    I+GIGFDATCSLVVL + + + VA GPNFD+  Q+II+WMDHRAI+E  
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181
           EIN +G  CLKYVGG+MS+EM+IPKIKWLKN++   +F K  F DLPD+LT+ A+G   R
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGD 241
           S+CS VCK G LP GV+GS+KGW  +    IGL E+ +  F+ LGG   + + NF  AG+
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGG--PNESGNFTYAGN 238

Query: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQES---ELASSRLA 298
            +  +S+       +   CIV SG+IDAYAGW+GT+A+      + +E    E  + RLA
Sbjct: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLA 298

Query: 299 TVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDT 358
            VAGTSTCHI +SK   F+ GVWGPYRD L+P YW  EGGQS TGALLAH+L  HP+ + 
Sbjct: 299 AVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANE 358

Query: 359 LCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRAT 418
           L  L K + + KF F+NN + EL  +   ++   L K  F YGDYHGNRSPIADPNMRA 
Sbjct: 359 LSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAA 418

Query: 419 IIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKL 478
           IIGQSMD S+DDLA   L ACEFIA QT+ I++ +  +GH I +IYMSGGQCRN +L++L
Sbjct: 419 IIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQL 478

Query: 479 LANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPK 538
           +ANCT LP+++PKYID+AVVFGSA+LG  A     +  SD                 K  
Sbjct: 479 IANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNN-SD-----------------KGG 520

Query: 539 QSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRA 593
             +LW+ M+N+T  G  + P+     E +L++ K++IFLDM +TQ+ YR LV  A
Sbjct: 521 ADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENA 575

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/592 (49%), Positives = 397/592 (67%), Gaps = 21/592 (3%)

Query: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61
           + +YIGVDVGT S RAC+ + +G IL++  K IS+QE+Q  ++TQSSNEIW AI   I++
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121
           +I  S V   SI GI FDATCSLVV ++ + + +AVGPNFDD  Q+IILWMDHRA  E +
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181
            INST  + LKYVGGKMS+E ++PKIKWLK++L    F +C F DL DFLTY+ATG    
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGD 241
           SF S VCK GLLP GV+GS  GW ++  E IGL EL    F KLGG ++    NFL  GD
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240

Query: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGIT--LGSDGQES----ELASS 295
            VGH+  + A    L   C+V +G+IDAY+GWVGT+A+ ++  + SD  +     E +  
Sbjct: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG 300

Query: 296 RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPA 355
           R+A V+GTSTCHI +SK P F+ GVWGPYRD L    W TEGGQS TGALL +++++HPA
Sbjct: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360

Query: 356 YDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNM 415
           Y  L ++   Q  + F +++ +LEEL+  R   SV  L K++F YGDY+GNRSP+ADP M
Sbjct: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420

Query: 416 RATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVL 475
              IIGQ+MD S++DLAI  L ACEFIA QTR I++ +   GH IT+IYMSGG C+N +L
Sbjct: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480

Query: 476 IKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSEL 535
           ++L++NC  LP+VL KYID++VVFG+A+LG  A           A ++++  + ++   L
Sbjct: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVA-----------AKINSM-KENKLEYSL 528

Query: 536 KPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYR 587
                +LW+ M  +T  G ++ P +      + L  KYE++LDMI+T  +YR
Sbjct: 529 ---NDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYR 577

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  215 bits (548), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 175/613 (28%), Positives = 278/613 (45%), Gaps = 104/613 (16%)

Query: 6   IGVDVGTESVRACVVDVHGTIL-SLASKPISRQEIQPNY---------LTQSSNEIWRAI 55
           IG+D+G+ S R  + D +  +L ++A +P+      P Y           Q S EI +A+
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPV------PYYHDSSKKSWKFWQKSTEIIKAL 62

Query: 56  CFCIRKIICDSQVVKDSIIGIGFDATCSLVVLE-EVTNKGVAVGPNFDDFEQDIILWMDH 114
             C +++    ++ + ++   G  ATCSL + + ++TN  +   PN    E ++I WMD 
Sbjct: 63  QNCFQEL----KITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYPN----EDNVIFWMDS 114

Query: 115 RAIDEVNEINST-GHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTY 173
            A+DE   +N     + L Y+GGK   EM IPK+K+  N     +  +   +DL  ++ Y
Sbjct: 115 SAVDECEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAY 174

Query: 174 RATGNKCRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTA 233
                   +      +  +  +G DG   GW    + DI           KL   V+   
Sbjct: 175 ELGRLYRWNTDELSARENINGIGNDGEASGWSSSFYNDI----------MKLPSNVT--- 221

Query: 234 SNFLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELA 293
                    +G     +      TT C      ID+YA W    +  +            
Sbjct: 222 ---------IGLTGLNSNNSSSTTTVC----SCIDSYASWFAVSSPNL------------ 256

Query: 294 SSRLATVAGTSTCH-----ITISKCPHFMDGVWGPYRDALMPG--YWVTEGGQSCTGALL 346
            + L  +AGTSTC+     +T +K P    GVWGP+   L     Y V   GQSCTG L+
Sbjct: 257 EASLFMIAGTSTCYMYGSPVTTTKIP----GVWGPFDTILETNGNYSVYTAGQSCTGKLI 312

Query: 347 AHVLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGN 406
            H+ KSHPA     +  +  G   ++ + N ++++ E++  +S+  L KH+FFYGDY GN
Sbjct: 313 EHLFKSHPA----ARKIQRSGEDIYEVLENSIQDI-EKKNRKSIHILAKHMFFYGDYEGN 367

Query: 407 RSPIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHI--KQSGHEITSIY 464
           R+P AD  MR + IG+S D S+ +L    +   EF++ QT+ I++    + SG  I  + 
Sbjct: 368 RTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEELR 427

Query: 465 MSGGQCRNLVLIKLLANCTK-LPIVLP-KYIDAAVVFGSALLGVAASEKYLHGCSDTASV 522
           +SG Q +N  L+ L++     + I  P + ID   V G+ +LG +A+EK          +
Sbjct: 428 VSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEK-----KQIIDI 482

Query: 523 STIVDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIET 582
               D    + E +P             G  Q+     +L    RLL  KY I LDM + 
Sbjct: 483 IRERDANADSEEFEP------------FGTYQLGNDCILLK---RLLSVKYRIHLDMAKQ 527

Query: 583 QKRYRDLVTRAEN 595
           Q++Y  LV  A N
Sbjct: 528 QQQYHRLVDEALN 540

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  204 bits (518), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 172/608 (28%), Positives = 277/608 (45%), Gaps = 104/608 (17%)

Query: 6   IGVDVGTESVRACVVDVHG-TILSLASKPISRQEIQPN---YLTQSSNEIWRAICFCIRK 61
           IG+DVG+ S R  + +     +L +A +P+   +          Q S EI +A+  C++K
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQK 93

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVG-PNFDDFEQDIILWMDHRAIDEV 120
           +    ++ + ++   G  ATCSL + E+    G  +  PN    E ++I WMD  AIDE 
Sbjct: 94  L----KITEYNVKSCGVSATCSLAIFEKDKRNGSLIPYPN----EDNVIFWMDSSAIDEC 145

Query: 121 NEINST-GHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNK 179
            ++N+    + L ++GG    EM IPK+K+  N     +  +   +DL  ++ Y  +   
Sbjct: 146 KQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLY 205

Query: 180 CRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSA 239
             +    + +     +GVDG   GW    +E+I                     SN +  
Sbjct: 206 QWNNEVLLKRENNKMVGVDGEASGWSPSFYENI-----------------MHLPSNVIIG 248

Query: 240 GDYVGHLSDEAAADLGLTTKCIVASGL----IDAYAGWVGTIAAGITLGSDGQESELASS 295
            +             G T K I +S +    ID+YA W    +  +             +
Sbjct: 249 SN-------------GATCKKIASSAIVRSCIDSYASWFAVSSPHL------------ET 283

Query: 296 RLATVAGTSTCH-----ITISKCPHFMDGVWGPYRDALMPG--YWVTEGGQSCTGALLAH 348
            L  +AGTSTC+     IT  K P    GVWGP+   L     + V   GQSCTG L+ H
Sbjct: 284 SLFMIAGTSTCYMYGTPITDIKIP----GVWGPFDSILDSNSHFSVYAAGQSCTGKLIEH 339

Query: 349 VLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRS 408
           +  +HP    + K    +G   +  +   + +++++ G QSV    K +FFYGDY GNR+
Sbjct: 340 LFVTHPCAKEILK----RGADIYQVLERTIHDIEKQNG-QSVHVFTKDIFFYGDYEGNRT 394

Query: 409 PIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQS--GHEITSIYMS 466
           P ADP M+ + IG++ D S+ +L    +   EF++ QTR I++  K+   G  I  + +S
Sbjct: 395 PFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELRIS 454

Query: 467 GGQCRNLVLIKLLANCTK-LPIVLPK-YIDAAVVFGSALLGVAASEKYLHGCSDTASVST 524
           G Q +N  L+ L++     + I  PK  +D   V G+ LL  +A+E              
Sbjct: 455 GSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEG-----------KQ 503

Query: 525 IVD--QQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIET 582
           I+D  ++R TS+   K   L           Q++  S++L    RLL  KY I LDM + 
Sbjct: 504 IIDVIRERDTSDDNEKFEPLPEY--------QLLNDSSLLR---RLLWAKYRIHLDMAKQ 552

Query: 583 QKRYRDLV 590
           Q+RY  L+
Sbjct: 553 QQRYHKLI 560

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  192 bits (488), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 164/605 (27%), Positives = 278/605 (45%), Gaps = 90/605 (14%)

Query: 2   LQHYIGVDVGTESVRACVVDVHG-TILSLASKPISRQEIQPNY---LTQSSNEIWRAICF 57
           LQ  IG+DVG+ S R  V + +   +L +A +P+   +          Q S EI +A+  
Sbjct: 5   LQVGIGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQK 64

Query: 58  CIRKIICDSQVVKDSIIGIGFDATCSLVVLE-EVTNKGVAVGPNFDDFEQDIILWMDHRA 116
           C++K+      VK      G  ATCSL + E + T+  +   PN    E ++I WMD  A
Sbjct: 65  CLQKLNIREYEVK----SCGVSATCSLAIFERDRTSNMLIPYPN----EDNVIFWMDSSA 116

Query: 117 IDEVNEIN-STGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRA 175
           ++E   +N     + L Y+GGK   EM +PK+K+  +     +      +DL  ++ Y  
Sbjct: 117 VNECQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYEL 176

Query: 176 TGNKCRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASN 235
           +     +    + +  L  +G DG   GW    +++I            L   VS     
Sbjct: 177 SRLYEWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI----------INLPSNVS----- 221

Query: 236 FLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASS 295
                  +G  S  A   +  T    V    ID+YA W    +  +             +
Sbjct: 222 -------IGTTSLVANKHISTT----VVRSCIDSYASWFAVASPHL------------ET 258

Query: 296 RLATVAGTSTCHI---TISKCPHFMDGVWGPYRDALMPG---YWVTEGGQSCTGALLAHV 349
            L  +AGTS+C++   TIS     + GVWGP+ D ++     + V   GQSCTG L+ H+
Sbjct: 259 SLFMIAGTSSCYMYGTTISDTR--IPGVWGPF-DTILDNRGDFSVYAAGQSCTGKLIEHL 315

Query: 350 LKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSP 409
            +SHP    + K     G   +  +   + ++++  G  S+  L K +FFYGDY GNR+P
Sbjct: 316 FESHPCARKILK----DGADIYQVLEQTIRDIEKNNGL-SIHILTKDMFFYGDYEGNRTP 370

Query: 410 IADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIK--QSGHEITSIYMSG 467
            ADP ++ + IG+S D S+ +L    +   EF++ QT+ I++  +   S   I  + +SG
Sbjct: 371 FADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRISG 430

Query: 468 GQCRNLVLIKLLANCTK-LPIVLPK-YIDAAVVFGSALLGVAASEKYLHGCSDTASVSTI 525
            Q +N  L+ L++     + I+ PK  +D   + G+ +L  +A EK          ++ +
Sbjct: 431 SQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEK--------KQLADV 482

Query: 526 VDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKR 585
           + ++ I+++ +  +S+    + N + + +            +LL  KY I LDM + QKR
Sbjct: 483 ITERDISNDSEKFESLAEYRLGNDSILLR------------KLLCVKYHIHLDMAKQQKR 530

Query: 586 YRDLV 590
           Y  LV
Sbjct: 531 YHKLV 535

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  191 bits (485), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 167/614 (27%), Positives = 262/614 (42%), Gaps = 115/614 (18%)

Query: 6   IGVDVGTESVRACVVDVH-GTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKIIC 64
           +G+D+G+  VR    ++     +++ S+ ++  E +    TQSS EI RAI  C   +  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESLNI 67

Query: 65  DSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDF----EQDIILWMDHRAIDEV 120
           D   V+      G  ATCSL V    + KG+     ++D     +Q+++ WMD  AI+E 
Sbjct: 68  DIWAVQ----SCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 121 NEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKC 180
           + IN        Y GG    EM +PK+     +  +   D  E +DL  ++ Y       
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNNSD-FEVFDLHTYVAYDLANRYG 182

Query: 181 RSFCSTVCKMGLLPLGVDGSTKGWPQDLFE-------DIGLAELC-RREFSKLGGVVSST 232
                 + +     +G DG  KGW  + +E       ++ +  LC  R FS         
Sbjct: 183 WDASFLINRPNHNGIGHDGEIKGWKDEFYEKTLKLPPNVRIGPLCINRRFSP-------- 234

Query: 233 ASNFLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESEL 292
                                       +  +  ID Y+ W                S  
Sbjct: 235 ----------------------------VKVASCIDCYSSWFSMF------------SST 254

Query: 293 ASSRLATVAGTSTCHITISKCP-HFMDGVWGPYRDAL----MPGYWVTEGGQSCTGALLA 347
               L   AGTSTC++  +  P   + G+WGP+ D L     P + V E GQS TG L+ 
Sbjct: 255 PERSLFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGKLIE 314

Query: 348 HVLKSHPAYDTLCKLAKNQGISKFDFINNRLE---ELKEERGAQSVAALGKHLFFYGDYH 404
           H+ +SHPA            +   + + NRLE    L E++ A+SV    KH+F YG+  
Sbjct: 315 HLFESHPAAKPY--------LEDRNVLFNRLETEINLIEQQSAESVHFKTKHMFNYGELQ 366

Query: 405 GNRSPIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIY 464
           GNR+P  DP M    IG+S D S  DL +  +   EF+A Q R I E +   G  I  I 
Sbjct: 367 GNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPINDIR 423

Query: 465 MSGGQCRNLVLIKLLA-----NCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDT 519
           ++G Q +N  L+ L++     +  ++P     Y+    V G+ LLG A   K+L      
Sbjct: 424 VAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVG---VQGAYLLGKA---KHL-----G 472

Query: 520 ASVSTIVDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDM 579
            +V  ++ Q+       P + I   +  N           N L +   L + KY+I+L+M
Sbjct: 473 LNVVELITQE--NGGESPMKDIEVRIEKN---------EENKLRA---LFEIKYKIYLNM 518

Query: 580 IETQKRYRDLVTRA 593
            +TQ++YR++V  A
Sbjct: 519 AQTQRQYREMVNAA 532

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  187 bits (476), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 155/606 (25%), Positives = 272/606 (44%), Gaps = 100/606 (16%)

Query: 6   IGVDVGTESVRACVVDVHG-TILSLASKPISRQE---IQPNYLTQSSNEIWRAICFCIRK 61
           IG+D+G+ S R  +   +   +L +A +P+   +    +     Q S EI  A+  C +K
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEV-TNKGVAVGPNFDDFEQDIILWMDHRAIDEV 120
           +    ++ + ++   G  ATCSL + E V T++ +   PN    E ++I WMD  A DE 
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSEALIPYPN----ENNVIFWMDSSATDEC 120

Query: 121 NEINST-GHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNK 179
             +N+    + L Y+GG+   EM IPK+K+  N     +  +   +DL  ++ Y      
Sbjct: 121 EWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLY 180

Query: 180 CRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSA 239
             +    +    +  +G DG   GW    +++I                  +  SN +  
Sbjct: 181 QWNIDGLLRGENINGIGNDGEASGWSSSFYKNI-----------------MNIPSNVI-- 221

Query: 240 GDYVGHLSDEAAADLGLTTKCIVASGL----IDAYAGWVGTIAAGITLGSDGQESELASS 295
                         +GL +K ++++ +    ID+YA W                      
Sbjct: 222 -----------IGPVGLVSKKVISTTVVRSCIDSYASWFAV------------SPPFLER 258

Query: 296 RLATVAGTSTCH-----ITISKCPHFMDGVWGPYRDAL--MPGYWVTEGGQSCTGALLAH 348
            L  +AGTS+C+     ++ +K P    GVWGP+ + L     + V   GQSCTG L+ H
Sbjct: 259 SLFMIAGTSSCYMYGTPVSNTKIP----GVWGPFNNILDDKGDFSVYAAGQSCTGKLIEH 314

Query: 349 VLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRS 408
           + +SHP    + K     G   +  +   +  +++++G  S+  L K +FFYGDY GNR+
Sbjct: 315 LFESHPCARKILK----SGADIYQVLEQTIHGIEKKKGL-SIHILAKDMFFYGDYEGNRT 369

Query: 409 PIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGH--EITSIYMS 466
           P ADP M+ + IG++ D S+ +L    +   EF++ QT+ I++  +       I  + +S
Sbjct: 370 PFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELRIS 429

Query: 467 GGQCRNLVLIKLLANCTK-LPIVLPK-YIDAAVVFGSALLGVAASEKYLHGCSDTASVST 524
           G Q RN  L+ L++     + I  P+  +D   + G+ +L  +A+EK          +  
Sbjct: 430 GSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEK--------KQLVD 481

Query: 525 IVDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQK 584
           ++ ++ +  + +  Q +    + N          S +L +   LL  KY I LDM + QK
Sbjct: 482 VIRERDVGDDNEKFQPLSEYCLGN---------DSTLLKN---LLCVKYRIHLDMAKQQK 529

Query: 585 RYRDLV 590
            Y  LV
Sbjct: 530 YYYKLV 535

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  182 bits (462), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 167/606 (27%), Positives = 270/606 (44%), Gaps = 107/606 (17%)

Query: 6   IGVDVGTESVRACVVDVH-GTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKIIC 64
           +G+D+G+ +VR  + D+    ++ + +KP+       N +TQSS +I  AI  CI+ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDLNP 70

Query: 65  DSQVVKDSIIGIGFDATCSLVV-------LEEVTNKGVAVGPNFDDFEQDIILWMDHRAI 117
           D +    S++  G  ATCSL V       L+ +   GV   P       +++ WMD  A 
Sbjct: 71  DLK----SVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPC-----HNVVFWMDSSAT 121

Query: 118 DEVNEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATG 177
            E   +N T  R  +++GG    EM IPK+  +    P+ +  K E +DL  ++ Y    
Sbjct: 122 LECEIVNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAI 180

Query: 178 NKCRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFL 237
                    + K     +G DG  KGW    + D+    L      K+G + +       
Sbjct: 181 KYGWDTSRIINKPNENRIGHDGELKGWDAGFYNDV----LKLPANVKIGPIHA------- 229

Query: 238 SAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRL 297
                           L   +   VAS  ID Y+ W    ++              ++ L
Sbjct: 230 ----------------LNTESPVRVAS-CIDCYSNWFSMCSSS------------PNNSL 260

Query: 298 ATVAGTSTCHITI-SKCPHFMDGVWGPYRDAL----MPGYWVTEGGQSCTGALLAHVLKS 352
              AGTSTC++   ++    + GVWGP+ + L       + V E GQS TG L+ H+ ++
Sbjct: 261 FMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFET 320

Query: 353 HPAYDTLCKLAKNQGISK---FDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSP 409
           HPA       A+   + K   F  I + +E+L+++ G +SV    KH+F YG+  GNR+P
Sbjct: 321 HPA-------ARAYSMDKSKLFSAIESAIEKLEQDFG-ESVHFRSKHMFTYGELQGNRTP 372

Query: 410 IADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQ 469
             D +M    IG++ D S  DL +  +   EF+A Q + I E  K    EI  I ++G Q
Sbjct: 373 YCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EIKDIRIAGSQ 429

Query: 470 CRNLVLIKLLANCT-KLPIVLP-KYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVD 527
            +N  L+ L +    ++ + +P +  D   V G+ LLG AA +       +   +  I  
Sbjct: 430 AKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHK-------NINIIDLIDK 482

Query: 528 QQRITS---ELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQK 584
           + R+ S   EL P                  ++  N      +LL+ KY+I+LDM +TQ 
Sbjct: 483 RDRLQSHILELGP------------------MKLGNHNTKLKQLLEAKYKIYLDMAQTQM 524

Query: 585 RYRDLV 590
           RYR +V
Sbjct: 525 RYRAMV 530

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  181 bits (459), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 169/607 (27%), Positives = 264/607 (43%), Gaps = 96/607 (15%)

Query: 6   IGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNY--------LTQSSNEIWRAICF 57
           IG+D+G+ SVR  +  +   ++    K    Q+I   Y         TQS++EI + I  
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVK----QKISYYYHGDSALWEYTQSTDEIMKVIER 61

Query: 58  CIRKIICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAI 117
           C+  +  D   +K      G  ATCS+ +  +  N             Q++I WMD+ + 
Sbjct: 62  CLHDLKIDEYNIK----SCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSK 117

Query: 118 DEVNEINSTGHRCLK-YVGGKMSIEMQIPKIKWLKNNLPQGKFDKCE-----FYDLPDFL 171
            E   +N+   + L+ ++GGK   EM IPKI  L N L     D  +       DL  +L
Sbjct: 118 TECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSS--DDLQNLSVVAMDLHRYL 175

Query: 172 TYRATGNKCRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSS 231
            Y        +F   +       +G DG   GW    + D                    
Sbjct: 176 AYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYID-----------------TLK 218

Query: 232 TASNFLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESE 291
             SN     +    L D+     G+   CI      D Y+ W+               S 
Sbjct: 219 IPSNITIGPE--PPLEDDFEYCKGIVASCI------DCYSSWLSLC------------SP 258

Query: 292 LASSRLATVAGTSTCHITISKCPHFMDGVWGPYRDAL--MPGYWVTEGGQSCTGALLAHV 349
                L  V GTSTC++  +     + GVWGP+ D L     Y V EGGQSCTG L+ H+
Sbjct: 259 TPEESLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTGKLIEHL 318

Query: 350 LKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSP 409
           L++HPA  ++   AK+      + I   +  ++E+ G +S+    KH+FFYGD+ GNR+P
Sbjct: 319 LQTHPASSSI---AKDDWPLLLEKIEQEISAIEEQTG-RSIHFKTKHMFFYGDFQGNRTP 374

Query: 410 IADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVE--HIKQSGHEITSIYMSG 467
            ADP M    IG++ DVS ++L +  +   EF+A Q + ++   +  Q   +IT I + G
Sbjct: 375 YADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDKITEIRICG 434

Query: 468 GQCRNLVLIKLLANCTK-LPIVLPKY-IDAAVVFGSALLGVAASEKYLHGCSDTASVSTI 525
            Q +N  L+ L++   +   I LPK  ++ + V G+ LLG +A    L   S    +   
Sbjct: 435 SQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSA----LLNKSPLDLIQEK 490

Query: 526 VDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKR 585
            DQ+++     P                 I +P +M      LL+ KYEI LDM + Q  
Sbjct: 491 DDQKQVDIFETP---------------SSINQPLSM------LLEAKYEIHLDMAKQQLI 529

Query: 586 YRDLVTR 592
           YR+++ +
Sbjct: 530 YREMINK 536

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  181 bits (459), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 170/613 (27%), Positives = 275/613 (44%), Gaps = 112/613 (18%)

Query: 6   IGVDVGTESVRACVVDVHG-TILSLASKPISRQEIQPNYLTQSSNEIWR------AICFC 58
           IG+D+G+ SVR  +  +H  ++L + SKP+      P Y   +   +W        I   
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPV------PYYYESNRTSLWEYTQDSAEILTA 61

Query: 59  IRKIICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAID 118
           I++    + + K  +   G  ATCSLV+ E     G     + +   ++++ WMD  A +
Sbjct: 62  IKECFDMADLQKYDVKSCGVAATCSLVLCER---SGDDTFQHCEGDSRNVVFWMDSMAKE 118

Query: 119 EVNEINSTGHRC----LKYVGGKMSIEMQIPKI-KWLKN--NLPQGKFDKCEFYDLPDFL 171
           E N +N+   RC    L ++GG    EM IPK+ ++LK+  + P+G   + E +DL  ++
Sbjct: 119 ETNSLNA---RCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNI-QWEVFDLHKYV 174

Query: 172 TYRATGNKCRSFCSTVCKMGLLP----LGVDGSTKGWPQDLFEDIGLAELCRREFSKLGG 227
            Y+      + +C    ++   P    +G DG   GW +  ++ I           +L  
Sbjct: 175 AYKLA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI----------VRLPP 220

Query: 228 VVSSTASNFLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDG 287
            V+      +   D +                 ++    ID Y+ W   + +        
Sbjct: 221 NVTIGCPKTIENEDSL-----------------VIVDSCIDCYSSWFSPLQS-------- 255

Query: 288 QESELASSRLATVAGTSTCHIT---ISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGA 344
               L  + L  VAGTSTC+I      K    + G+WGP+ D L     V E G SC+G 
Sbjct: 256 ----LNKNTLFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCSGK 311

Query: 345 LLAHVLKSHPAYDTLCKLAKNQGISKFDFINNRLEELK--EERGAQSVAALGKHLFFYGD 402
           L+ H+  SHP+  +L  L+  Q ISK +      EE+   E + A S+     + F YGD
Sbjct: 312 LIEHLFTSHPSAISL-NLSTGQLISKLE------EEINIWETQNATSIHFEACNNFLYGD 364

Query: 403 YHGNRSPIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITS 462
             GNR+P  DP MR   IG+S D S  DL +  +   E +A QT+ +V++ ++  + I  
Sbjct: 365 LDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKL-NSINE 423

Query: 463 IYMSGGQCRNLVLIKL--LANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTA 520
           +++ G Q +N  L+KL  L N   L +V  +  D   V G+ LLG A    YL    D  
Sbjct: 424 LFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAG---YLGTSVDLV 480

Query: 521 SVSTIVDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMI 580
            VS            +P++ I        T     I+ + +     +LL  KY I L+M 
Sbjct: 481 PVS------------EPREYI----SVKYTNDSDKIQQTKLY----KLLLTKYIIHLEMA 520

Query: 581 ETQKRYRDLVTRA 593
           E Q+R+R +V++A
Sbjct: 521 EQQQRFRKMVSKA 533

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  177 bits (449), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 172/602 (28%), Positives = 267/602 (44%), Gaps = 96/602 (15%)

Query: 6   IGVDVGTESVRACVVDVHG-TILSLASKPISRQEI-QPNYLTQSSNEIWRAICFCIRKII 63
           +GVD+G+ SVR  +  +   ++L +  +P+           TQS+ EI  A+  C+ ++ 
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL- 71

Query: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFE----QDIILWMDHRAIDE 119
              +    SI+  G  ATCS+ V       G     +    +    ++++ WMD  A + 
Sbjct: 72  -GLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVASEA 130

Query: 120 VNEINS--TGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATG 177
            + ++   + H      GG +  EM +PK+  L    P       E +DL  ++ Y    
Sbjct: 131 CDALDKRVSTHVKAALCGGFIP-EMGVPKLLHLVGQFPGRSL---EVFDLHKYIAY---- 182

Query: 178 NKCRSFCSTVCKMGLLP----LGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVS-ST 232
           +  R +   +  +   P    +G DG   GWPQ+ +          R   KL   V+   
Sbjct: 183 DLARRYGWDMAALANRPNSNGIGHDGEVGGWPQEFY----------RNVLKLPATVAVGP 232

Query: 233 ASNFLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESEL 292
           AS F   G  VG                 VAS  ID YA W G              S  
Sbjct: 233 ASTF--KGQRVG-----------------VAS-CIDCYASWFGVC------------STQ 260

Query: 293 ASSRLATVAGTSTCHITISKCPH-FMDGVWGPYRDAL--MPGYW-VTEGGQSCTGALLAH 348
               L  VAGTSTC++  S      + G+WGP+ + L      W V E GQS TG LL H
Sbjct: 261 PEQSLFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGRLLEH 320

Query: 349 VLKSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRS 408
           + ++HPA       A + G   F  + +R+ +++ + G  S+  L +H+F YG+  GNR+
Sbjct: 321 LFETHPAAR---DYAGDTG-RLFKDLEDRIADMEADSGC-SIHHLARHMFLYGELQGNRT 375

Query: 409 PIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQ-SGHEITSIYMSG 467
           P ADP M    +G++ D S  +LA+  +   EF+A QTRQIVE  +  +   I  + ++G
Sbjct: 376 PYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGELRVAG 435

Query: 468 GQCRNLVLIKLLANCT-KLPIVLP-KYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTI 525
            Q RN  L+ L++     +P+ +P +    A V G+ LLG A   +YL          ++
Sbjct: 436 SQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKA---RYLD--------VSL 484

Query: 526 VDQQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKR 585
           +D  R      P   +  T  +N    G   E  N+     RLL+ KY I LDM + Q+R
Sbjct: 485 LDVVRKPGATIPTVEV--TESSNYPACGATKE--NLR----RLLEAKYAIHLDMAQVQQR 536

Query: 586 YR 587
           YR
Sbjct: 537 YR 538

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 157/603 (26%), Positives = 260/603 (43%), Gaps = 97/603 (16%)

Query: 6   IGVDVGTESVRACVVDVHGTIL---SLASKPISRQEIQPNY-LTQSSNEIWRAICFCIRK 61
           IG+D+G+ SVR  + +     +    + + P        N+  TQSS EI  AI  C ++
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121
           +  D   +K   +G    ATCSL + +  T     +  N DD +++++ WMD  AI E  
Sbjct: 70  LNIDKHEIKSCGVG----ATCSLAIFQ--TKDNALIPWNLDDPDKNVVFWMDSIAIKETQ 123

Query: 122 EINSTGHRCLK-YVGGKMSIEMQIPKIKW----LKNNLPQGKFDKCEFYDLPDFLTYRAT 176
           E+N      ++ ++GG    EM +PK++     LKN      F   E  DL  ++     
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTF---EIIDLHRYIAMSLA 180

Query: 177 GNKCRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNF 236
                 + +      L  +G DG   GW    +E+                V+    +  
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYEN----------------VLQLPPNIV 224

Query: 237 LSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSR 296
           +    +  H S +           +  S  ID Y+ W   + + +             + 
Sbjct: 225 IGPTKHSQHSSKQG----------LKVSSCIDCYSNWFALLPSNL------------QNS 262

Query: 297 LATVAGTSTCHITIS-KCPHFMDGVWGPYRDAL--MPGYWVTEGGQSCTGALLAHVLKSH 353
           L  V GTSTC++  S +  H + GVWGP+ +       + + E GQSCTG L+ H+ K+H
Sbjct: 263 LFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKLIEHLFKTH 322

Query: 354 PAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADP 413
           PA      +        F  IN+ +E++ E+    S+    KH+FFYGD  GNR+P ADP
Sbjct: 323 PAS---SHIDTRDWPHLFSQINDFIEKV-EQNTQDSIHMQTKHMFFYGDLDGNRTPYADP 378

Query: 414 NMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVE--HIKQSGHEITSIYMSGGQCR 471
           +M    IG++ D S  +L    +   EFIA Q + ++   +      +I+++   G   +
Sbjct: 379 SMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISNLQFCGSLAK 438

Query: 472 NLVLIKLLANCTKLPIVLPKYIDAAVV--FGSALLGVAASEKYLHGCSDTASVSTIVDQQ 529
           N  L+ LLA       +    +D A++  +GS L+G A++       SD + V    +Q 
Sbjct: 439 NKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKAST-------SDKSIVEVAHNQ- 490

Query: 530 RITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDL 589
             T   +P +             G ++E          LL+ KY+I+ +M E Q++YR  
Sbjct: 491 --TYSYRPPEKT----------DGLLVE----------LLEVKYQIYFNMAEQQRKYRKQ 528

Query: 590 VTR 592
           V  
Sbjct: 529 VNN 531

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 123/489 (25%), Positives = 206/489 (42%), Gaps = 74/489 (15%)

Query: 6   IGVDVGTESVRACVVDVHGTILSLASK---PISRQEIQPNYLTQSSNEIWRAICFCIRKI 62
           IGVD+G+   R  + D +   L   +K   P  R       +TQ +++I  A+     K 
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRH--GNGIITQCTSDILTAV----EKA 59

Query: 63  ICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDD--FEQDIILWMDHRAIDEV 120
                + + +I  +G  ATCS+VV ++     +      D      DII WM   AI+E 
Sbjct: 60  FNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 121 NEINS-TGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNK 179
             +N+ T    L + GGK   EM IPK+  L N L   K D     DL  +L ++ +   
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHL-NKLY--KDDGLTVLDLHIWLLWKISLKL 176

Query: 180 CRSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSA 239
                  V +     +G DG   GW ++ +E + L                    N +  
Sbjct: 177 GHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQL--------------------NKIFI 216

Query: 240 GDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLAT 299
           G+      +E   D             ID YA W    +             + +  L  
Sbjct: 217 GNNAVIKKNEQFGD-----------SCIDCYASWFQCWSTA-----------MLNRTLFV 254

Query: 300 VAGTSTCHITISKC-PHFMDGVWGPYRDALM--------PGYWVTEGGQSCTGALLAHVL 350
           VAGTSTC +  S C   F+ G+WGP++D L+          Y V E G S TG LL  +L
Sbjct: 255 VAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRTGVLLEKLL 314

Query: 351 KSHPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPI 410
            +HPA        K+  ++  + + ++++ L E+   QS+  + K+ FF+ DY    S  
Sbjct: 315 STHPA-------VKDSDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFFHEDYEEFESSF 366

Query: 411 ADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQC 470
              +   +I+ +  + ++ DLA+  +   E +A Q   ++   ++    I+ + ++G Q 
Sbjct: 367 VQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITISKLLITGSQA 426

Query: 471 RNLVLIKLL 479
           +N  L+++L
Sbjct: 427 KNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 107/511 (20%), Positives = 195/511 (38%), Gaps = 89/511 (17%)

Query: 6   IGVDVGTESVRACVVDVHG--TILSLASKPISRQEIQPN--YLTQSSNEIWRAICFCIRK 61
           IG+DVG+ SVR  + +     TI ++  + + + E      + TQ++  +  +I   + +
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIFTALEE 64

Query: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTN----KGVAVGPNFDDFEQDIILWMDHRAI 117
           +  +S +VK  I G+   ATCS+V L+  +     + + +     +    II W DH A 
Sbjct: 65  LHVNSYIVK--ICGVS--ATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 118 DEVNEINS-----------TGHRCLKYVGGKMSI--EMQIPKIKWLKNNLPQGKFDKCEF 164
            E   +N+             ++ L  +G +     EM IPK+  L N + +G ++    
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 165 YDLPDFLTYRATGNKCRSFCSTV---CKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRRE 221
            ++ D   Y A     +   +TV    K  +  +G+DG  +GW      D+        E
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGW------DLSFYVWALPE 234

Query: 222 FSKLGGVVSSTASNFLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGI 281
            S    +  S   N                      T  +     ID YA W  T A   
Sbjct: 235 TSFPICIGPSKVIN---------------------ETSIVRPKSCIDCYASWFSTDACT- 272

Query: 282 TLGSDGQESELASSRLATVAGTSTC---HITISKCPHF------MDGVWGPYRDALMPGY 332
                          L   AGTSTC    +  S   +F      +   WGP+ + L    
Sbjct: 273 -----------KDDTLFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWGPFTNVLDKDK 321

Query: 333 WVT-EGGQSCTGALLAHVLKSHPAYDTLCKLAKNQGISK-FDFINNRLEELKEERGAQSV 390
             + E G S TG LL  +   H       ++  +  +++  +++ N++  + E + + S+
Sbjct: 322 KSSFEIGFSETGILLEKLFNKH-------QITASWSVAESINYVENQI-AIYERKKSHSI 373

Query: 391 AALGKHLFFYGDYHGNRSPIA--DPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQ 448
             L   ++ +  Y     P     P+         +  S   L    +   E++A Q   
Sbjct: 374 -YLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAILEYLAYQVSN 432

Query: 449 IVEHIKQSGHEITSIYMSGGQCRNLVLIKLL 479
           ++   ++    I  + +SG Q +N  L+ L+
Sbjct: 433 LILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>KLLA0E23013g Chr5 complement(2049719..2050726) [1008 bp, 335 aa]
           {ON} some similarities with uniprot|P53324 Saccharomyces
           cerevisiae YGR263C
          Length = 335

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 66/177 (37%), Gaps = 15/177 (8%)

Query: 309 TISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVL-KSHPAYDTLCKLAKNQG 367
            ++ CP  +D VW  Y +       +   G SC G L+ ++L K H    T+ K A    
Sbjct: 143 VMANCPETIDYVWKEYLELTETFTEINLIGDSCGGNLILNILLKCHENKMTIPKRA--IA 200

Query: 368 ISKFDFINNRLEELKEERGAQSVAALGKHLF--FYGDYHGNRSPIADPNMRATIIGQS-- 423
           IS +  + +R     E     +V  L   +   F   Y  N   + DP+     +  +  
Sbjct: 201 ISPWCNVLDRDSVDVERLNGYNVDMLSMKVLTVFQNSYMQN---VVDPSQYLKYLNFTSI 257

Query: 424 -----MDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVL 475
                 ++  D    +T G  E    Q    + HI  + + I  I+  G     LVL
Sbjct: 258 PRETWTEILSDTKLFITYGDLEMFKNQIELFINHISPNENLIAEIFPCGSHIEPLVL 314

>Kwal_14.2064 s14 (594241..595584) [1344 bp, 447 aa] {ON} YER136W
           (GDI1) - GDP dissociation inhibitor [contig 230] FULL
          Length = 447

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 11/100 (11%)

Query: 480 ANCTKLPIVLP-----KYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSE 534
           +N   + +++P     +  D  V   S    VA+   YL      A VSTI++      E
Sbjct: 317 SNADSVQVIIPQSQVGRKNDIYVAVMSDSHNVASKGHYL------AIVSTIIETDTPHVE 370

Query: 535 LKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYE 574
           L+P   +L T+     GI +I EP     S+   L + Y+
Sbjct: 371 LEPAFKLLGTIEERFMGIAEIFEPKESGSSDNVFLSRSYD 410

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 59/124 (47%), Gaps = 17/124 (13%)

Query: 397 LFFYGDYHGNRSPIADPNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIK-- 454
           + F   ++G  +P  DP+ RATI+G S   +   +A     A E +  Q R I++ +   
Sbjct: 610 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMSGD 666

Query: 455 --QSGHE---ITSIYMSGGQCRNLVLIKLLAN----CTKL---PIVLPKYIDAAVVFGSA 502
             + G+E   + ++ + GG  ++  ++++ A+    C KL   PIV    + AA+    A
Sbjct: 667 KIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRRSPIVECTALGAAIAANMA 726

Query: 503 LLGV 506
              V
Sbjct: 727 YKNV 730

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 275 GTIAAGITLGSDGQESELASSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPG 331
           GTI   IT G   Q S      + +VA    CH  ISK P+  + + GP R AL+ G
Sbjct: 562 GTIRENITYGVSRQPS---MEEIRSVAKKCFCHAFISKFPNGYETIIGP-RGALLSG 614

>SAKL0G10516g Chr7 (895476..896354) [879 bp, 292 aa] {ON} highly
           similar to uniprot|Q05533 Saccharomyces cerevisiae
           YDR287W inositol monophosphatase
          Length = 292

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 16/102 (15%)

Query: 232 TASNFLSAGDYVGHLSDEAAADLGLTTKCIVASGLIDAY-----------AGW-VGTIAA 279
           T  N LS  D  G++    +A       C VA+G++DAY           AGW +   + 
Sbjct: 186 TYKNLLS--DKGGYIHGSRSAGSAAMNMCYVANGMLDAYWEGGCWAWDVCAGWCILKESG 243

Query: 280 GITLGSDGQESELASSRLATVAGTSTCHITISKCPHFMDGVW 321
           GI +G +  E +++  R   +A    C    S+  +F+   W
Sbjct: 244 GIVVGGNKDEWDISVDRRCYLAVRGGCE--KSEQQYFVKSFW 283

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,057,997
Number of extensions: 2506428
Number of successful extensions: 5979
Number of sequences better than 10.0: 38
Number of HSP's gapped: 6036
Number of HSP's successfully gapped: 58
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)